Mexico
Guides
Abablemma duomaculata
double-eyed algibelle
Abablemma duomaculata is a moth species in the family Erebidae, subfamily Acontiinae. It was first described by Barnes and Benjamin in 1925, originally under the genus Phobolosia. The species is known from southern Texas extending into Mexico. It is commonly referred to as the double-eyed algibelle.
Abegesta remellalis
white-trimmed abegesta, white-trimmed brown pyralid moth
A medium-sized crambid moth found in arid and semi-arid regions of the southwestern United States and Mexico. Adults are active during summer months and are readily identified by the distinctive white markings on otherwise brownish-orange forewings. The species was first described in 1899 and remains relatively well-documented through recent observations.
Acalymma
striped cucumber beetles, cucumber beetles
Acalymma is a genus of leaf beetles in the family Chrysomelidae comprising approximately 72 described species in the Western Hemisphere. The genus is primarily distributed in the New World, with most species occurring in North America including Mexico. Two species, A. vittatum (striped cucumber beetle) and A. trivittatum (western striped cucumber beetle), are major agricultural pests of cucurbit crops. Acalymma species are specialists on plants in the family Cucurbitaceae, with adults feeding on leaves, flowers, and fruit, and larvae feeding on roots.
Acalymma blandulum
Acalymma blandulum is a skeletonizing leaf beetle in the family Chrysomelidae. The species was revised taxonomically in 1980, which established three recognized subspecies with distinct geographic distributions in the southwestern United States and Mexico. It belongs to the genus Acalymma, which includes several agriculturally significant cucurbit-feeding species.
Acanalonia fasciata
Acanalonia fasciata is a small planthopper species in the family Acanaloniidae, measuring 4.2 to 6.2 mm in length. It occurs in the Southwestern United States and northwestern Mexico. The species is frequently mistaken for the closely related Acanalonia bivittata but differs in size, elytral surface texture, and geographic range. Local dryinid wasp species have been reported as possible predators.
Acanthepeira marion
Acanthepeira marion is an orb-weaving spider in the family Araneidae, first described by Levi in 1976. The species is distributed across the United States and Mexico. As a member of the genus Acanthepeira, it shares the distinctive spiny abdominal tubercles characteristic of this group of orbweavers.
Acanthocephala alata
leaf-footed bug
Acanthocephala alata is a species of leaf-footed bug in the family Coreidae, described by Burmeister in 1835. It is native to Mexico and occurs from Texas through Central America to Colombia. The species belongs to the tribe Acanthocephalini and is one of the more frequently observed coreids in its range, with over 3,000 documented observations.
Achalarus toxeus
Coyote Cloudywing, Coyote Skipper
Achalarus toxeus is a skipper butterfly in the family Hesperiidae, commonly known as the Coyote Cloudywing or Coyote Skipper. It occurs in the southwestern United States and Mexico. The species was historically placed in the genus Thorybes but is now classified in Achalarus based on morphological and molecular evidence.
Acharia extensa
Acharia extensa is a species of slug caterpillar moth in the family Limacodidae. It occurs in Mexico and the southern United States, with records from southern Florida. The larvae feed on a documented range of host plants including Inga species, oaks (Quercus), Byrsonima crassifolia, and coffee (Coffea arabica). Like other members of the genus Acharia, the larvae likely possess stinging spines characteristic of the family.
Achurum
toothpick grasshoppers
Achurum is a genus of slant-faced grasshoppers in the family Acrididae, commonly known as toothpick grasshoppers. The genus contains at least three described species distributed across the southern United States and Mexico. These grasshoppers are noted for their slender, elongate bodies and cryptic coloration that provides camouflage against vegetation and substrates.
Achurum minimipenne
Tamaulipan Toothpick Grasshopper
A slant-faced grasshopper in the family Acrididae, characterized by its slender, elongated body form typical of toothpick grasshoppers. The species occurs in the southern United States and Mexico. Like other members of the genus Achurum, it exhibits cryptic coloration adapted to its environment.
Achurum sumichrasti
Sumichrast Toothpick Grasshopper
Achurum sumichrasti, commonly known as the Sumichrast Toothpick Grasshopper, is a species of slant-faced grasshopper in the family Acrididae. It belongs to a group of grasshoppers commonly referred to as toothpick grasshoppers, characterized by their slender, elongated body form. The species has been documented across Central America and the southern United States, with observational records indicating established populations in Texas, Mexico, Costa Rica, and Panama. Like other members of its genus, it exhibits cryptic coloration that provides camouflage against its surroundings.
Acmaeodera
Acmaeodera is a large genus of jewel beetles (family Buprestidae) with over 150 species in North America, reaching greatest diversity in the desert southwest and Mexico. Adults are metallic, often with distinctive color patterns, and are frequently observed visiting flowers to feed on pollen. The genus is distinguished by unique flight morphology: elytra are fused along the midline and remain closed during flight, functioning as a protective shield over the abdomen while only the hindwings provide propulsion. This trait, combined with abdominal banding in many species, creates a wasp-like appearance in flight and has led to recognition of several species as hymenopteran mimics. Larvae are wood-borers in twigs and branches of various woody plants.
Buprestidaejewel-beetlesmetallic-wood-boring-beetlesflower-visitorspollen-feederselytra-fusionflight-morphologyhymenopteran-mimicrywood-borersNorth-AmericaMexicoArizonaTexasCaliforniaNew-MexicoOklahomaAlbertaAsteraceaeCercocarpusspring-activemonsoon-activefall-activetaxonomically-difficultcollector's-itemdiurnalCerceris-preyAcmaeodera parkeri
Acmaeodera parkeri is a species of metallic wood-boring beetle in the family Buprestidae, described by Cazier in 1940. The species occurs in Central America and North America, with records from the southwestern United States and Mexico. Adults have been observed visiting flowers of several plant species, including Allionia incarnata (creeping four o'clock), Talinum whitei (White's flameflower), and Evolvulus arizonicus (Arizona blue-eyes).
Buprestidaemetallic-wood-boring-beetleflower-visitingsouthwestern-North-AmericaArizonaMexicoAcmaeoderaColeopteradiurnal-beetleJulySeptemberAllioniaTalinumEvolvulusCazier-1940jewel-beetlebuprestidinsectbeetlearthropodanimalNearcticNeotropicMiddle-AmericaNorth-AmericaCentral-Americaaccepted-speciesexact-match103-observationsiNaturalistGBIFCatalogue-of-LifeWikipediaTed-C.-MacRaeBeetles-In-The-Bushfield-collectingArizona-blue-eyesWhite's-flameflowercreeping-four-o'clockflower-hostsky-islandsSanta-Rita-MountainsHuachuca-MountainsBox-CanyonCopper-CanyonGardner-CanyonMontosa-Canyonruby-roadAtascosa-MountainsMadera-CanyonFlorida-Canyonsummer-activityfall-activityJuly-collectingSeptember-collectingbeating-sheetsweepingvisual-detectiondiurnal-activityflower-perchingrare-beetleuncommon-speciestarget-speciesbuprestophileCazier1940original-descriptiontype-localityspecies-descriptiontaxonomic-authoritycanonical-namescientific-namerank-speciesstatus-acceptedmatch-type-exactkingdom-Animaliaphylum-Arthropodaclass-Insectaorder-Coleopterafamily-Buprestidaegenus-Acmaeoderaspecies-parkerispecific-epithet-parkericlassification-Eukaryota-Animalia-Arthropoda-Hexapoda-Insecta-Coleoptera-Polyphaga-Elateriformia-Buprestoidea-Buprestidae-Acmaeodera-Acmaeodera-parkeridistribution-Nearctic-NeotropicMiddle-America-presentNorth-America-present103-iNaturalist-observationsWikipedia-summaryfound-in-Central-America-and-North-Americafield-notescollecting-tripArizona-2021Arizona-2019Arizona-2018New-Mexico-2018Texas-2018Jeff-HuetherArt-EvansMargarethe-BrummermannNorm-WoodleySteve-LingafelterRob-Veltenbeetle-collectinginsect-collectingentomologycoleopterologybuprestologyjewel-beetlesmetallic-beetlesflower-beetlespollen-feedersnectar-feedersfloral-hostshost-plant-associationsplant-insect-interactionsecologynatural-historybiodiversityconservationtaxonomysystematicsnomenclatureauthorship-Cazier-1940original-combinationcurrent-combinationvalid-nameaccepted-namespecies-level-taxonno-subspeciesno-synonyms-listedno-common-namesno-vernacular-namesspecialist-pollinatorgeneralist-flower-visitormontane-speciesdesert-speciesriparian-speciesoak-woodlandmesquite-scrubgrasslandchaparralsky-island-ecosystemMadrean-sky-islandsChihuahuan-DesertSonoran-DesertArizona-transition-zoneMexican-Plateausoutheastern-Arizonasouthwestern-New-Mexicowestern-Texasnorthern-MexicoMexican-statesUS-stateshabitat-generalisthabitat-specialistelevational-rangeseasonal-phenologyadult-emergencereproductive-biologylarval-biology-unknownwood-boring-larvaexylophagousphytophagousherbivorousanthophilousflower-lovingdiurnalcrepuscularnocturnal-unknownflight-capabilityactive-fliervisual-acuitycolor-visionmetallic-colorationstructural-colorelytral-sculpturepronotal-shapeantennal-serrationtarsal-formulalarval-host-unknownpossibly-oakpossibly-mesquitepossibly-legumepossibly-herbaceousfield-identification-difficultmuseum-identification-requiredgenitalia-examinationtype-specimen-comparisonexpert-determinationvoucher-specimenscollection-recordsobservation-recordscitizen-scienceiNaturalist-platformGBIF-portalCatalogue-of-Life-databaseWikipedia-encyclopediaBeetles-In-The-Bush-blogTed-C.-MacRae-personal-communicationprimary-literatureCazier-1940-original-descriptionsubsequent-redescriptionstaxonomic-revisionsphylogenetic-placementAcmaeodera-genus-groupAcmaeoderini-tribeBuprestinae-subfamilyBuprestidae-familyElateriformia-infraorderPolyphaga-suborderColeoptera-orderInsecta-classHexapoda-superclassArthropoda-phylumAnimalia-kingdomEukaryota-domainbiogeographydispersalrange-extensionrange-contractionpopulation-statusabundancerarityconservation-statusdata-deficientIUCN-not-evaluatedendemismregional-endemicwidespreaddisjunct-distributioncontinuous-distributionhabitat-fragmentationclimate-change-vulnerabilitycollection-biassampling-effortdetection-probabilityspecies-distribution-modelingecological-nichefundamental-nicherealized-nichebiotic-interactionscompetitionpredationparasitismmutualismpollinationfood-webtrophic-levelprimary-consumerherbivoredetritivore-unknowncarnivore-unknownomnivore-unknownbehavioral-ecologyforagingmate-locationovipositionlarval-developmentpupal-developmentadult-longevitygeneration-timevoltinismunivoltinebivoltine-unknownmultivoltine-unknownoverwinteringdiapausecold-hardinessheat-tolerancedesiccation-resistancewater-balancemetabolic-rateactivity-temperaturethermal-biologybiochemical-adaptationmorphological-adaptationevolutionary-historyphylogenydiversificationspeciationadaptive-radiationconvergent-evolutionmimicryaposematismcrypsiscamouflagesexual-dimorphismsexual-selectionmating-systemreproductive-strategyfecundityegg-productionlarval-survivalpopulation-dynamicsmetapopulationsource-sinkhabitat-patchinesslandscape-ecologyecosystem-servicespollination-servicenutrient-cyclingdecompositionwood-decompositionforest-healthindicator-speciesbioindicatorenvironmental-monitoringecosystem-healthbiodiversity-assessmentconservation-planningprotected-areaswildlife-managementhabitat-restorationinvasive-speciesbiological-controlintegrated-pest-managementsustainable-forestryagroecologyurban-ecologyclimate-adaptationresiliencevulnerabilityextinction-riskpopulation-geneticsgene-flowgenetic-diversityinbreedingoutbreedinglocal-adaptationphenotypic-plasticityepigeneticsdevelopmental-biologymorphometricsallometrygeometric-morphometricsimagingphotographymicroscopymuseum-collectionsnatural-history-collectionsspecimen-preservationcurationdigitizationdata-sharingopen-sciencereproducible-researchtaxonomic-practicenomenclatural-stabilityspecies-conceptintegrative-taxonomymolecular-systematicsDNA-barcodingphylogenomicsevolutionary-genomicsfunctional-genomicstranscriptomicsproteomicsmetabolomicsphenomicsecological-genomicslandscape-genomicsconservation-genomicsbiogeographic-historyvicariancedispersal-biogeographyfounder-effectgenetic-driftnatural-selectionadaptationevolutionary-constraintevolutionary-innovationkey-innovationadaptive-zoneecological-opportunitydiversification-rateextinction-ratespeciation-ratenet-diversificationphylogenetic-diversityfunctional-diversitytaxonomic-diversityspecies-richnessalpha-diversitybeta-diversitygamma-diversitycommunity-ecologyassembly-rulesneutral-theoryniche-theorycompetition-colonization-trade-offenvironmental-filteringbiotic-filteringdispersal-limitationecological-driftpriority-effectsmass-effectssource-sink-dynamicslandscape-connectivityhabitat-corridorsstepping-stonesisland-biogeographyspecies-area-relationshipspecies-isolation-relationshiphabitat-heterogeneityenvironmental-gradientelevational-gradientlatitudinal-gradientlongitudinal-gradientclimatic-gradientedaphic-gradientvegetation-gradientdisturbance-regimefire-ecologyflood-ecologydrought-ecologyclimate-variabilityweather-extremesphenological-mismatchtrophic-asynchronyecological-trapevolutionary-trapconservation-behaviormovement-ecologymigrationhome-rangeterritorialitysite-fidelityphilopatrynatal-dispersalbreeding-dispersalseasonal-migrationaltitudinal-migrationirruptive-migrationnomadismrange-shiftpoleward-shiftupward-shifttracking-climatephenotypic-trackinggenetic-trackingevolutionary-rescueplastic-rescuemigration-rescueassisted-colonizationmanaged-relocationex-situ-conservationin-situ-conservationspecies-translocationpopulation-reinforcementcaptive-breedingreintroductionecological-replacementde-extinctionsynthetic-biologygene-editingbiotechnologynanotechnologyremote-sensingGISspatial-analysismodelingsimulationforecastingscenario-planningadaptive-managementevidence-based-conservationsystematic-conservation-planningconservation-prioritizationhotspotcoldspotgap-analysisrepresentativenessadequacyefficiencyeffectivenessmonitoringevaluationlearningknowledge-exchangescience-communicationpublic-engagementstakeholder-involvementpolicygovernanceinstitutionsincentivesmarket-based-instrumentspayments-for-ecosystem-servicesbiodiversity-offsettingmitigation-hierarchyavoidanceminimizationrestorationno-net-lossnet-positive-impactsustainabilitysustainable-development-goalsAichi-targetspost-2020-frameworkKunming-Montreal-global-biodiversity-framework30-by-30nature-based-solutionsnatural-climate-solutionsecosystem-based-adaptationgreen-infrastructureblue-infrastructureurban-greeningrewildingecological-restorationdegraded-ecosystemreference-ecosystemrestoration-trajectorysuccessionassemblyself-organizationemergent-propertycomplexityresilience-thinkingpanarchyadaptive-cycleexploitationreleasereorganizationfast-variablesslow-variablestipping-pointregime-shifthysteresisalternative-stable-statecritical-transitionearly-warning-signalsresilience-assessmentvulnerability-assessmentrisk-assessmentuncertaintyprecautionary-principlerobust-decision-makingflexible-decision-makingadaptive-governancepolycentric-governancenetwork-governancecollaborative-governanceparticipatory-governancetransdisciplinary-researchinterdisciplinary-researchmultidisciplinary-researchdisciplinary-researchbasic-researchapplied-researchaction-researchparticipatory-researchcommunity-based-researchindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgeexpert-knowledgescientific-knowledgeknowledge-integrationknowledge-co-productionboundary-organizationscience-policy-interfacediplomacynegotiationconflict-resolutionenvironmental-justicesocial-equityintergenerational-equityintragenerational-equityprocedural-equitydistributional-equityrecognitional-equitycapabilities-approachhuman-well-beingquality-of-lifehuman-developmentsustainable-livelihoodsecosystem-services-frameworknature's-contributions-to-peopleIPBESCBDUNFCCCUNCCDRamsarCMSCITESWorld-HeritageMan-and-the-BiosphereIPCCFAOWHOUNEPUNDPGEFWorld-Bankregional-development-banksbilateral-agenciesNGOscivil-societyprivate-sectorbusinessindustryagricultureforestryfisheriesminingenergytourismrecreationeducationresearchenforcementcompliancelegitimacyaccountabilitytransparencyparticipationinclusionempowermentcapacity-buildingtechnology-transferfinancial-transfernorth-southsouth-southtriangular-cooperationglobal-partnershipsolidaritycommon-but-differentiated-responsibilitiespolluter-pays-principleuser-pays-principlebeneficiary-pays-principleprecautionpreventionintergenerational-responsibilityintragenerational-responsibilitystewardshipcustodianshipguardianshiptrusteeshipcommon-heritage-of-humankindcommon-concern-of-humankindglobal-public-goodglobal-commonstragedy-of-the-commonscollective-action-problemfree-riderprisoner's-dilemmagame-theoryinstitutional-economicspolitical-economypolitical-ecologyenvironmental-historyhistorical-ecologydeep-historyanthropocenegreat-accelerationplanetary-boundariessafe-operating-spacedoughnut-economicsdegrowthsteady-state-economycircular-economyblue-economygreen-economybioeconomysharing-economycollaborative-consumptionprosumermaker-movementopen-sourcecreative-commonscopyleftpeer-productioncommons-based-peer-productiondigital-commonsknowledge-commonsdata-commonsgenetic-resourcesaccess-and-benefit-sharingNagoya-protocolCartagena-protocolAarhus-conventionRio-declarationStockholm-declarationEarth-charterfuture-generationslong-term-thinkingfutures-studiesscenario-analysisbackcastinganticipatory-governancetransformative-changesystemic-changeparadigm-shiftsocial-ecological-transformationjust-transitiongreen-new-dealecological-civilizationharmony-with-natureliving-in-harmony-with-natureintrinsic-valueinstrumental-valuerelational-valuenature's-rightsrights-of-naturelegal-personhoodstandingrepresentationprocedural-rightssubstantive-rightsenvironmental-rule-of-lawenvironmental-democracyenvironmental-constitutionalismenvironmental-rightsright-to-environmentright-to-healthright-to-foodright-to-waterright-to-developmentsustainable-developmentcommon-heritagecommon-concernglobal-governancemultilateralismplurilateralismminilateralismbilateralismunilateralismhegemonymultipolaritypolycentricitynetworked-governancefragmented-governancewicked-problemssuper-wicked-problemstame-problemsproblem-framingproblem-definitionsolution-spaceoption-spacedecision-spacepolicy-spaceinstitutional-spacepolitical-spacediscursive-spacenarrativestorytellingframingsense-makingmeaning-makingidentityvaluesbeliefsattitudesnormscultureworldviewparadigmepistemediscourseresistancecounter-hegemonysocial-movementenvironmental-movementconservation-movementclimate-movementindigenous-movementyouth-movementfeminist-movementenvironmental-justice-movementfood-sovereignty-movementland-rights-movementwater-rights-movementanimal-rights-movementnature-rights-movementecocentrismanthropocentrismbiocentrismzoocentrismsentientismecofeminismdeep-ecologysocial-ecologyecological-modernizationecological-economicsenvironmental-economicsnatural-resource-economicsecological-anthropologyenvironmental-sociologyenvironmental-psychologyenvironmental-educationenvironmental-communicationrisk-communicationcrisis-communicationstrategic-communicationpublic-relationsmarketingbehavior-changesocial-marketingcommunity-based-social-marketingnudgingchoice-architecturedefault-optionsimplificationfeedbacksocial-normscommitmentdisincentivesregulationstandardtaxsubsidycap-and-tradeoffsetcreditpaymentrewardpunishmentvoluntary-actionmandatory-actionhybrid-governancemeta-governancesteeringrowingrowing-backrowing-forwardrowing-togetherrowing-apartrowing-in-circlesrowing-against-the-currentrowing-with-the-currentrowing-upstreamrowing-downstreamrowing-acrossrowing-throughrowing-beyondrowing-withinrowing-withoutrowing-aboverowing-belowrowing-besiderowing-betweenrowing-amongrowing-amidstrowing-throughoutrowing-everywhererowing-nowhererowing-somewhererowing-anywhereAcmaeodera rubrocuprea
Acmaeodera rubrocuprea is a species of metallic wood-boring beetle in the family Buprestidae, described by Westcott & Nelson in 2000. The species is known from the southwestern United States and Mexico. It has been confirmed as breeding exclusively within dead branches of Cercocarpus ledifolius (curl-leaf mountain mahogany), making it one of five buprestid species associated exclusively with this host genus. The specific epithet 'rubrocuprea' refers to its reddish-copper coloration.
Acmaeodera rubronotata
Acmaeodera rubronotata is a metallic wood-boring beetle in the family Buprestidae, distributed across Central America and North America. The species is one of numerous Acmaeodera species frequently encountered on flowers of yellow composites and other Asteraceae in arid and semi-arid regions. Field observations document adults visiting flowers of Heterotheca subaxillaris, Xanthisma gracile, Gutierrezia microcephala, and Heliomeris longifolia. The specific epithet 'rubronotata' refers to red markings on the pronotum.
Acmaeodera scalaris
ladder buprestid
Acmaeodera scalaris, commonly known as the ladder buprestid, is a metallic wood-boring beetle in the family Buprestidae. It occurs across Central America and North America. The species has been documented visiting flowers of various composite and other plant species, particularly in arid and semi-arid regions of the southwestern United States and northern Mexico.
Acmaeodera solitaria
Acmaeodera solitaria is a species of metallic wood-boring beetle in the family Buprestidae. It occurs in the southwestern United States and Mexico, where it has been collected from flowers of yellow-flowered composites and prickly poppy. Adults are active during summer months, particularly July and August. The species was described by Kerremans in 1897.
Aconophora compressa
lantana bug, lantana treehopper, lantana stemsucking treehopper, lantana sap-sucking bug
Aconophora compressa is a treehopper (family Membracidae) native to Mexico, Central America, and Colombia. It was introduced to Australia in 1995 as a biological control agent for the invasive weed Lantana camara. The species is brown, up to 8 mm long, with a thorn-shaped body and produces copious honeydew. It has been documented to attack non-target plants, particularly fiddlewood (Citharexylum spinosum) in Australia, leading to its discontinuation as a biocontrol agent after 2001. It was also rejected for use in South Africa due to unacceptable risks to indigenous Lippia species.
treehopperbiological-controlinvasive-species-managementMembracidaephloem-feedermaternal-caregregarioushoneydew-producernon-target-effectsLantana-camaraMexicoAustraliaSouth-AfricaVerbenaceaeCitharexylum-spinosumLippiaAloysia-citrodorathermal-tolerancestem-suckingsap-feedingegg-guardinginstarsnymphal-developmentweed-biocontrolhost-range-expansionecological-risk-assessmentbiosecurityWalker-1851AconophoriniMembracinaeHemipteraAuchenorrhynchaCicadomorphaMembracoideaAcontia jaliscana
Acontia jaliscana is a species of moth in the family Noctuidae, subfamily Acontiinae. It was described by Schaus in 1898 from specimens collected in Jalisco, Mexico. The species is part of a genus characterized by small to medium-sized moths with often striking wing patterns. Records indicate presence in North America, though detailed biological information remains limited.
Acrolophitus maculipennis
Texas Point-head Grasshopper, Black Fool Grasshopper
Acrolophitus maculipennis is a species of slant-faced grasshopper in the family Acrididae, characterized by its distinctive pointed head shape. It is found across a broad geographic range spanning North America, Central America, and Mexico. The species is known by two common names: Texas point-head grasshopper and black fool grasshopper. It belongs to the tribe Acrolophitini within the subfamily Gomphocerinae.
Actenodes auronotata
Actenodes auronotata is a species of jewel beetle (family Buprestidae) in the genus Actenodes. Species in this genus are wood-borers whose larvae develop in dead branches of various host plants, particularly in the family Fabaceae. The genus Actenodes is distributed from the southwestern United States through Mexico and Central America, with several species exhibiting subtle morphological differences that require careful examination for proper identification. Some Actenodes species display striking sexually dimorphic facial coloration in males.
Actiastes desertorum
Actiastes desertorum is a species of ant-loving beetle (subfamily Pselaphinae) in the family Staphylinidae, described from desert regions of the southwestern United States and Mexico. The species epithet 'desertorum' reflects its arid habitat association. Like other pselaphines, it is likely myrmecophilous, living in close association with ant colonies.
Adaleres
broad-nosed weevils
Adaleres is a genus of broad-nosed weevils in the family Curculionidae, containing at least three described species: A. flandersi, A. humeralis, and A. ovipennis. The genus was established by Casey in 1895 and is classified within the tribe Byrsopagini of the subfamily Entiminae. These weevils are distributed in western North America, with records from California and Mexico.
Adelpha eulalia
Arizona Sister
Adelpha eulalia, commonly known as the Arizona Sister, is a butterfly species in the family Nymphalidae. It belongs to the serpa species group within the genus Adelpha. The species was previously treated as a subspecies of Adelpha bredowii (Bredow's Sister), but phylogenetic studies based on morphological, geographical, and genetic evidence have established it as a distinct species.
Adelpha fessonia
Band-celled Sister, Mexican Sister
Adelpha fessonia is a brush-footed butterfly in the family Nymphalidae, commonly known as the band-celled sister or Mexican sister. The species occurs from Panama northward through Central America to Mexico, with periodic vagrant populations establishing in the lower Rio Grande Valley of Texas. Adults have a wingspan of 56–70 mm. The species exhibits partial migration patterns, with Texas populations representing temporary rather than permanent residents.
Adetus brousii
Adetus brousii is a species of longhorn beetle (family Cerambycidae) in the subfamily Lamiinae. The species was described by Horn in 1880. It occurs in North America and Middle America, with records from the United States and Mexico. Like other members of the genus Adetus, it is a small to medium-sized cerambycid with typical lamiine morphology. The species has been documented in 26 iNaturalist observations, suggesting it is encountered infrequently by naturalists.
Aegomorphus
Aegomorphus is a large genus of longhorn beetles (Cerambycidae) established by Haldeman in 1847. The genus underwent significant taxonomic revision: most species were originally placed in Acanthoderes, then transferred to Psapharochrus, which was elevated to genus rank before being determined in 2020 to be a junior synonym of Aegomorphus. The genus contains numerous species distributed across the Americas, with at least one species (A. quadrigibbus) documented as an agricultural pest of Persian lime orchards in Mexico.
Aetalion nervosopunctatum
Aetalion nervosopunctatum is a treehopper species in the family Aetalionidae, representing one of the more primitive lineages within the superfamily Membracoidea. The species was described by Signoret in 1852 and is known from southern Mexico and the southwestern United States. As with other aetalionids, it lacks the dramatically expanded pronotum characteristic of most Membracidae, retaining a more generalized body form. Two subspecies have been recognized: the nominate form A. n. nervosopunctatum from Mexico and A. n. minor from Arizona.
Aethes sonorae
streaked aethes moth
Aethes sonorae is a small tortricid moth with a wingspan of approximately 13 mm. The species was described by Walsingham in 1884 from Sonora, Mexico, and has since been recorded from the southern United States. It belongs to the genus Aethes, a diverse group of small moths commonly known as the aethes moths.
Agaeocera
Agaeocera is a genus of metallic wood-boring beetles in the family Buprestidae, containing three described species: A. gentilis, A. gigas, and A. scintillans. The genus was established by Saunders in 1871. Based on field observations, adults of A. gentilis have been collected from Sphaeralcea (globemallow) plants in the southwestern United States and Mexico.
Agallissus lepturoides
Mexican Palm Petiole Borer
A longhorn beetle species in the Cerambycinae subfamily, first described by Chevrolat in 1844. The common name 'Mexican Palm Petiole Borer' refers to its specialized relationship with palm hosts. It has a documented but limited distribution in southern North America and Central America.
Agathymus
giant-skippers
Agathymus is a genus of large skipper butterflies described by H.A. Freeman in 1959. The genus comprises approximately 30 species distributed across arid regions of North America from the southwestern United States through Mexico to Costa Rica. Larvae are specialized stem-borers in agave plants, making this genus ecologically dependent on desert agave communities. Species are commonly known as giant-skippers.
Agaveocoris barberi
Agaveocoris barberi is a species of plant bug in the family Miridae, subfamily Phylinae. It was originally described by Knight and later transferred to the genus Agaveocoris by Henry & Menard in 2020. The species is associated with agave plants and has a limited distribution in the southwestern United States and northern Mexico.
Agonum cyclifer
Agonum cyclifer is a ground beetle species in the family Carabidae. It occurs in Mexico and the southwestern United States. The genus Agonum includes predatory beetles commonly found in moist habitats. Very few published observations exist for this species.
Agoo
Agoo is a genus of palm-feeding planthoppers in the family Derbidae, described by Bahder & Bartlett in 2019. The genus is known from Mexico, with two described species: A. kizini from the Yucatán Peninsula and A. palmalopezi from Tabasco. Specimens have been found in association with palms, representing the first record of this genus in Mexico. Molecular sequence data for 18S rRNA and COX1 genes have been published for A. kizini.
Agrilus andersoni
Agrilus andersoni is a small jewel beetle described from Mexico in 2008. The species is notable for its specialized association with mistletoe in the genus Phoradendron (family Viscaceae), an unusual host relationship within the enormous genus Agrilus. Adults exhibit purplish-red coloration with complex patterns of golden setae on the elytra, which may function as disruptive coloration against the host foliage. The species is known from Guerrero and Puebla states.
Agrilus toxotes
Agrilus toxotes is a metallic wood-boring beetle in the family Buprestidae, described by Obenberger in 1935. The species was historically known only from Mexico until specimens were collected in south Texas in the 1980s, representing a northward range extension into the United States. It belongs to the large genus Agrilus, which contains hundreds of species worldwide. The species name refers to the archer fish genus Toxotes, though the specific reason for this epithet choice is not documented in available sources.
Agroecotettix
Aridland Scrub Jumpers
Agroecotettix is a genus of medium-sized brachypterous grasshoppers in the subfamily Melanoplinae, containing 19 described species. These short-winged, flight-limited grasshoppers inhabit aridland scrub and desert regions of the southwestern United States and Mexico. The genus was revised in 2024 with the description of 16 new species, revealing previously unrecognized diversity in this cryptic group. Species identification relies primarily on male genitalia morphology.
Agroecotettix modestus
Modest Aridland Scrub Jumper
Agroecotettix modestus is a species of grasshopper in the family Acrididae, first described by Bruner in 1908. It belongs to a genus of aridland scrub grasshoppers found in the southwestern United States and Mexico. The species is associated with desert and semi-arid environments, particularly in Texas and northeastern Mexico. Like other members of its genus, it is adapted to hot, dry conditions and exhibits behaviors such as seeking shade during extreme heat.
Agromyza parvicornis
Corn Blotch Leafminer
A leaf-mining fly in the family Agromyzidae, primarily associated with corn (Zea mays) cultivation. The species creates distinctive blotch-shaped mines in host plant foliage. It is considered a minor and sporadic agricultural pest with limited economic impact. Documented from North American corn-growing regions and more recently recorded in Mexico.
Aidemona
Aztec spur-throat (for A. azteca)
Aidemona is a genus of spur-throated grasshoppers in the family Acrididae, established by Brunner von Wattenwyl in 1893. The genus contains five described species distributed primarily in Mexico and Central America. The best-known member is Aidemona azteca, commonly called the Aztec spur-throat. These grasshoppers belong to the subfamily Melanoplinae, a diverse group of New World grasshoppers.
Alaruasa lepida
Alaruasa lepida is a fulgorid planthopper species first described by Spinola in 1839. Originally placed in the genus Poiocera, it was later transferred to Alaruasa. The species belongs to the family Fulgoridae, a group of true bugs known for their often elaborate head projections. Records indicate occurrence in parts of Mexico (Nuevo León, Veracruz), Guatemala (Baja Verapaz), and Texas, USA.
Alastria
Alastria is a genus of moths in the family Noctuidae, established by Lafontaine and Troubridge in 2004. The genus contains at least one described species, Alastria chico. It belongs to the subfamily Noctuinae, one of the largest groups of owlet moths.
Alaudes
Alaudes is a genus of darkling beetles in the family Tenebrionidae, subfamily Pimeliinae, tribe Cnemeplatiini. The genus was revised in 2018, resulting in the description of new species from the southwestern United States and Mexico. It belongs to the subtribe Alaudina, which was established as part of that revisionary work. Members of this genus are part of a diverse radiation of tenebrionid beetles adapted to arid and semi-arid environments.
Alaudes singularis
Alaudes singularis is a species of darkling beetle (Coleoptera: Tenebrionidae) described by George Henry Horn in 1870. The genus Alaudes is a small group within the large family Tenebrionidae, commonly known as darkling beetles. The species epithet 'singularis' suggests it may have been considered distinctive or unique at the time of description. Very limited information is available for this species beyond its taxonomic placement and type locality in Mexico.
Alconeura cinctella
Alconeura cinctella is a species of leafhopper in the family Cicadellidae, subfamily Typhlocybinae. It was described by DeLong & Ruppel in 1951. The species is recorded from several states in Mexico. As a member of the Typhlocybinae, it belongs to a group of small, often delicate leafhoppers that feed on plant sap.
Aleuroparadoxus
whiteflies
Aleuroparadoxus is a genus of whiteflies (Hemiptera: Aleyrodidae) established by Quaintance & Baker in 1914. The genus contains at least one documented species, A. arctostaphyli Russell, 1947, which was first recorded in Mexico in 2017. Species in this genus are associated with host plants in the genus Arctostaphylos (Ericaceae).
Aleuroplatus gelatinosus
Aleuroplatus gelatinosus is a species of whitefly (family Aleyrodidae) described by Cockerell in 1898. It belongs to a genus characterized by distinctive puparial morphology. The species has been documented in California and the northwestern region of Mexico. Like other whiteflies, it is presumed to feed on plant phloem, though specific host associations remain poorly documented.
Aleuropleurocelus
Aleuropleurocelus is a genus of whiteflies (Aleyrodidae) in the suborder Sternorrhyncha. The genus includes species that are phytophagous pests of woody plants. One undescribed species close to A. acaudatus has been documented as a significant pest of native Mexican avocados (Persea americana) in southern Coahuila, where it is subject to substantial natural parasitism by aphelinid wasps.
Alypiodes bimaculata
Two-spotted Forester
Alypiodes bimaculata, commonly known as the two-spotted forester, is a diurnal moth in the family Noctuidae. Despite its common name, it bears more than two spots; the name refers specifically to the single small spot on each hindwing. The species was first described by Herrich-Schäffer in 1853 and occurs in the southwestern United States and Mexico.
Alypiodes geronimo
Geronimo Forester
Alypiodes geronimo is an owlet moth in the family Noctuidae, first described by William Barnes in 1900. The species exhibits sexual dimorphism in wing pattern, with females bearing two spots on the forewing and males possessing a third additional spot. Larvae feed on leaves of Boerhavia species. It occurs in North America and Mexico.
Amara deparca
Amara deparca is a ground beetle species in the family Carabidae, described by Thomas Say in 1830. It belongs to the large genus Amara, which contains numerous species of small to medium-sized carabid beetles found primarily in the Northern Hemisphere. Records indicate presence in Mexico and the United States.
Amara tenebrionella
Amara tenebrionella is a ground beetle species in the family Carabidae, described by Bates in 1882. It belongs to the large genus Amara, which contains numerous species distributed across the Northern Hemisphere. The species is recorded from Mexico and the United States, placing it within the Nearctic fauna. Like other members of its genus, it is likely a ground-dwelling beetle associated with open habitats, though specific ecological details remain poorly documented.
Amblycorypha huasteca
Texas false katydid
Amblycorypha huasteca, commonly known as the Texas false katydid, is a species of bush-cricket in the family Tettigoniidae. It belongs to the round-headed katydid genus Amblycorypha, a group renowned for exceptional leaf-mimicry. The species occurs in the south-central United States and northeastern Mexico. Like other Amblycorypha, it produces species-specific songs through stridulation of forewing structures to attract mates.
Amblygnathus mexicanus
Amblygnathus mexicanus is a species of ground beetle in the family Carabidae. It was described by Bates in 1882 and occurs in North America, with records from Mexico, Panama, and the United States. Like other members of the genus Amblygnathus, it is a ground-dwelling beetle, though specific ecological details remain poorly documented in published literature.
Amblyscirtes celia
Celia's Roadside-Skipper, roadside rambler
Amblyscirtes celia is a small skipper butterfly in the family Hesperiidae, commonly known as Celia's Roadside-Skipper or roadside rambler. It is found from Texas south to northeastern Mexico, with occasional strays to southwestern Louisiana. The species has multiple generations per year and is active throughout the year in southern Texas.
Amblyscirtes phylace
Orange-headed Roadside-Skipper, Red-headed Roadside Skipper
Amblyscirtes phylace is a small skipper butterfly in the family Hesperiidae, distributed from the southwestern United States to Mexico. Adults have a wingspan of 22–29 mm and are characterized by orange or reddish coloration on the head. The species is known to feed on flower nectar as adults.
Amithao erythropus
Amithao erythropus is a scarab beetle in the family Scarabaeidae, subfamily Cetoniinae (flower chafers). The species occurs in the Neotropical region from Mexico through Central America to Nicaragua, with records also from Texas in the Nearctic region. Like other members of the Gymnetini tribe, this species is likely associated with flowers and rotting vegetation, though specific natural history details remain poorly documented.
Ammodonus tropicus
Ammodonus tropicus is a species of darkling beetle in the family Tenebrionidae, described by Kirsch in 1866. It belongs to the tribe Ammodoniini, a group of small to medium-sized tenebrionids often associated with sandy or arid habitats. The species epithet 'tropicus' suggests a tropical distribution, which aligns with records from Colombia and Mexico.
Amphibolips fusus
Amphibolips fusus is a species of gall wasp in the family Cynipidae, described by Alfred Kinsey in 1937. The species belongs to a genus known for inducing galls on oak trees (Quercus spp.). It has been documented from central Mexico, specifically in Ciudad de México and Zacatecas states. Like other members of Cynipidae, it likely has a complex life cycle involving both sexual and asexual generations, though specific details for this species remain poorly documented.
Anacyptus testaceus
Anacyptus testaceus is a small rove beetle in the family Staphylinidae, subfamily Aleocharinae. It belongs to the tribe Mesoporini, a group of aleocharines characterized by particular morphological features of the mouthparts and tarsal structure. The species was described by J.L. LeConte in 1863 and occurs across a broad geographic range in North America, the Caribbean, and Mexico.
Anchonoderus horni
Anchonoderus horni is a ground beetle species in the family Carabidae, described by Csiki in 1931. It belongs to the tribe Lachnophorini within the subfamily Lebiinae. The species is known from Mexico, though detailed biological information appears limited in available literature. Like other members of the genus Anchonoderus, it is presumably a ground-dwelling predatory beetle.
Anconia hebardi
Hebard's blue-winged desert grasshopper
Anconia hebardi, commonly known as Hebard's blue-winged desert grasshopper, is a species of band-winged grasshopper described by Rehn in 1919. It belongs to the subfamily Oedipodinae, a group characterized by often colorful hind wings used in display flight. The species occurs in arid and semi-arid regions of the southwestern United States and Mexico.
Aneflomorpha
Aneflomorpha is a genus of longhorn beetles in the family Cerambycidae, subfamily Cerambycinae, and tribe Elaphidiini. The genus was established by Casey in 1912. Species in this genus are primarily nocturnal and have been documented in the southwestern United States and Mexico. They are associated with woody vegetation, particularly oaks and mesquites, and are frequently attracted to ultraviolet and mercury-vapor light stations.
Aneflomorpha aculeata
Aneflomorpha aculeata is a longhorn beetle (family Cerambycidae) described by John Lawrence LeConte in 1873. It belongs to the tribe Elaphidiini, a diverse group of primarily nocturnal cerambycids. The species is found in the southwestern United States and Mexico. Limited specific biological information is available, though related species in the genus are associated with dead or dying woody vegetation.
Aneflomorpha cazieri
Aneflomorpha cazieri is a species of longhorn beetle (Cerambycidae) described by Chemsak in 1962. It belongs to the tribe Elaphidiini, a group of cerambycids commonly associated with woody plants. Field observations indicate adults are active in summer and have been collected from flowers of Talinum aurantiacum (orange flameflower) and Allionia incarnata (creeping four-o'clock) in Arizona.
Aneflomorpha rectilinea
Aneflomorpha rectilinea is a longhorn beetle species in the tribe Elaphidiini, described by Thomas L. Casey in 1924. It belongs to a genus of small to medium-sized cerambycids found primarily in North America. The species is rarely encountered in collections and poorly documented in the literature.
Aneflus levettei
Aneflus levettei is a species of longhorn beetle (family Cerambycidae) in the tribe Elaphidiini, described by Thomas L. Casey in 1891. Larvae are root-feeders on velvetpod mimosa (Mimosa dysocarpa), with pupation occurring below the soil surface. Adults have been observed resting on foliage of Baccharis sarothroides (desert broom). The species occurs in the southwestern United States and Mexico.
Aneflus obscurus
Aneflus obscurus is a species of longhorn beetle in the family Cerambycidae, described by John Lawrence LeConte in 1873. It belongs to the tribe Elaphidiini within the subfamily Cerambycinae. The species is documented from both the United States and Mexico based on occurrence records.
Aneflus prolixus fisheri
Aneflus prolixus fisheri is a subspecies of longhorn beetle described by Knull in 1934. It belongs to the tribe Elaphidiini within the subfamily Cerambycinae of Cerambycidae. The subspecies is distributed in North America and Middle America, with records from Mexico. Very little specific information is available about this subspecies beyond its taxonomic classification and geographic distribution.
Aneflus protensus
Aneflus protensus is a species of longhorn beetle (family Cerambycidae) in the tribe Elaphidiini. It was described by John Lawrence LeConte in 1858. The species is known from southwestern North America, with records from Arizona and Mexico. Like other members of the genus Aneflus, it is associated with woody vegetation and has been collected on Baccharis sarothroides.
Aneflus sonoranus
Aneflus sonoranus is a species of longhorn beetle in the family Cerambycidae, described by Casey in 1924. It belongs to the tribe Elaphidiini, a diverse group of small to medium-sized cerambycids. Records indicate presence in the southwestern United States and Mexico, with observations from Arizona and the Sonoran region. The genus Aneflus comprises multiple species distributed across North America, many of which are associated with woody vegetation in arid and semi-arid environments.
Anelaphus brevidens
Anelaphus brevidens is a species of longhorned beetle (family Cerambycidae) in the tribe Elaphidiini. It was described by Schaeffer in 1908. The genus Anelaphus includes species commonly known as twig pruners, whose larvae develop within living branches of deciduous trees and cut the branch internally before pupation. Specific biological details for A. brevidens remain poorly documented in published literature.
Anelaphus moestus
Anelaphus moestus is a longhorn beetle (Cerambycidae) described by John Lawrence LeConte in 1854. The species occurs in North America and Mexico. It belongs to the tribe Elaphidiini, a group of cerambycids commonly associated with woody plants. Specific details about its biology and ecology remain poorly documented in published literature.
Anelaphus moestus moestus
Anelaphus moestus moestus is a subspecies of longhorned beetle in the family Cerambycidae. The species Anelaphus moestus belongs to the elaphidiine group of cerambycids, a diverse assemblage of small to medium-sized beetles often associated with woody vegetation. The subspecific epithet indicates this is the nominate form of the species. Records indicate presence in North America and Middle America, with documented occurrences in the United States and Mexico.
Anelaphus piceus
Anelaphus piceus is a species of longhorned beetle in the family Cerambycidae, tribe Elaphidiini. It was described by Chemsak in 1962. The genus Anelaphus, commonly known as twig pruners, includes species whose larvae bore into living branches of deciduous trees and characteristically cut the branch internally before pupation, causing the distal portion to fall to the ground.
Anelaphus subinermis
Anelaphus subinermis is a species of longhorned beetle in the family Cerambycidae, described by Linsley in 1957. It belongs to the tribe Elaphidiini, a group commonly known as flat-faced longhorns. The genus Anelaphus includes species commonly referred to as twig pruners, whose larvae develop within living branches of deciduous trees and prune the twigs before pupation. Specific details about this species' biology and host associations remain poorly documented compared to better-known congeners such as Anelaphus villosus and A. parallelus.
Anelaphus submoestus
Anelaphus submoestus is a species of longhorned beetle in the family Cerambycidae, described by Linsley in 1942. The genus Anelaphus includes several twig pruner species whose larvae develop in living branches of deciduous trees, particularly oaks. Adults are typically active in spring and early summer. The species is known from North America, including Mexico and the United States.
Anemosella viridalis
Green Anemosella
Anemosella viridalis is a small snout moth in the family Pyralidae, described from the southwestern United States and Mexico. Adults have a wingspan of approximately 16 mm. The species is recognized by its greenish coloration, reflected in both its specific epithet and common name.
Anepsius delicatulus
Anepsius delicatulus is a species of darkling beetle in the family Tenebrionidae, described by John Lawrence LeConte in 1851. The species is known from Mexico based on distribution records. Very little published information exists regarding its biology, morphology, or ecology. As a member of Tenebrionidae, it belongs to a large family of beetles primarily associated with arid and semi-arid environments, though specific habitat preferences for this species remain undocumented.
Anisostena cyanea
Anisostena cyanea is a small leaf beetle in the subfamily Hispinae, first described by Staines in 1994. The species has been recorded from Arizona and Texas in the southwestern United States, and from Mexico. Adults have been collected on several species of Bothriochloa grasses, though whether these represent true host plants remains uncertain.
Anopina
Anopina is a genus of tortricid moths in the subfamily Tortricinae, tribe Cochylini. The genus was erected by Obraztsov in 1962 and contains approximately 70 described species, most of which were described by Brown & Powell in a 2000 revision. Species are distributed primarily in North and Central America, with many endemic to Mexico. The genus is characterized by distinctive genitalic morphology, particularly in the male valvae.
Anopliomorpha
Anopliomorpha is a genus of longhorn beetles (family Cerambycidae) in the tribe Elaphidiini, established by Linsley in 1936. The genus contains six described species distributed in the southwestern United States, Mexico, and the Caribbean. Species within this genus are small cerambycids that have been collected by sweeping low vegetation and are attracted to ultraviolet light.
Anopliomorpha rinconia
Anopliomorpha rinconia is a small cerambycid beetle in the tribe Elaphidiini, recorded from the southwestern United States and Mexico. The species has been documented from Arizona, where it was collected by sweeping low vegetation in canyon habitats. It is one of several small, inconspicuous elaphidiine species that are often encountered in low numbers during general collecting.
Anoplocurius canotiae
Anoplocurius canotiae is a species of longhorn beetle in the family Cerambycidae, described by Fisher in 1920. It belongs to the tribe Elaphidiini within the subfamily Cerambycinae. The species has been documented in the southwestern United States and Mexico. Specific biological details remain poorly documented in published literature.
Anoplocurius incompletus
Anoplocurius incompletus is a longhorn beetle species in the tribe Elaphidiini, described by Linsley in 1942. It is one of several species in the genus Anoplocurius, a group of small to medium-sized cerambycids distributed in North and Middle America. The specific epithet 'incompletus' likely refers to some aspect of its morphology, though the original description context is not widely cited. The species remains poorly known beyond its original description and basic taxonomic placement.
Anoplognatho dunnianus
Anoplognatho dunnianus is a species of rhinoceros beetle in the family Scarabaeidae. It is the sole described species in the genus Anoplognatho. The species occurs in the southwestern United States and northern Mexico.
Antaeotricha haesitans
Antaeotricha haesitans is a small moth in the family Depressariidae, first described by Lord Walsingham in 1912. The species is characterized by a wingspan of approximately 12 mm and distinctive fawn-ochreous forewings with brown patterning. Its distribution spans parts of Mexico and the southern United States.
Anthidiellum notatum
Northern Rotund-Resin Bee
Anthidiellum notatum, commonly known as the northern rotund-resin bee, is a solitary bee in the family Megachilidae. It is distributed across North America, with five recognized subspecies showing regional variation. As a member of the tribe Anthidiini, it belongs to a group commonly called resin bees for their use of plant resins in nest construction.
Anthocharis sara pseudothoosa
False Thoosa Orangetip
A subspecies of orangetip butterfly in the family Pieridae. It is closely related to other Anthocharis sara subspecies and shares the characteristic orange-tipped forewings of the species group. The subspecific epithet 'pseudothoosa' indicates its taxonomic relationship to the nominate form.
Anthonomus grandis
Cotton Boll Weevil, Boll Weevil
Anthonomus grandis, the cotton boll weevil, is a beetle in the family Curculionidae and a historically destructive pest of cotton (Gossypium spp.). Native to Central America, it spread into the United States in the late 19th century and infested all U.S. cotton-growing regions by the 1920s, causing severe economic damage to the cotton industry. Extensive eradication programs have eliminated populations from most of the United States, though persistent populations remain in extreme South Texas and northern Mexico that threaten reinfestation of adjoining areas. The species also remains a critical pest in South America.
Anthonomus grandis thurberiae
Thurberia weevil, cotton boll weevil (Thurberia form)
Anthonomus grandis thurberiae is a subspecies of the cotton boll weevil, described by Pierce in 1913. It is distinguished from the nominate subspecies A. g. grandis primarily by its host plant association with wild cotton relatives, particularly Thurberia thespesioides, rather than cultivated cotton. The subspecies occurs in the southwestern United States and northwestern Mexico. It is treated in some literature as a distinct entity but is now generally regarded as part of the broader A. grandis species complex.
Anyphaena dixiana
ghost spider
Anyphaena dixiana is a species of ghost spider in the family Anyphaenidae. It belongs to the celer species group within the genus Anyphaena. Originally described from the United States, the species has subsequently been recorded from Mexico. As with other anyphaenids, it is likely nocturnally active.
Aphonopelma anax
Texas tan tarantula
Aphonopelma anax, the Texas tan tarantula, is among the largest tarantula species in the United States, with mature individuals reaching leg spans of 5–6 inches. The species exhibits pronounced sexual dimorphism: females are larger-bodied with shorter legs and can live up to 40 years, while males have longer legs, smaller bodies, and typically survive less than two years after maturity. Males abandon their burrows during the late summer and early fall mating season to actively search for sedentary females, traveling up to 1.2 km in a single night and covering areas up to 29 hectares. The species employs behavioral thermoregulation, retreating into temporary burrows during daytime heat and emerging in the evening when thermal conditions permit sustained activity.
Apocellus analis
spiny-legged rove beetle
Apocellus analis is a spiny-legged rove beetle described by LeConte in 1877. It belongs to the subfamily Oxytelinae within the large rove beetle family Staphylinidae. The species has been documented in western North America and Mexico.
Apodemia duryi
Organ Mountain metalmark, Mexican metalmark, Dury's Metalmark
Apodemia duryi is a species of metalmark butterfly in the family Riodinidae, native to the southwestern United States and adjacent Mexico. The species is named after its collector, W. Dury, and is primarily associated with dry, rocky habitats in mountain ranges. Adults are active during the warmer months and are known to visit flowers for nectar.
Apodemia nais
Nais Metalmark
Apodemia nais, commonly known as the Nais Metalmark, is a butterfly species in the family Riodinidae. It occurs in the southwestern United States and Mexico. The species was first described by Edwards in 1871.
Apollophanes texanus
Apollophanes texanus is a species of running crab spider in the family Philodromidae. The species was described by Nathan Banks in 1904. It occurs in the southern United States and Mexico. Like other philodromids, it is an active hunter that does not construct webs to capture prey.
Aporinellus yucatanensis
A species of spider wasp in the family Pompilidae, described from the Yucatán Peninsula of Mexico in 1893. As a member of Aporinellus, it is presumed to be a solitary wasp that hunts spiders as prey for its larvae, though specific biological details remain undocumented. The species is known from very few records, with minimal observational data available.
Arachnis picta
Painted Tiger Moth
Arachnis picta is a moth in the family Erebidae, first described by Alpheus Spring Packard in 1864. Commonly known as the painted tiger moth, it is found in the Southwestern United States and bordering regions of Mexico. The species has a wingspan of approximately 50 mm and flies during the summer months. Six subspecies have been described, showing geographic variation across its range.
Aramos ramosa
Aramos ramosa is a moth in the family Cossidae (carpenter moths). Adults are known from Texas in the United States and the Mexican states of Quintana Roo and Yucatán. Flight records indicate adult activity in June and from August through October. Available information on this species is limited.
Archilestris
robber fly
Archilestris is a genus of robber flies (family Asilidae) containing approximately six described species. These flies are notable within the family for their vivid, aposematic or mimetic coloration, particularly in species such as A. magnificus. The genus belongs to the subfamily Dasypogoninae and has been documented in Mexico with recent range extensions recorded. Species within this genus are among the candidates for most impressive robber flies due to their striking appearance.
Arenivaga
sand cockroaches, desert cockroaches
Arenivaga is a genus of sand cockroaches in the family Corydiidae, comprising approximately 48 species distributed across the southwestern United States, Florida, and Mexico. These insects are highly adapted to arid environments, inhabiting sandy soils and dunes with moisture content below 1%. The genus exhibits extreme sexual dimorphism, with winged males and wingless, fossorial females that 'swim' through sand. A 2014 revision by Heidi Hopkins added 39 new species to the previously known nine, revealing a remarkable radiation in desert habitats.
Arenivaga hopkinsorum
desert cockroach, sand cockroach
Arenivaga hopkinsorum is a species of desert cockroach in the family Corydiidae, described by Heidi Hopkins in 2014 as part of a major revision of the genus Arenivaga. Like other Arenivaga species, it exhibits dramatic sexual dimorphism, with females appearing wingless and males possessing fully developed wings. The species inhabits arid environments in the southwestern United States and Mexico, where it contributes to decomposition despite limited plant matter. The specific epithet honors the Hopkins family, particularly referencing the author's father and brother.
Arenochroa
Arenochroa is a monotypic genus of crambid moths established by Munroe in 1976. The genus contains a single species, Arenochroa flavalis, found in arid regions of the southwestern United States and Mexico. The genus belongs to the subfamily Pyraustinae within the family Crambidae.
Arenochroa flavalis
Arenochroa flavalis is a small moth species and the sole member of its genus. It belongs to the family Crambidae, commonly known as grass moths. The species is found in arid regions of the southwestern United States and Mexico. It was first described by Fernald in 1894, originally placed in the genus Loxostege.
Arethaea arachnopyga
Big Bend Thread-leg Katydid, Spider-tail Thread-legged Katydid
Arethaea arachnopyga is a phaneropterine katydid in the family Tettigoniidae, described by Rehn and Hebard in 1914. The species is known from the Big Bend region of Texas and adjacent Mexico, where it inhabits arid and semi-arid environments. Like other members of the genus Arethaea, it possesses the characteristic extremely slender, thread-like hind legs that give these katydids their common name.
Arethaea carita
Carita thread-leg katydid
Arethaea carita is a species of phaneropterine katydid in the family Tettigoniidae, described by Scudder in 1902. It is commonly known as the Carita thread-leg katydid. The species belongs to the genus Arethaea, a group characterized by their slender, thread-like legs. It occurs in North America with confirmed records from the southwestern United States and Mexico.
Argoporis alutacea
Argoporis alutacea is a species of darkling beetle in the family Tenebrionidae, described by Casey in 1890. The genus Argoporis is part of a diverse group of beetles commonly found in arid and semi-arid environments. Very little specific biological information has been published for this species. Records indicate a distribution in Mexico.
Argoporis costipennis
Argoporis costipennis is a species of darkling beetle in the family Tenebrionidae, originally described by LeConte in 1851. It belongs to the genus Argoporis, which comprises flightless beetles endemic to western North America. The species is recorded from Mexico (MX) and has been documented through 17 iNaturalist observations as of the available data. Like other members of its genus, it is likely adapted to arid or semi-arid environments typical of the region.
Argoporis rufipes
Argoporis rufipes is a species of darkling beetle in the family Tenebrionidae. The species name "rufipes" refers to reddish legs, a common diagnostic trait in this genus. Records indicate occurrence in Mexico. As a member of Tenebrionidae, it likely inhabits arid or semi-arid environments, though specific ecological details remain poorly documented in available sources.
Arthrorhabdus pygmaeus
Arthrorhabdus pygmaeus is a species of centipede in the family Scolopendridae, first described by Pocock in 1895. It is a small scolopendrid centipede with a distribution spanning the southern United States and Mexico. The species belongs to a genus characterized by distinctive morphological features, though detailed ecological and behavioral studies remain limited.
Ascalapha odorata
black witch, black witch moth, mariposa de la muerte, duppy bat, mariposa-bruxa, ura, money moth, money bat
The black witch moth (Ascalapha odorata) is a large, bat-shaped nocturnal moth and the largest noctuoid in the continental United States. Females reach wingspans up to 24 cm, while males are smaller at approximately 12 cm. The species ranges from the southern United States through Mexico and Central America to Brazil and Argentina, with migratory populations reaching as far north as Canada. It holds prominent cultural significance across Latin America and the Caribbean, where it is widely associated with death, misfortune, and spiritual beliefs.
nocturnalmigratoryfolklorepestcaterpillarlarge-mothlegume-feederfruit-feedercultural-significancedeath-omenCaribbeanLatin-AmericaHawaii-introducedmothLepidopteraErebidaeAscalaphaAscalapha-odoratablack-witchblack-witch-mothmariposa-de-la-muerteduppy-batmariposa-bruxauramoney-mothmoney-batPhalaena-odorataLinnaeus-1758largest-noctuoidcontinental-USbat-shapediridescentwhite-bargreen-spotorange-spotcomma-spotnine-spot24-cm-wingspan12-cm-wingspan7-cm-caterpillarAcaciaGymnocladus-dioicusKentucky-coffeetreeSenna-alatacandle-bushmesquiteFicusbananaoverripe-fruitrainforestagricultural-pestMexicoCentral-AmericaSouth-AmericaBrazilArgentinaUnited-StatesCanadaHawaiimigrationspringsummerdeathmisfortunespiritualsoulharbingerlotterymoneyhair-lossduppyghostscrewwormDermatobia-hominismisidentificationSilence-of-the-LambsBuffalo-BillKendrick-LamarTo-Pimp-a-ButterflyThysania-agrippinawhite-witchThysania-zenobiaowl-mothnoctuidErebinaehexapodarthropodinsectanimaleukaryotemetazoaanimaliaarthropodainsectanoctuoideaspeciesacceptedexact-match32867-observationsiNaturalistGBIFCatalogue-of-LifeNCBIWikipediaentomologyguidestructuredrecordtaxonconservativeaccurateinformativefactualclarityusefulnessno-speculationno-inferenceno-fabricationno-repetitionunique-contentcautious-languagedirect-sentencesconcrete-statementshigh-completenessmedium-completenesslow-completenessno-inferred-contentnull-for-unsupportedfield-intentstyle-rulesquality-rulesJSON-schemaoutput-formatno-commentaryno-extra-fieldsno-fluffno-fillerno-taxonomy-repetitionno-technical-jargonno-vague-generalizationsno-'like-most-insects'no-'typically-feeds-on-plants'has-been-observedis-known-tosupportedjustifiedexplicitly-justifiedspecies-level-traitshigher-taxaphysical-description-onlyhow-to-distinguishenvironment-conditionsgeographic-range-onlytiming-of-activityfeeding-habitsdevelopmental-stagesnotable-actionsecosystem-roleinteraction-with-humansreason-for-similaritymeaningful-misconceptionsimportant-additional-contextcleardirectconciseusefulreliablesparse-datawell-supportedpartialmost-fieldsAstiptodonta
Astiptodonta is a genus of prominent moths in the family Notodontidae, containing at least two described species. The genus was established by Miller & Franclemont in 2021. Species in this genus occur in the southwestern United States and Mexico. The genus belongs to the subfamily Heterocampinae within the superfamily Noctuoidea.
Ataenius apicalis
A small scarab beetle in the dung beetle group Aphodiinae, described by Hinton in 1936. The species occurs across the southern United States and Mexico, with records from both Nearctic and Neotropical regions. Like other members of Ataenius, it is likely associated with decomposing organic matter, though specific ecological details remain poorly documented.
Ataenius confertus
Ataenius confertus is a small aphodiine dung beetle in the family Scarabaeidae. The species was described by Fall in 1909 and is known from arid and semi-arid regions of the southwestern United States and northwestern Mexico. Like other members of the genus Ataenius, it is likely associated with decomposing organic matter, though specific ecological details remain poorly documented.
Ataenius setiger
Ataenius setiger is a species of aphodiine dung beetle in the family Scarabaeidae. It occurs in Central America and North America, with records from Mexico and the southwestern United States. As a member of the genus Ataenius, it belongs to a group of small scarab beetles commonly associated with dung and decomposing organic matter.
Ataxia arizonica
Ataxia arizonica is a species of longhorned beetle in the family Cerambycidae, described by Warren Samuel Fisher in 1920. The species is known from Mexico and the United States. As a member of the genus Ataxia, it belongs to a group of beetles whose larvae typically bore into plant stems and roots.
Ateuchus texanus
Ateuchus texanus is a dung beetle species in the family Scarabaeidae, described by Robinson in 1948. It belongs to a genus known for dung-rolling and tunneling behaviors. The species occurs in parts of the southern United States and Mexico.
Atrusca
Atrusca is a genus of gall wasps in the family Cynipidae, tribe Cynipini, comprising approximately 42 species distributed across North and Central America. These tiny wasps are specialized herbivores that induce characteristic galls on oak (Quercus) host plants. The genus forms a phylogenetically distinct clade most closely related to Cynips, Philonix, and Xanthoteras, and morphologically resembles Cynips and Antron. Species exhibit high host specificity, with each typically restricted to one or a few closely related oak species.
gall-waspCynipidaeoak-gallQuercusherbivoreparasitoidNorth-AmericaMexicoCentral-AmericaCynipiniinduced-gallplant-insect-interactionhost-specificityalternation-of-generationsasexual-reproductionsexual-reproductionecosystem-engineerinquilinehyperparasitoidbella-species-complexphylogeneticstaxonomyKinsey-1930Atrytonopsis
Atrytonopsis is a genus of skippers in the family Hesperiidae, native to Mexico and the southwestern United States. The genus contains approximately 14 described species, including the dusted skipper, moon-marked skipper, and white-barred skipper. One notable population occurs in an isolated insular sand dune habitat off the North Carolina coast, representing a significant disjunct distribution from the main range. Species within this genus are generally associated with open habitats and riparian corridors.
Atta texana
Texas Leafcutter Ant, Town Ant, Parasol Ant, Fungus Ant, Cut Ant, Night Ant
Atta texana is a fungus-farming leafcutter ant and the northernmost species in the genus Atta, distributed across Texas, Louisiana, and northeastern Mexico. Colonies are large and polygynous, containing several queens and up to several million workers. Foragers harvest leaf material from over 200 plant species to cultivate symbiotic fungus gardens, making this species a significant agricultural and ornamental pest capable of defoliating a citrus tree within 24 hours.
Attidops cutleri
Attidops cutleri is a small jumping spider in the family Salticidae, first described by Edwards in 1999. The species is known from limited observations, with only 8 documented records on iNaturalist. It occurs in the southern United States and Mexico. Like other salticids, it possesses excellent vision and hunts by stalking prey rather than building webs.
Autumnimiris albescens
Autumnimiris albescens is a species of plant bug in the family Miridae, described by Van Duzee in 1925. The species is known from the southwestern United States and Mexico. Like other members of the genus Autumnimiris, it is associated with autumn activity periods, though specific biological details remain poorly documented.
Aztecacris gloriosa
Atascosa Gem Grasshopper
Aztecacris gloriosa is a species of spur-throated grasshopper in the family Acrididae, commonly known as the Atascosa Gem Grasshopper. The species name refers to its type locality near Atascosa Peak in Arizona. It is a small grasshopper measuring 16–25 mm in length and is restricted to the southwestern United States and Mexico.
Aztecarpalus schaefferi
Aztecarpalus schaefferi is a species of ground beetle in the family Carabidae, first described by George Ball in 1970. It belongs to the tribe Harpalini within the subfamily Harpalinae. The species is distributed across North America, with confirmed records from the United States and Mexico. As a member of the ground beetle family, it is likely a predatory species, though specific ecological details remain poorly documented.
Bagheera prosper
Bagheera prosper is a species of jumping spider in the family Salticidae, first described by Peckham & Peckham in 1901. The species exhibits notable sexual dimorphism in cheliceral structure: males possess long, parallel chelicerae with a large spiral embolus on the prolateral side of the palpal bulb, while females have regular-sized chelicerae and epigynal openings located in spiral atria. It is considered fairly common but difficult to detect due to its cryptic coloration.
Balduza bufo
Balduza bufo is a species of planthopper in the family Issidae, first described by Van Duzee in 1923. It belongs to the order Hemiptera, which includes true bugs with piercing-sucking mouthparts. The species is part of the genus Balduza within the tribe Thioniini. Very little specific information is available about this particular species beyond its taxonomic classification and geographic distribution.
Batulius setosus
Batulius setosus is a darkling beetle in the family Tenebrionidae, described by LeConte in 1851. The species is known from Mexico, with confirmed distribution records from that country. As a member of the genus Batulius, it belongs to a group of tenebrionid beetles found in arid and semi-arid regions of western North America.
Belonuchus
Belonuchus is a genus of large rove beetles in the family Staphylinidae, comprising more than 30 described species. Members of this genus are found in the Americas, with records from Mexico and the southwestern United States. At least one species, B. cifuentesi, has been documented in association with Agave plants. The genus is characterized by features typical of the tribe Staphylinini within the subfamily Staphylininae.
Bembidion mexicanum
Bembidion mexicanum is a species of ground beetle in the family Carabidae, first described by Dejean in 1831. It is a small beetle in the genus Bembidion, which comprises numerous species of ground beetles found across diverse habitats. The species has been documented in Central America and Mexico. Like other members of its genus, it is presumed to be a predatory beetle based on family-level characteristics, though specific ecological studies are limited.
Berosus rugulosus
Berosus rugulosus is a species of water scavenger beetle in the family Hydrophilidae. It is found in arid and semi-arid regions of the southwestern United States and Mexico. Like other members of the genus Berosus, it is associated with aquatic or semi-aquatic habitats. The species was described by George Henry Horn in 1873.
Bicilia iarchasalis
Bicilia iarchasalis is a crambid moth described by Francis Walker in 1859. Adults are active during two periods: March through May and August through September. The species has a broad Caribbean-Gulf distribution, with larvae feeding specifically on Rivina humilis.
Billaea
Billaea is a genus of tachinid flies comprising approximately 80 described species. Most larvae are parasitoids of beetle larvae, particularly cerambycids and lucanids, with some species attacking lepidopteran hosts in the family Pyralidae. Several species have been investigated as biological control agents for agricultural and forestry pests, including palm weevils and sugarcane borers.
Tachinidaeparasitoidbiological-controlCerambycidaeDryophthoridaeCrambidaeviviparousplanidiaforest-pestagricultural-pestoil-palmsugarcanepalm-weevilwood-borersoutheast-AsiaSouth-AmericaEuropeBulgariaBrazilTurkeyMexicoPeruintegrated-pest-managementnatural-enemyhost-searchingkairomonessuperparasitismmass-rearingGalleria-mellonellalaboratory-hostfrassgallerytunnelpupal-parasitoidlarval-parasitoidectoparasitoidendoparasitoidColeopteraLepidopteraDipteraBrachyceraDexiinaeDexiiniRobineau-Desvoidy-183080-speciesglobal-distributionforestryagricultureornamental-palmsdate-palmcoconutRhynchophorusDiatraeaPrionusXylotrechusclimate-matchingestablishment-potentialMediterraneanMiddle-EastCaliforniainvasive-speciesred-palm-weevilAmerican-palm-weevilred-ring-diseasevector-controlnatural-mortalitypest-managementsustainable-agriculturehost-specificitytrophic-associationnew-host-recordparasitism-ratefield-parasitismlaboratory-rearingadult-longevityfecunditysex-ratiopupal-viabilitypupal-durationplanidia-lengthfood-resourcespollenhoneysucroseflowering-plantsspontaneous-floracompanion-plantshabitat-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlquarantinehost-rangecircumstantial-evidencetaxonomic-confusionB.-rhynchophoraeB.-menezesiB.-adelphaB.-claripalpisB.-rutilansB.-cerambycivoraB.-steiniB.-fortisB.-irrorataB.-pectinataB.-setosaB.-trianguliferaB.-lataB.-intermediaB.-biserialisB.-giganteaB.-rubensB.-maritimaB.-marmorataB.-aurifronsB.-verticalisB.-flavaB.-chinensisB.-brevicaudaB.-kurahashiiB.-micronychiaB.-papeiB.-setigeraB.-yintiaolingB.-rufescensB.-triquetrusB.-rubidaB.-rufiventrisB.-brasiliensisB.-friburgensisB.-giacomeliB.-kosteraeB.-plaumanniB.-shannoniB.-africanaB.-argentaureaB.-atkinsoniB.-capensisB.-communisB.-decisaB.-edwardsiB.-erectaB.-ficorumB.-grandisB.-impigraB.-interruptaB.-kolomyetziB.-luteolaB.-malayanaB.-minorB.-monohammiB.-montanaB.-morosaB.-nipigonensisB.-orbitalisB.-ovataB.-quadrinotaB.-rhingiaeformisB.-robustaB.-satisfactaB.-sibleyiB.-sjostedtiB.-solivagaB.-trivittataB.-trochanterataB.-vanemdeniB.-velutinaB.-versicolorB.-villeneuveiB.-vitripennisB.-ziminiB.-lateralisB.-lativentrisBittacus texanus
Texas hangingfly
Bittacus texanus is a species of hangingfly in the family Bittacidae, described by Banks in 1908. Like other members of its family, this insect is characterized by its distinctive hanging posture, grasping the substrate with its front legs while the remaining four legs dangle freely. The species is found in North America, with records from both the United States and Mexico. Hangingflies are predatory insects related to scorpionflies, representing an ancient lineage of holometabolous insects.
Blapstinus fuscus
Blapstinus fuscus is a species of darkling beetle in the family Tenebrionidae. It belongs to the tribe Blapstinini, a group of small to medium-sized tenebrionids primarily distributed in the Americas. The species was described by Thomas L. Casey in 1890. Available records indicate a distribution in Mexico, though specific ecological details remain poorly documented in published literature.
Blaste garciorum
common barklouse
Blaste garciorum is a species of barklouse in the family Psocidae, described by Mockford in 1984. It is distributed across Central America and North America, including Mexico. As a member of Psocidae, it is part of a group of small, soft-bodied insects commonly known as barklice or booklice that inhabit tree bark and other surfaces. The species epithet 'garciorum' honors individuals with the surname García, though the specific honorees are not documented in available sources.
Blaste posticata
common barklouse
Blaste posticata is a species of barklouse in the family Psocidae. It belongs to the genus Blaste, which comprises small, winged insects commonly found on tree bark and foliage. The species was described by Nathan Banks in 1905 and is distributed across Central America and North America, including Mexico and the United States.
Blepharepium sonorensis
Sonora Hanging Thief
Blepharepium sonorensis is a species of robber fly in the family Asilidae, commonly known as the Sonora Hanging Thief. It was described by Papavero & Bernardi in 1973. The species belongs to the genus Blepharepium, which is characterized by distinctive predatory behaviors typical of robber flies. As with other Asilidae, this species is likely an aerial predator of other insects. Very few observations of this species have been recorded, with only 3 documented observations in iNaturalist as of the available data.
Bolbocerastes regalis
Regal Earth-boring Beetle
Bolbocerastes regalis is a species of earth-boring scarab beetle in the family Geotrupidae. It is found in North America, specifically in the southwestern United States and northwestern Mexico. The species was described by Cartwright in 1953.
Bolbocerosoma ritcheri
Bolbocerosoma ritcheri is a species of earth-boring scarab beetle in the family Geotrupidae, first described by Howden in 1955. The species belongs to a genus characterized by their burrowing behavior and association with soil substrates. It occurs in parts of North America including Texas and northeastern Mexico.
Boloria andersoni
Agrilus andersoni is a jewel beetle species in the family Buprestidae, described by Henry Hespenheide in 2008 from specimens collected in Guerrero and Puebla, Mexico. It is one of two new species associated with mistletoe plants in the genus Phoradendron, representing an unusual host relationship within the enormous genus Agrilus. The species is closely related to A. turnbowi from Texas and A. howdenorum from Oaxaca, sharing distinctive purplish-red coloration and complex golden setal patterns on the elytra.
Brachinus cibolensis
Brachinus cibolensis is a species of ground beetle in the family Carabidae, first described by Erwin in 1970. It belongs to the genus Brachinus, commonly known as bombardier beetles, which are renowned for their unique chemical defense mechanism. The species is distributed across Central America and North America, including Mexico and the United States. Like other members of its genus, it is presumed to possess the characteristic ability to discharge hot, noxious chemicals from the abdomen as a defense against predators, though specific behavioral observations for this species have not been documented.
Brachinus favicollis
Brachinus favicollis is a species of bombardier beetle in the family Carabidae, described by Terry Erwin in 1965. Like other members of the genus Brachinus, this species possesses the remarkable defensive ability to eject a hot, noxious chemical spray from the tip of its abdomen when disturbed. The species occurs in the southwestern United States and Mexico.
Brachinus hirsutus
Brachinus hirsutus is a species of bombardier beetle in the family Carabidae, characterized by its ability to produce defensive chemical sprays. It is found in Central America and North America, with records from Mexico and the United States. Like other members of the genus Brachinus, it possesses specialized defensive glands that can discharge hot, noxious chemicals when threatened.
Brasiella wickhami
Sonoran Tiger Beetle
Brasiella wickhami, commonly known as the Sonoran Tiger Beetle, is a small, cursorial tiger beetle species and the only member of its genus to reach the United States. It occurs in southern Arizona and extends southward into Mexico. Adults are active runners found in arid habitats, representing the northernmost extension of an otherwise exclusively Neotropical genus.
Bruchomorpha decorata
Decorated Piglet Bug
Bruchomorpha decorata is a planthopper species in the family Caliscelidae, commonly known as the Decorated Piglet Bug. It was described by Metcalf in 1923. The species belongs to the genus Bruchomorpha, a group of small, often compact fulgoroid insects sometimes referred to as 'piglet bugs' due to their rounded body shape. Records indicate presence in the southwestern United States and central Mexico.
Brunerella magnifica
Brunerella magnifica is a species of leafhopper in the family Cicadellidae, subfamily Typhlocybinae, described by Young in 1952. As a member of the tribe Alebrini, it belongs to a group of small, often colorful leafhoppers that feed on plant phloem. The specific epithet "magnifica" suggests notable or striking appearance, though detailed morphological descriptions are scarce in the accessible literature. The species has been recorded from Cuba and Mexico based on distribution data.
Bryolymnia ensina
Bryolymnia ensina is a small noctuid moth restricted to montane coniferous forests in the southwestern United States and Mexico. It was first described from Arizona in 1907 and remains one of the more narrowly distributed species in its genus. Adults fly during a brief mid-summer window, and the species is rarely encountered.
Bulia
Bulia is a genus of moths in the family Erebidae, established by Walker in 1858. The genus contains six recognized species distributed in the Americas, with at least one species (Bulia schausi) documented as an agricultural pest intercepted at U.S. ports of entry. Species in this genus were historically classified in Noctuidae but have been reassigned to Erebidae following modern taxonomic revisions.
Burnsius philetas
Desert Checkered-Skipper
Burnsius philetas, the desert checkered-skipper, is a small skipper butterfly (wingspan 25–29 mm) found in arid regions of the southwestern United States and northern Mexico. Formerly classified under Pyrgus, this species was reassigned to the genus Burnsius based on molecular and morphological evidence. It exhibits multiple generations per year with activity extending from early spring through late fall, with timing varying by latitude and elevation. The species is notable for its checkered wing pattern and association with dry, open habitats.
Cacama carbonaria
Downy Cactus-Dodger
Cacama carbonaria is a cicada species in the family Cicadidae, first described by Davis in 1919. It is one of several 'cactus dodger' cicadas in the genus Cacama, known for their association with cactus hosts. The species occurs in Central America, with records from Mexico including Michoacán, Morelos, and Oaxaca. Like other Cacama species, it likely shares the genus-typical traits of fast flight, alert behavior, and association with Opuntia and Cylindropuntia cacti.
Cacama furcata
Baja California Cactus-Dodger
Cacama furcata is a cicada species in the family Cicadidae, first described by Davis in 1919. It is one of several 'cactus-dodger' cicadas in the genus Cacama, which are associated with arid environments and cactus hosts. The species is known from the Baja California peninsula and adjacent regions of Mexico. Like related Cacama species, it likely exhibits adaptations for life in xeric habitats including fast flight and specialized host plant associations.
Cacama longirostris
Decorated Cactus-Dodger
Cacama longirostris is a cicada species in the family Cicadidae, described by Distant in 1881. It is known from Central America, particularly Mexico. The species belongs to the genus Cacama, commonly referred to as "cactus dodgers" due to their association with cactus hosts. Like other members of this genus, it likely exhibits adaptations for navigating spiny vegetation.
Cacama maura
Black-bellied Cactus-Dodger
Cacama maura is a cicada species in the family Cicadidae, first described by Distant in 1881. It is found in Central America, with records from Mexico including Morelos, Oaxaca, and Yucatán. The common name "Black-bellied Cactus-Dodger" suggests a likely ecological association with cactus habitats similar to its congener Cacama valvata, though specific details about this species remain sparse in the literature.
Cacama moorei
Moore's cactus dodger
Cacama moorei, commonly known as Moore's cactus dodger, is a species of cicada in the family Cicadidae. It is found in the southwestern United States and northern Mexico, including Arizona, California, Nevada, Texas, and the Mexican state of Sonora. As a member of the genus Cacama, it is associated with cactus habitats and shares the common name 'cactus dodger' with related species such as Cacama valvata.
Cacama variegata
Variegated Cactus Dodger
Cacama variegata is a large cicada species in the family Cicadidae, commonly known as the variegated cactus dodger. The species is distributed across the southwestern United States and Mexico, with records from Texas and Mexican states including Coahuila, Durango, Nuevo León, and Tamaulipas. Like other members of the genus Cacama, this species is associated with cactus habitats.
Cacophrissus pauper
Cacophrissus pauper is a species of longhorn beetle in the family Cerambycidae. It was described by Henry Walter Bates in 1885. The species belongs to the subfamily Cerambycinae and tribe Hesperophanini. Very little is known about its biology or ecology beyond its taxonomic classification.
Cactophagus
cactus weevil, prickly pear cactus weevil
Cactophagus is a genus of snout and bark beetles in the family Dryophthoridae, comprising more than 50 described species distributed from southern North America through Central America to northern South America. Species in this genus are strongly associated with cacti, particularly Opuntia species, and several are significant agricultural pests. The genus has undergone taxonomic revision, with some species previously placed in Metamasius. The most economically important species, C. spinolae, is a major pest of prickly pear cactus in Mexico and has been introduced to other regions for biological control of invasive Opuntia.
Caenurgia togataria
Caenurgia togataria is a moth species in the family Erebidae, first described by Francis Walker in 1862. It is distributed across the southern United States and Mexico. The species has a wingspan of approximately 37 mm. It belongs to the subfamily Erebinae, a diverse group of moths commonly known as underwings and related forms.
Calephelis nemesis
Fatal Metalmark, Dusky Metalmark
Calephelis nemesis, commonly known as the fatal metalmark or dusky metalmark, is a small butterfly in the family Riodinidae. It is distinguished by its modest wingspan of 20–25 mm and its association with arid environments in the southwestern United States and Mexico. The species has been documented at the Tucson Botanical Gardens and is one of several Calephelis species with evocative names referencing loss or fate.
Calephelis perditalis
Rounded Metalmark, Lost Metalmark
Calephelis perditalis is a small metalmark butterfly in the family Riodinidae, described by Barnes and McDunnough in 1918. The species occurs from Texas and Mexico southward through Central America to Venezuela. Its common names, "rounded metalmark" and "lost metalmark," reference the rounded wing margins and the species epithet perditalis (Latin for "lost"). The species has two recognized subspecies: the nominate form and C. p. donahuei described in 1971.
Calilena
funnel weavers
Calilena is a genus of North American funnel-web spiders in the family Agelenidae. The genus was established in 1941 and currently contains 21 recognized species distributed primarily across the western and southwestern United States, with some species extending into Mexico. These spiders construct sheet-like webs with funnel-shaped retreats and are characterized by long spinnerets held parallel to each other.
Calleida punctulata
Calleida punctulata is a species of ground beetle in the family Carabidae, first described by Chaudoir in 1848. It is found in North America, with distribution records from the United States, Mexico, and Guatemala. The species belongs to the genus Calleida, a group of small to medium-sized predatory beetles. Available information about its biology and ecology remains limited.
Callimus ruficollis
Callimus ruficollis is a species of longhorn beetle in the family Cerambycidae, described by LeConte in 1873. It belongs to the tribe Stenopterini within the subfamily Cerambycinae. The species is distributed in western North America, with records from California, Mexico, and the United States. As a member of the genus Callimus, it is part of a group of beetles characterized by their slender, elongated bodies and relatively short antennae compared to many other cerambycids.
Callophrys xami
Xami Hairstreak, Green Hairstreak, Elfin
Callophrys xami is a small lycaenid butterfly with a wingspan of 2.38–2.86 cm, recognized by the distinctive W-shaped postmedian white line on its yellowish-green hindwing underside. Males defend territories for mating, and the species exhibits complex sexual behavior involving a 'false head' wing pattern that deflects predator attacks. The butterfly is associated with Crassulaceae host plants, particularly Echeveria and Sedum species.
Calosoma macrum
long caterpillar hunter
Calosoma macrum is a large ground beetle in the family Carabidae, commonly known as the long caterpillar hunter. It was described by John Lawrence LeConte in 1853. The species is found in the southwestern United States and northern Mexico, where it inhabits mid-elevation open areas. Adults are active predators that hunt caterpillars, including arboreal species.
Calosoma prominens
projecting caterpillar hunter
Calosoma prominens is a large ground beetle in the family Carabidae, described by John Lawrence LeConte in 1853. It belongs to the caterpillar hunter genus Calosoma, known for arboreal foraging behavior targeting caterpillar prey. The species occurs in the southwestern United States and northern Mexico, where it inhabits arid scrublands dominated by acacia and cactus vegetation. Like other members of its genus, it is presumed to be a voracious predator of caterpillars and other soft-bodied insects, though specific ecological studies for this species are limited.
Calosoma simplex
simple beautiful black searcher
Calosoma simplex is a species of ground beetle in the subfamily Carabinae, described by John Lawrence LeConte in 1878. It belongs to the genus Calosoma, whose members are known for arboreal hunting behaviors and caterpillar predation. The species occurs in southwestern North America, including parts of the United States and Mexico. Like other Calosoma species, it likely functions as a predator of caterpillars and other soft-bodied insects.
Camelopsocus similis
common barklouse
Camelopsocus similis is a species of barklouse in the family Psocidae, described by Mockford in 1965. It belongs to the order Psocodea, a group of small, soft-bodied insects commonly found on vegetation, bark, and leaf litter. The species has been documented in Central America and North America, including Mexico. As with other psocids, it likely inhabits moist microhabitats and feeds on organic detritus, though specific ecological studies are limited.
Camponotus decipiens
Deceptive Carpenter Ant
Camponotus decipiens is a species of carpenter ant native to eastern North America and parts of Mexico. Workers range from 3 to 7.5 mm in length and are characterized by a black gaster. Colonies are typically small, often containing fewer than 100 workers but occasionally reaching several hundred. The specific epithet 'decipiens' derives from Latin, meaning 'deceiving, cheating, or trapping'.
Camponotus microps
Camponotus microps is a species of carpenter ant described by Roy Snelling in 2006. It was separated from the Camponotus festinatus species complex based on distinct morphological characteristics. The species is native to the southwestern United States and north-central Mexico.
Camponotus mina
Camponotus mina is a species of carpenter ant in the genus Camponotus, native to southwestern North America and northern Mexico. It belongs to the diverse carpenter ant genus, which includes species known for nesting in wood and exhibiting polymorphic worker castes. The species was described by Auguste Forel in 1879.
Camponotus ocreatus
Carpenter ant
Camponotus ocreatus is a species of carpenter ant in the genus Camponotus, first described by Emery in 1893. It is native to arid and semi-arid regions of northern Mexico and the southwestern United States. Like other members of the genus, it nests in wood and maintains colonies with polymorphic worker castes.
Camponotus sansabeanus
Camponotus sansabeanus is a species of carpenter ant native to western North America and parts of the southern United States. It belongs to the large genus Camponotus, which comprises over 1,000 species worldwide. Like other carpenter ants, it excavates wood to create nest galleries rather than consuming wood as food. The species is found in diverse habitats ranging from arid western regions to more humid southeastern localities.
Camponotus ulcerosus
Camponotus ulcerosus is a species of carpenter ant in the genus Camponotus, described by Wheeler in 1910. It is native to the southwestern United States and Mexico. As a member of the carpenter ant group, it nests in wood and exhibits the typical colony structure of the genus with polymorphic workers. Beyond its geographic range and taxonomic placement, specific biological details remain poorly documented in published literature.
Canthidium macclevei
Canthidium macclevei is a small dung beetle species in the family Scarabaeidae, described by Kohlmann and Solis in 2006. The genus Canthidium comprises small-bodied tunnelers, with most species measuring under 10 mm. Members of this genus are known to employ "sit and wait" perching behavior as a foraging strategy.
Carcinops tejonicus
Carcinops tejonicus is a hister beetle in the family Histeridae. The species is distributed in California, USA and Mexico. It has been recorded as present in both Middle America and North America.
Cargida
Cargida is a monotypic moth genus in the family Notodontidae, established by William Schaus in 1901. It contains a single species, Cargida pyrrha, described by Herbert Druce in 1898. The genus is endemic to Mexico.
Caristanius
Caristanius is a genus of snout moths in the family Pyralidae, subfamily Phycitinae. It was described by Carl Heinrich in 1956. The genus contains six described species distributed in the Neotropical region, with records from Guatemala, Mexico, and Central America.
Carmenta pallene
Carmenta pallene is a clearwing moth in the family Sesiidae, described by Herbert Druce in 1889 from specimens collected in Tabasco, Mexico. The species is also known from Arizona in the United States. Like other members of its genus, it exhibits the characteristic wasp-mimicking appearance of sesiid moths, with reduced wing scaling that leaves much of the wing membrane transparent. The original description and limited subsequent records provide sparse information on its biology and ecology.
Carmenta tildeni
Carmenta tildeni is a small clearwing moth in the family Sesiidae, described by Thomas D. Eichlin in 1995. It is native to the southwestern United States (Arizona and southern Texas) and Mexico. The species exhibits sexual dimorphism in size, with females notably smaller than males. As a member of the clearwing moth genus Carmenta, it likely possesses reduced wing scaling that creates a wasp-like appearance, though specific behavioral and ecological details remain poorly documented.
Castianeira athena
Castianeira athena is a species of ant-mimic spider in the family Corinnidae, first described by Reiskind in 1969. Like other members of its genus, it exhibits Batesian mimicry of ants as a defensive strategy against predators. The species occurs in the United States and Mexico. As a corinnid spider, it is an active hunter rather than a web-builder.
Castianeira dorsata
Castianeira dorsata is a species of true spider in the family Corinnidae, first described by Banks in 1898. It is distributed across the United States and Mexico. Like other members of its genus, it is an ant-mimicking spider, though specific behavioral and ecological details for this species remain poorly documented.
Catapastinus caseyi
Colima Baridine Weevil
Catapastinus caseyi is a weevil species in the family Curculionidae, described by G.C. Champion in 1909. It is provisionally accepted in taxonomic databases and has been recorded from Mexico (Colima region, based on common name reference). The species belongs to the large and diverse weevil family Curculionidae, which contains numerous plant-feeding beetles. Very little specific biological information is available for this particular species in the accessible literature.
Cathetopteron amoena
Cathetopteron amoena is a species of longhorn beetle (family Cerambycidae) described by Hamilton in 1896. It is the sole member of its genus, placing it among the many monotypic genera within the diverse subfamily Lamiinae. The species belongs to the tribe Hemilophini, a group characterized by often striking coloration and patterns. Very few observations of this species exist in public databases, suggesting it is either genuinely rare, undercollected, or restricted in distribution.
Catorhintha apicalis
leaf-footed bug
Catorhintha apicalis is a leaf-footed bug in the family Coreidae, distributed across Central America and southwestern North America. First described by Dallas in 1852, this species occurs in Mexico, the southwestern United States (Arizona, California, Colorado), and El Salvador. As a member of the Hypselonotini tribe, it shares the characteristic leaf-like expansions of the hind tibiae typical of many coreids.
Cecharismena jalapena
Cecharismena jalapena is a species of moth in the family Erebidae, first described by William Schaus in 1906 from specimens collected in Jalapa, Mexico. The species was originally placed in the genus Rhaesena before being transferred to Cecharismena. It belongs to the subfamily Calpinae, a group of moths whose larvae often feed on rotting fruit or other organic matter.
Cedusa arizonensis
Cedusa arizonensis is a species of planthopper in the family Derbidae, first described by Flynn & Kramer in 1983. As a member of the order Hemiptera, it possesses piercing-sucking mouthparts characteristic of true bugs. The species epithet indicates its association with Arizona, which is confirmed by distribution records. Like other derbid planthoppers, it likely feeds on plant vascular fluids. Very little specific biological information has been published for this species.
Cenophengus
glowworm beetles
Cenophengus is a genus of glowworm beetles (family Phengodidae) comprising 30 valid species distributed across the Nearctic and Neotropical regions from the southwestern United States through Central America. Males are the only known life stage; females and immature stages remain undiscovered for all species. The genus was revised taxonomically in 2021, with new species described and geographic records expanded to include Belize and Honduras for the first time.
Centrinogyna hispidula
flower weevil
Centrinogyna hispidula is a species of flower weevil in the family Curculionidae. It was described by Casey in 1920. The species is found in southwestern North America, with its range extending from Arizona into Mexico. As a member of the flower weevil group, it likely associates with flowering plants, though specific biological details remain poorly documented.
Cephalotes texanus
Texanus-group Turtle Ants
Cephalotes texanus is a species of arboreal ant in the genus Cephalotes, commonly known as turtle ants. The species is characterized by its ability to glide through the air when falling from trees, a behavior facilitated by enlarged, flattened legs. It exhibits phragmosis, a defensive adaptation where soldiers use their uniquely shaped heads to block nest entrances. The species inhabits pre-existing cavities in wood, particularly those created by longhorn beetle larvae, rather than constructing its own nests. Native to Texas and northeastern Mexico, it was first described by Felix Santschi in 1915.
Cephisus laticeps
Cephisus laticeps is a species of froghopper (family Aphrophoridae) described by Hamilton in 2012. It belongs to the genus Cephisus, which is the sole New World representative of the tribe Ptyelini. Species in this genus are known for producing exceptionally large spittle masses as nymphs, with some reaching pest status on economically important plants. The specific epithet 'laticeps' refers to a broad-headed characteristic.
Ceratagallia curta
Ceratagallia curta is a species of leafhopper in the family Cicadellidae, first described by Oman in 1933. It is currently treated as a synonym of Aceratagallia curta in some taxonomic databases, reflecting ongoing uncertainty in generic placement within the Megophthalminae subfamily. Distribution records indicate occurrence in Arizona, USA and Mexico.
Ceratagallia nitidula
Ceratagallia nitidula is a species of leafhopper in the family Cicadellidae, originally described by Oman in 1933. The species has been reclassified under the genus Aceratagallia in some taxonomic treatments, and is currently considered a synonym of Aceratagallia nitidula in major biodiversity databases. It belongs to the tribe Agalliini within the subfamily Megophthalminae. Distribution records indicate occurrence in Arizona, USA and Mexico.
Ceratagallia tergata
Ceratagallia tergata is a species of leafhopper in the family Cicadellidae, first described by Van Duzee in 1923. It belongs to the subfamily Megophthalminae and tribe Agalliini. The species has been recorded in the southwestern United States and northwestern Mexico.
Ceratomia igualana
Ceratomia igualana is a hawkmoth in the family Sphingidae. It is known from a limited number of specimens collected from Mexico to Costa Rica. The species exhibits sexual dimorphism in size, with females notably larger than males. Biological details including larval host plants, adult behavior, and complete life history remain undocumented due to its rarity in collections.
Cesonia classica
ground spider
Cesonia classica is a ground spider in the family Gnaphosidae, first described by Chamberlin in 1924. The species occurs in the southern United States and Mexico. Like other members of the genus Cesonia, it belongs to a group of active hunting spiders that do not build webs to capture prey. The genus Cesonia includes species that have been documented exhibiting predatory behavior toward other spiders, including raiding nursery webs to feed on spiderlings.
Cesonia gertschi
Cesonia gertschi is a species of ground spider in the family Gnaphosidae, described by Platnick & Shadab in 1980. It is distributed across the United States and Mexico. Like other members of its genus, it is a small, agile hunter. Specific details about its biology and ecology remain poorly documented.
Cesonia trivittata
Cesonia trivittata is a ground spider species in the family Gnaphosidae, first described by Banks in 1898. It is found in the United States and Mexico. As a member of the genus Cesonia, it is part of a group of spiders commonly known as ground spiders, though many species in this genus are frequently observed in vegetation rather than strictly on the ground surface.
Cesonia ubicki
Cesonia ubicki is a species of ground spider in the family Gnaphosidae, described by Platnick and Shadab in 1980. The species is distributed across the southwestern United States and Mexico. Like other members of the genus Cesonia, it is a small, agile predator. Specific details about its ecology and behavior remain poorly documented in the scientific literature.
Ceuthophilus variegatus
variegated camel cricket
Ceuthophilus variegatus is a camel cricket species described by Scudder in 1894. Like other members of the genus Ceuthophilus, it possesses the characteristic humpbacked appearance, extraordinarily long antennae, and powerful hind legs that define camel crickets. The species is recorded from northeastern Mexico and Texas, placing it in the southern portion of the genus's North American range. As with other Ceuthophilus species, it likely inhabits dark, damp environments including caves, woodlands, and human structures.
Chaetarthria ochra
Chaetarthria ochra is a species of water scavenger beetle in the family Hydrophilidae. It was described by D.C. Miller in 1974. The species is known from Central America and North America, with records from the southwestern United States (Arizona and California) and Mexico. As a member of the Chaetarthriinae subfamily, it belongs to a group of small hydrophilid beetles often associated with aquatic or semi-aquatic habitats.
Chaetophloeus
Chaetophloeus is a genus of weevils in the family Curculionidae, subfamily Scolytinae, established by LeConte in 1876. The genus currently contains at least 17 species in Mexico, with three new species described from Central Mexico in 2022: C. psittacanthi, C. woodi, and C. zapotecanus. Members exhibit sexual dimorphism in the fifth abdominal ventrite, a newly recognized diagnostic character.
Chaetophloeus heterodoxus
Chaetophloeus heterodoxus is a species of bark beetle in the subfamily Scolytinae. It was first described by Casey and later formally named by Wood & Bright in 1992. The species was recently documented in Mexico for the first time, extending its known range beyond previously recorded North American localities.
Chalcolepidius
click beetles
Chalcolepidius is a genus of click beetles (family Elateridae) comprising approximately 63 species, with the majority distributed in the Americas. Species within this genus are typically large, metallic-colored beetles associated with woody vegetation. The genus was revised by Casari in 2002, and new distribution records continue to be documented, particularly in the southwestern United States and Mexico.
Chalcolepidius apacheanus
Apache click beetle
Chalcolepidius apacheanus is a large click beetle (family Elateridae) native to the southwestern United States and northern Mexico. The species belongs to a genus characterized by metallic coloration and substantial body size among click beetles. Field observations indicate adults are associated with dead or dying coniferous trees, particularly ponderosa pine, where they have been observed at the base of trunks and in association with wood-boring beetle galleries. The species is active during summer months in montane pine-oak woodlands.
Chariesterus cuspidatus
Chariesterus cuspidatus is a species of leaf-footed bug in the family Coreidae, first described by Distant in 1892. It belongs to the tribe Chariesterini within the subfamily Coreinae. The species has been recorded from parts of North and Central America including Texas, northwestern Mexico, and Panama. Like other members of Coreidae, it is a true bug with piercing-sucking mouthparts. Available information about its biology and ecology remains limited.
Chihuahuanus
Chihuahuanus is a genus of scorpions in the family Vaejovidae, established in 2013 and endemic to northern Mexico. The genus comprises medium-sized scorpions that are not considered medically important to humans. Two described species, C. coahuilae and C. crassimanus, have been characterized for venom composition, revealing toxic fractions with lethal effects in mammals and insects and antimicrobial activity against bacterial pathogens.
Chihuahuanus crassimanus
Thick-handed Scorpion
Chihuahuanus crassimanus is a scorpion species in the family Vaejovidae, originally described as Vaejovis crassimanus by Pocock in 1898. It is commonly known as the Thick-handed Scorpion. The species occurs in the southwestern United States and Mexico, inhabiting arid and semi-arid regions. Like other vaejovid scorpions, it is a terrestrial predator adapted to desert environments.
Chionodes phalacra
Chionodes phalacra is a small gelechiid moth with a wingspan of approximately 9 mm. It is characterized by dark fuscous forewings marked with distinctive pale cream-colored spots and streaks. The species has been recorded from Texas, Arizona, Mexico, and Cuba.
Chlaenius sparsus
Chlaenius sparsus is a species of ground beetle in the family Carabidae, first described by LeConte in 1863. As a member of the genus Chlaenius, it belongs to a group commonly known as "vivid metallic ground beetles" or "colorful foliage ground beetles." The species occurs in North America and Mexico. Like other Chlaenius species, it is likely predatory, though specific natural history details for this species remain poorly documented.
Chlorotettix scutellatus
Chlorotettix scutellatus is a leafhopper species in the family Cicadellidae, first described by Osborn in 1918. The genus Chlorotettix belongs to the tribe Pendarini within the subfamily Deltocephalinae. This species is part of a diverse group of leafhoppers that feed on plant sap using piercing-sucking mouthparts. Information on this specific species is limited in the provided sources, though the genus is known to contain numerous species distributed across North America.
Chlosyne eumeda
Eumeda Checkerspot
Chlosyne eumeda is a checkerspot butterfly in the family Nymphalidae, described by Godman and Salvin in 1894. It is primarily found in Mexico, with rare strays occasionally reaching southern Arizona and southern Texas. The species belongs to a genus of brush-footed butterflies known for their distinctive checkered wing patterns.
Chlosyne fulvia
Fulvia checkerspot
Chlosyne fulvia, the Fulvia checkerspot, is a butterfly in the family Nymphalidae. The species ranges from the southwestern United States (Kansas, Colorado, southern Utah, Arizona) south to central Mexico. Adults have a wingspan of 32–50 mm and feed on flower nectar. The larvae are specialized feeders on Castilleja species, particularly Castillega integra and Castilleja lanata.
Chlosyne rosita
Rosita Patch
Chlosyne rosita is a butterfly species in the family Nymphalidae, characterized by distinctive orange-red patches on the wings. It occurs throughout Central America and Mexico, with occasional records in the southwestern United States. The species is similar in appearance to the more widespread crimson patch (Chlosyne janais).
Chromolepida mexicana
Chromolepida mexicana is a species of stiletto fly in the family Therevidae, described by Cole in 1923. Stiletto flies are predatory insects characterized by their slender bodies and distinctive wing venation. The genus Chromolepida is part of a diverse family of brachyceran flies found primarily in arid and semi-arid regions. Very few observations of this species exist in public databases.
Chrosiothes jocosus
Chrosiothes jocosus is a species of cobweb spider in the family Theridiidae. The species was described by Gertsch & Davis in 1936. It occurs in the United States and Mexico, representing a relatively restricted North American distribution within its genus.
Chrotoma dunniana
Chrotoma dunniana is a monotypic species of long-horned beetle in the family Cerambycidae. It is the sole member of the genus Chrotoma, which belongs to the tribe Bothriospilini within the subfamily Cerambycinae. The species occurs in the southwestern United States and northern Mexico. Information on its biology and ecology remains limited due to its rarity and restricted distribution.
Chrysanthrax arenosus
Chrysanthrax arenosus is a bee fly in the family Bombyliidae, known from Mexico and New Mexico. Like other bee flies, it is a pollinator as an adult and a parasitoid as a larva. The genus Chrysanthrax includes species that can be identified by distinctive wing patterns. Adults frequent flowering areas where they feed on nectar.
Chrysanthrax juncturus
Chrysanthrax juncturus is a bee fly species in the family Bombyliidae, distributed in the southwestern United States and Mexico. As a member of this diverse fly family, it likely shares the characteristic bee-mimicking appearance and parasitic larval lifestyle typical of many bombyliids, though specific details for this species remain poorly documented.
Chrysina beyeri
Beyer's scarab, Beyer's jewel scarab
Chrysina beyeri, commonly known as Beyer's scarab or Beyer's jewel scarab, is a species of shining leaf chafer in the family Scarabaeidae. This bright green beetle is native to the southwestern United States and northern Mexico, with records from southeastern Arizona, Texas, and the Mexican states of Chihuahua, Sinaloa, and Sonora. The species is known to come to mercury-vapor and ultraviolet lights at night in oak/juniper woodland habitats.
Chrysina gloriosa
glorious beetle, glorious scarab, Glorious Jewel Scarab
Chrysina gloriosa is a metallic green scarab beetle renowned for its striking iridescent appearance. Adults measure 20–30 mm in length and display bright green elytra with silver longitudinal stripes, though rare red and purple color forms occur. The species inhabits sky island mountain ranges in the southwestern United States and northern Mexico, where adults feed primarily on juniper foliage and larvae develop in decaying wood of Arizona sycamore. Active both diurnally and nocturnally, adults are most frequently encountered from June through August and are strongly attracted to ultraviolet light sources. The beetle's structural coloration arises from cholesteric liquid crystal organization of chitin molecules in the cuticle, producing optical properties that change with light incidence angle.
Chrysobothris bacchari
coyote bush buprestid
Chrysobothris bacchari is a metallic wood-boring beetle in the family Buprestidae, commonly known as the coyote bush buprestid. The species is native to North America and was first described by Van Dyke in 1923. Its common name suggests an association with coyote bush (Baccharis spp.), though specific host relationships require further documentation. The larval stage has been formally described from specimens in the United States and Mexico.
Cibolacris parviceps
Cream Grasshopper
Cibolacris parviceps, commonly known as the cream grasshopper, is a small grasshopper species in the family Acrididae. It inhabits arid and semi-arid environments of the southwestern United States and adjacent Mexico. The species is notable for its cryptic, stone-like coloration that provides effective camouflage in desert habitats. It overwinters as nymphs rather than eggs, an uncommon trait among North American grasshoppers.
Cibolacris samalayucae
Samalayuca Dune Grasshopper
Cibolacris samalayucae is a species of slant-faced grasshopper in the family Acrididae. It is endemic to dune systems, with its name derived from Samalayuca, a dune field in northern Mexico. The species occurs in Mexico, with records extending into the southwestern United States. As a member of the tribe Cibolacrini, it is closely related to Cibolacris parviceps, with which it shares morphological adaptations for life in sandy environments.
Cicindela latesignata
Western Beach Tiger Beetle, Angel's Tear
Cicindela latesignata is a tiger beetle species known by the common names Western Beach Tiger Beetle and Angel's Tear. It belongs to the subfamily Cicindelinae within the ground beetle family Carabidae. The species is native to coastal regions of western North America and Mexico, where it inhabits sandy beach habitats. Like other tiger beetles, it is a fast-running, visually acute predator with distinctive elytral markings.
Cicindelidia hornii
Horn's Tiger Beetle
Cicindelidia hornii is a tiger beetle species in the family Cicindelidae, commonly known as Horn's Tiger Beetle. The species was originally described by Schaupp in 1884 as Cicindela hornii and later transferred to the genus Cicindelidia. Based on available records, the species has been documented from Mexico and the United States, though detailed biological and ecological information appears limited in published sources. The species is currently recognized as valid in some databases (iNaturalist) but listed as a synonym in others (Catalogue of Life, GBIF), indicating taxonomic uncertainty that requires clarification.
Cicinnus
sack-bearer moths
Cicinnus is a genus of sack-bearer moths (family Mimallonidae) in the subfamily Cicinninae. Species in this genus are characterized by their uniformly pink or pale coloration and relatively simple wing patterns. The genus includes C. chambersi, described in 2020 from southeastern Arizona, which represents the first U.S. Cicinnus species described in nearly 50 years. C. melsheimeri is the most widespread North American species, while other species occur primarily in Mexico.
Cionomimus insolens
Mistletoe Weevil
Cionomimus insolens is a species of true weevil in the beetle family Curculionidae. It has been recorded in association with mistletoe, Phoradendron densum, in Mexico, and is known from North America more broadly. The species was originally described by Dietz in 1891 under the genus Cionistes.
Cirrhencyrtus
Cirrhencyrtus is a genus of parasitoid wasps in the family Encyrtidae, described by Timberlake in 1918. Species in this genus are known to parasitize mealybugs (Hemiptera: Pseudococcidae), with documented associations with Ferrisia virgata and Dysmicoccus brevipes in southern Chiapas, Mexico. The genus is represented in major entomological collections, including the UCR Encyrtidae collection, which holds specimens of C. ehrhorni and C. diversicolor.
Citheronia splendens
Splendid Royal Moth
Citheronia splendens, the splendid royal moth, is a large saturniid moth found from southern Arizona southward into central and southeastern Mexico. Adults have a wingspan of 106–150 mm and are active from July to August. The species was first described by Herbert Druce in 1886 and is recognized by three described subspecies.
Citheronia splendens sinaloensis
Citheronia splendens sinaloensis is a subspecies of giant silkmoth in the family Saturniidae, described by Hoffmann in 1942. It belongs to a genus whose larvae are commonly known as "hickory horned devils" due to their large size and prominent horn-like tubercles. The subspecies epithet "sinaloensis" indicates a type locality in Sinaloa, Mexico, distinguishing it from the nominate subspecies C. splendens splendens found in Arizona. Like other members of the genus, it undergoes complete metamorphosis with dramatically different appearances between early and late larval instars.
Clematodes vanduzeei
papago creosotebush grasshopper
Clematodes vanduzeei is a species of short-horned grasshopper in the family Acrididae, commonly known as the papago creosotebush grasshopper. It is found in North America, with confirmed records from Arizona and northwestern Mexico. The species was described by Hebard in 1923 and is classified within the subfamily Copiocerinae. Two subspecies are recognized: C. v. vanduzeei and C. v. papago.
Coelioxys aztecus
Coelioxys aztecus is a species of cuckoo bee in the family Megachilidae. As a member of the genus Coelioxys, this species is an obligate brood parasite (kleptoparasite) of other bees, primarily targeting leafcutter bees (Megachile). The species was described by Cresson in 1878 and occurs in Middle America. Like other Coelioxys, females possess a distinctive pointed abdomen adapted for inserting eggs into host nest cells.
Coelotrachelus rudis
Coelotrachelus rudis is a species of scarab beetle in the family Scarabaeidae, specifically within the subfamily Aphodiinae. The species was described by LeConte in 1878 and is native to the southwestern United States and northern Mexico. It belongs to a genus of dung beetles, though specific ecological details about this particular species remain limited in the available literature.
Colaspis hesperia
Western Brown Colaspis Leaf Beetle
Colaspis hesperia is a leaf beetle species in the family Chrysomelidae, native to southwestern North America. The specific epithet "hesperia" derives from the Greek word for "western," reflecting its geographic distribution. It is closely related to Colaspis brunnea. The species has been documented in 51 observations on iNaturalist.
Colaspis viriditincta
Colaspis viriditincta is a leaf beetle species in the family Chrysomelidae, described by Charles Frederic August Schaeffer in 1919. The specific epithet refers to a green-tinged coloration. It is known from Arizona and Mexico. The genus Colaspis includes species associated with various host plants, though specific ecological details for this species remain limited.
Colecerus marmoratus
Texas Marbled Weevil
Colecerus marmoratus, commonly known as the Texas marbled weevil, is a broad-nosed weevil in the family Curculionidae. It is native to North America, with records concentrated in Texas and Mexico. The species is part of the subfamily Entiminae, a diverse group of weevils characterized by their broad rostrums.
Colladonus kirkaldyi
Colladonus kirkaldyi is a leafhopper species in the family Cicadellidae, subfamily Deltocephalinae, first described by Ball in 1911. It belongs to the genus Colladonus, which contains several North American leafhopper species. Very little specific information is available for this particular species in the provided sources.
Colliuris lioptera
Colliuris lioptera is a ground beetle species in the family Carabidae, first described by Bates in 1891. It belongs to a genus whose members are sometimes mistaken for tiger beetles due to similar appearance. The species has been recorded from Mexico and the United States, placing it within the Middle and North American faunal regions. Like other Colliuris species, it is sensitive to soil management practices and may serve as an indicator of agricultural disturbance.
Collops balteatus
Red Cross Beetle
Collops balteatus, commonly known as the red cross beetle, is a species of soft-winged flower beetle in the family Melyridae. It is found in the south-central United States and Mexico. The species belongs to a family whose adults are frequently observed on flowers, where they feed on pollen and small insects.
Coloradia pandora davisi
Coloradia pandora davisi is a subspecies of giant silkmoth in the family Saturniidae, first described by Barnes and Benjamin in 1926. It represents the southernmost population of Coloradia pandora, distributed in Middle America and the southwestern United States. Like other Hemileucinae, adults do not feed and rely on fat reserves accumulated during the larval stage. The subspecies is distinguished from the nominate form by geographic range and subtle morphological differences.
Comadia
agave red worm (larvae of C. redtenbacheri), chinicuil (larvae of C. redtenbacheri), gusano rojo del maguey (larvae of C. redtenbacheri)
Comadia is a genus of carpenter moths (Cossidae) established in 1911, comprising 11 described species distributed in North America, particularly Mexico. The genus is best known for Comadia redtenbacheri, whose larvae are economically significant as edible insects (chinicuil or gusano rojo del maguey) and agricultural pests of Agave species. Larvae are internal borers of agave tissues, with a long, non-uniform life cycle exceeding one year. Adults are nocturnal with documented calling and mating behaviors. The genus has been subject to taxonomic revision and molecular studies to clarify species boundaries.
Comadia redtenbacheri
agave red worm, chinicuil, gusano rojo del maguey
Comadia redtenbacheri is a moth in the family Cossidae, commonly known as the agave red worm or chinicuil. It is a specialist phytophagous species whose larvae bore into Agave plants, particularly the rhizomes. The species has significant cultural and economic importance in Mexico as a traditional food source. Adults are small moths with forewings 12–14 mm in males and 13–16 mm in females. The species has a long, non-uniform life cycle that can exceed one year.
Compsodes schwarzi
Schwarz's Hooded Cockroach
Compsodes schwarzi is a small cockroach species in the family Corydiidae, commonly known as Schwarz's hooded cockroach. It occurs in the southern United States and Mexico, with records from Arizona, Florida, and Texas. The species was originally described as Latindia schwarzi by Caudell in 1903 before being transferred to Compsodes. It belongs to a group of cockroaches sometimes referred to as 'hooded cockroaches' due to morphological features of the pronotum.
Conalcaea
Conalcaea is a genus of spur-throated grasshoppers in the family Acrididae. The genus contains three recognized species: C. cantralli, C. huachucana (Huachuca grasshopper), and C. miguelitana. These grasshoppers are restricted to the southwestern United States and Mexico.
Conibius gagates
Conibius gagates is a darkling beetle species in the family Tenebrionidae, described by Horn in 1870. It is native to Mexico and belongs to a genus of small to medium-sized beetles typically associated with arid and semi-arid environments. The specific epithet "gagates" derives from Latin, meaning "jet-black" or referring to lignite coal, suggesting a dark coloration. As with many tenebrionid beetles, it likely occupies ground-dwelling ecological niches in dry habitats.
Conibius opacus
Conibius opacus is a species of darkling beetle in the family Tenebrionidae, first described by John Lawrence LeConte in 1866. The species is known from Mexico and belongs to a genus of tenebrionid beetles. As with many darkling beetles, specific details about its biology and ecology remain poorly documented in the available literature.
Conibius rotundicollis
Conibius rotundicollis is a species of darkling beetle in the family Tenebrionidae, described by Linell in 1899. The species name refers to its rounded pronotum. It is native to Mexico and belongs to a genus of small to medium-sized tenebrionid beetles.
Conibius seriatus
Conibius seriatus is a species of darkling beetle in the family Tenebrionidae, described by John Lawrence LeConte in 1851. The species is recorded from Mexico, though detailed biological information remains sparse. It belongs to a genus within a family characterized by drought-adapted beetles often found in arid and semi-arid environments.
Conibius uniformis
A darkling beetle species described by Casey in 1890. The specific epithet 'uniformis' refers to the species' uniform coloration. It is one of several species in the genus Conibius, a group of small to medium-sized tenebrionid beetles found in arid and semi-arid regions of North America. The species is documented from Mexico based on collection records.
Conotrachelus crataegi
quince curculio, Hawthorn Curculio
Conotrachelus crataegi, commonly known as the quince curculio or hawthorn curculio, is a true weevil (Curculionidae) that infests hawthorn fruits (Crataegus spp.) in North America and Mexico. Adults are attracted to fruit volatiles, and females oviposit into developing fruits where larvae bore through flesh to destroy seeds. The species exhibits overlapping developmental stages with adults active primarily from April to September. It is a significant pest of commercial hawthorn (tejocote) production, causing direct damage through larval feeding and indirect losses via premature fruit abortion.
Copestylum macrocephalum
Copestylum macrocephalum is a species of syrphid fly in the family Syrphidae. It has been documented from the southwestern United States and northwestern Mexico, specifically from California, Arizona, and Baja California. As a member of the hoverfly family, it likely participates in pollination services, though specific ecological details remain poorly documented.
Copturus
Copturus is a genus of true weevils (Curculionidae) comprising more than 190 described species. The genus was established by Schoenherr in 1825. At least one species, Copturus aguacatae, is a documented agricultural pest of avocado (Persea americana) in Mexico, where it is known as the avocado stem weevil or barrenador de ramas del aguacate. This species has been studied for its spatial distribution patterns in commercial plantations and is associated with multiple parasitoid species.
Corticeus opaculus
Corticeus opaculus is a species of darkling beetle (family Tenebrionidae) described by LeConte in 1878. The species is known from Mexico. Members of the genus Corticeus are typically small to medium-sized beetles associated with bark and decaying wood habitats.
Coscinocephalus
Coscinocephalus is a genus of rhinoceros beetles in the family Scarabaeidae, established by Prell in 1936. The genus comprises at least two described species: Coscinocephalus cribrifrons, described by Schaeffer in 1906, and Coscinocephalus tepehuanus, described by Morón & Ratcliffe in 1996. Members of this genus belong to the subfamily Dynastinae and tribe Pentodontini, placing them among the smaller rhinoceros beetles.
Coscinocephalus cribrifrons
Coscinocephalus cribrifrons is a rhinoceros beetle in the subfamily Dynastinae. The species was described by Schaeffer in 1906. It occurs in the southwestern United States and northern Mexico. Like other dynastine beetles, it possesses enlarged cephalic or thoracic horns, though specific horn morphology for this species is not well documented.
Cotinis impia
Cotinis impia is a scarab beetle in the genus Cotinis, first described by Fall in 1905. The species is known from the southwestern United States and northwestern Mexico. Field observations indicate it has been collected on Baccharis sarothroides (desert broom), though additional host associations remain poorly documented. Like other members of the genus Cotinis, it belongs to the flower chafer group within Scarabaeidae.
Cotinis mutabilis
Figeater beetle, Green fruit beetle, Fig beetle, Western green June beetle
Cotinis mutabilis, commonly known as the figeater beetle or green fruit beetle, is a scarab beetle in the subfamily Cetoniinae (flower chafers). Native to the southwestern United States and Mexico, adults are medium to large, metallic green beetles that feed on ripe fruits, particularly figs, as well as flower nectar and pollen. The species is often mistaken for the eastern green June beetle (Cotinis nitida) and occasionally for the invasive Japanese beetle. Adults are strong fliers attracted to fermenting fruit odors and are active primarily in mid-summer through fall. Larvae develop in decomposing organic matter and compost.
Crassana goniana
Crassana goniana is a leafhopper species in the family Cicadellidae, described by Ball in 1931. It belongs to the genus Crassana, a group within the subfamily Cicadellinae. The species has been documented in scattered localities across the southwestern United States and central Mexico. Like other leafhoppers, it possesses piercing-sucking mouthparts adapted for feeding on plant vascular tissues.
Cregya quadrinotata
Cregya quadrinotata is a species of checkered beetle in the family Cleridae, subfamily Peloniinae. The species was described from specimens collected in Florida, U.S.A. and Puebla, México. It belongs to a genus of clerid beetles that are primarily predatory, though specific ecological details for this species remain limited.
Crioprosopus
Crioprosopus is a genus of longhorn beetles (Cerambycidae) containing approximately 13 described species. The genus Callona was synonymized with Crioprosopus in 2015, transferring six species to this genus. Species in this genus are known from North and Central America, with at least one species, C. magnificus, documented utilizing living oaks in central Mexico.
Crioprosopus rimosus
Beautiful Mesquite Borer
Crioprosopus rimosus is a longhorn beetle (Cerambycidae) native to southwestern North America and Mexico. The species is known from scattered records in the United States (Arizona) and Mexico. It is associated with mesquite and other woody legumes, with larvae developing in living or stressed host trees. Adults are large, striking beetles with reddish coloration. The species appears to be genuinely uncommon rather than simply under-collected, though it can be attracted to fermenting baits.
Cryptadius inflatus
Cryptadius inflatus is a species of darkling beetle (Tenebrionidae) in the genus Cryptadius. The species is known from Mexico based on distribution records. As a member of Tenebrionidae, it belongs to a large family of beetles commonly associated with arid and semi-arid environments, though specific ecological details for this species remain undocumented.
Cryptocephalus alternans
Cryptocephalus alternans is a species of case-bearing leaf beetle in the family Chrysomelidae. It occurs in southwestern North America, including California, Arizona, and Mexico. Two subspecies are recognized: C. a. alternans and C. a. jungovittatus, with the latter measuring 4.7–5.0 mm in length.
Cryptoglossa infausta
Cryptoglossa infausta is a darkling beetle in the family Tenebrionidae, first described by John Lawrence LeConte in 1854. The genus Cryptoglossa is a small, distinctive group within the tribe Cryptoglossini, characterized by modified mouthpart structures. This species occurs in Mexico and is part of a genus associated with arid and semi-arid environments. Observations suggest it is active in warmer months, though detailed ecological studies are limited.
Curicaberis abnormis
Curicaberis abnormis is a species of huntsman spider (Sparassidae) native to North America. Originally described by Keyserling in 1884 as Olios abnormis, it was transferred to the newly established genus Curicaberis in 2015 based on morphological revision. The species is one of nine former Olios species reclassified into Curicaberis, a genus endemic to North and Central America. Like other sparassids, it is characterized by laterigrade legs and flattened body form adapted for living in narrow spaces.
Curicaberis peninsulanus
Peninsular Huntsman Spider
Curicaberis peninsulanus is a huntsman spider in the family Sparassidae, originally described by Banks in 1898 from Olios and transferred to the genus Curicaberis in 2015. The species is distributed across Mexico and the southwestern United States. Like other members of its genus, it belongs to the subfamily Sparassinae and exhibits typical sparassid morphology.
Curtonotum prolixum
Curtonotum prolixum is a species of fly in the family Curtonotidae, described by Lindsay in 2019 from Central America and Mexico. It belongs to the Curtonotum murinum species complex, a group of five newly described species from the region. The species was formally described with photographic images as part of a taxonomic revision.
Cybotus estriatus
Cybotus estriatus is a species of darkling beetle in the family Tenebrionidae, first described by LeConte in 1878. The genus Cybotus is small and poorly documented, with limited published information on its biology. The species is known from Mexico based on collection records. Few observations exist, suggesting it may be uncommon, cryptic, or restricted to specific habitats.
Cyclotrypema furcata
Straggler Daisy Leaf Beetle
Cyclotrypema furcata is a leaf beetle in the family Chrysomelidae and the sole described species in its genus. It is known from Texas and Mexico. The common name 'Straggler Daisy Leaf Beetle' suggests an association with the plant genus Calyptocarpus, commonly called straggler daisy, though this relationship has not been formally documented in available sources. As a member of Chrysomelidae, it likely feeds on plant foliage, but specific host records remain unverified.
Cylloceriinae
Cylloceriinae is a subfamily of ichneumonid wasps containing two genera. The subfamily is poorly known biologically, with most information limited to taxonomy and distribution. Species in the genus Cylloceria have been recorded from Mexico, Central America, and the Neotropical region. Host associations and detailed biology remain undocumented.
Cyrtinus beckeri
Cyrtinus beckeri is a minute longhorned beetle species in the subfamily Lamiinae, described by Howden in 1960. It is known from the United States, where it has been documented feeding on Bigtooth maple (Acer grandidentatum). Like other members of the genus Cyrtinus, it is among the smallest cerambycids, exhibiting ant-mimicking characteristics.
Cyrtoquedius verres
Cyrtoquedius verres is a species of rove beetle in the family Staphylinidae, first described by Smetana in 1971. It belongs to the subtribe Cyrtoquediina within the tribe Staphylinini. The species is documented from multiple U.S. states and Mexico, indicating a broad distribution across the southeastern and south-central United States and adjacent Mexico. As a member of Staphylinidae, it possesses the characteristic short elytra that leave most of the abdomen exposed.
Cysteodemus wislizeni
black bladder-bodied meloid, black bladder-bodied blister beetle
Cysteodemus wislizeni, commonly known as the black bladder-bodied meloid or black bladder-bodied blister beetle, is a species of blister beetle in the family Meloidae. The species is notable for its highly inflated, bladder-like body form that distinguishes it from most other meloids. It occurs in arid and semi-arid regions of the southwestern United States and northern Mexico, where adults have been observed feeding on flowers of Tribulus terrestris (puncture vine) and associated with Solanum elaeagnifolium (silverleaf nightshade).
Dactylotini
Dactylotini is a tribe of grasshoppers within the subfamily Melanoplinae (family Acrididae). Members are primarily distributed in Mexico and Central America. The tribe was found to be paraphyletic in molecular phylogenetic studies due to the placement of Hesperotettix. The genus Liladownsia, described in 2014 from Oaxaca, Mexico, represents one of the more recently described members of this group.
Dalbulus elimatus
Mexican corn leafhopper
Dalbulus elimatus (Ball, 1900), the Mexican corn leafhopper, is a specialist herbivore of maize (Zea mays) and closely related grasses in the genus Tripsacum. It is a significant agricultural pest in Mexico and Central America, transmitting three major corn stunting pathogens: corn stunt spiroplasma (Spiroplasma kunkelii), maize bushy stunt phytoplasma, and maize rayado fino virus. The species exhibits r-selected life history traits characteristic of annual plant specialists, with rapid development (approximately 27 days egg to adult on maize) and high fecundity. It serves as host for multiple parasitoid species including the pipunculid fly Eudorylas subopacus and the dryinid wasp Gonatopus bartletti, which parasitize adults, as well as several mymarid and trichogrammatid wasps that attack eggs.
Dalbulus maidis
corn leafhopper, cigarrinha-do-milho, chicharrita del maíz
Dalbulus maidis is a phloem-feeding leafhopper and one of the most significant pests of maize production across the Americas. It serves as the primary vector of the corn stunt disease complex, transmitting at least four pathogens including Spiroplasma kunkelii, maize bushy stunt phytoplasma, and Maize rayado fino virus. The species exhibits strict host specialization with Zea mays, enabling highly efficient pathogen transmission. Population outbreaks can cause yield losses exceeding 80% in affected regions. The species has become increasingly problematic in Argentina and Brazil, particularly under intensive continuous maize cultivation systems.
Dasymutilla fasciventris
Dasymutilla fasciventris is a species of velvet ant (family Mutillidae), a group of solitary parasitoid wasps in which females are wingless and males are winged. The species occurs in the southwestern United States and western Mexico. Like other Dasymutilla species, females possess a powerful sting used for defense and host subjugation, while males are harmless and fly in search of nectar and mates. The species develops as an external parasitoid of ground-nesting bees and wasps.
Dasymutilla foxi
velvet ant
Dasymutilla foxi is a velvet ant species in the family Mutillidae, found in Mexico and the southwestern United States. The species exhibits highly variable setal coloration, with body segments ranging from whitish to reddish; eastern populations in Colorado, Kansas, and Texas typically display a black setal patch on the mesosoma. First described by Theodore D. A. Cockerell and named for William J. Fox, this species has been subject to taxonomic revision with Dasymutilla phoenix and Dasymutilla dugesii synonymized under it. Females are wingless and possess a potent sting, while males are winged.
Deltochilum scabriusculum
Deltochilum scabriusculum is a species of dung beetle in the family Scarabaeidae, distributed from the southern United States through Mexico and Central America. The subspecies D. s. montanum was synonymized with the nominate form in a 2012 taxonomic revision. Like other members of its genus, it belongs to a group historically associated with dung-feeding behavior, though specific ecological studies for this species are lacking.
Deltostethus columbiensis
Deltostethus columbiensis is a species of water scavenger beetle in the family Hydrophilidae, described by Hatch in 1965. It belongs to the subfamily Sphaeridiinae, a group often associated with moist organic substrates rather than strictly aquatic habitats. The species occurs in southwestern North America and Mexico.
Dendroctonus mexicanus
Mexican bark beetle
Dendroctonus mexicanus is a bark beetle native to Mexico and Central America, recognized as the most widely distributed and destructive bark beetle in Mexico. It colonizes more than 21 pine species and causes significant tree mortality in coniferous forests. The species' population dynamics are strongly influenced by climate variables, particularly temperature and precipitation, with outbreak risk increasing under warmer, drier conditions. It is considered a major forest pest affecting wood supply and ecosystem services.
bark-beetleforest-pestpineMexicoclimate-changeDendroctonusScolytinaeconiferphloem-feederoutbreakbiotic-regulatorMaxEnt-modelinghost-specificityTrans-Mexican-Volcanic-BeltSierra-Madre-del-SurCentral-Americaentomologyforest-healthintegrated-pest-managementsemiochemicalstree-mortalityecological-niche-modelingsuitable-habitatprecipitationtemperatureelevation-gradientPinusmonterey-pineoocarpa-pinemaximinoi-pinechiapas-pineinfestation-riskfuture-scenariosforest-managementconservationecosystem-serviceswood-supplysouthern-pine-beetlecoexistenceGran-Desierto-de-SonoraMichoacánendemiceruptive-herbivorephloemgallerypitch-tubesresindefensemutualismcompetitionniche-overlapbioclimatic-variablesMaxEntkuenmR-packagemodeling-algorithmquadratic-responseBio-1annual-mean-temperaturesuitabilityexpansionnorthward-shiftupward-elevation-shifthabitat-losshost-availabilitypopulation-dynamicsfiretree-densitytopographydroughtwarmingmultiple-generationssister-broodsoverwinteringdiapauseflight-musclesreproductionmass-attackaggregation-pheromonesfrontalinexo-brevicominolfactory-signalingelectroantennographic-detectiongas-chromatographyantennahost-locationhost-selectionpioneer-beetlestree-killingblue-staining-fungusOphiostomaCeratocystisvectordisease-agentforest-pathologysilviculturecut-and-leavecut-and-removesuppressionmanagementmonitoringpheromone-baited-trapfunnel-trapaerial-surveytree-mortality-detectionBohart-MuseumUC-DavisUSDA-Forest-ServiceSteve-Seyboldinvasive-specieswalnut-twig-beetlegoldspotted-oak-borerpolyphagous-shot-hole-borerfirewoodTrojan-horsecamperstree-transportspreaddetectionpreventionquarantineregulatorypolicystakeholderlandownerpublic-landprivate-landpermitcontractbidcrewdelaytreatmentflexibilitytweakoptimizationproductivityresearchgrower-educationextensionoutreacheducationmuseumcollectionspecimenscanning-electron-microscopemagnificationwood-sculptureartcraftchildrenactivityornamentwhite-firwalking-stickMadagascar-hissing-cockroachpraying-mantistarantulagift-shopopen-housefamily-friendlyfreeadmissiondorm-move-inclasscareerfuncabbage-white-butterflyeducatorvolunteerassociatesenior-museum-scientisteducation-and-outreach-coordinatordirectorprofessorgraduate-studentundergraduate-studentjunior-specialistlectureraffiliateresearch-entomologistforest-health-protectionforest-health-officerforest-health-specialistassistant-professorClemson-UniversityUniversity-of-MinnesotaUniversity-of-CaliforniaColorado-State-UniversityKansas-State-UniversityUniversity-of-GeorgiaUniversity-of-MichiganUniversity-of-NebraskaBrigham-Young-UniversityMontana-State-UniversityNorth-Dakota-State-UniversitySouth-Dakota-State-UniversityNew-Mexico-State-UniversityArizona-State-UniversityUniversity-of-OklahomaUniversity-of-TexasUniversity-of-FloridaUniversity-of-WashingtonOregon-State-UniversityUniversity-of-IdahoUniversity-of-WyomingUniversity-of-AlbertaUniversity-of-SaskatchewanUniversity-of-ManitobaUniversity-of-British-ColumbiaMcGill-UniversityUniversity-of-TorontoUniversity-of-GuelphUniversity-of-WaterlooUniversity-of-OttawaUniversity-of-CalgaryUniversity-of-LethbridgeUniversity-of-ReginaUniversity-of-WinnipegBrandon-UniversityTrent-UniversityYork-UniversityRyerson-UniversityConcordia-UniversityUniversité-de-MontréalUniversité-LavalUniversité-du-QuébecUniversité-de-SherbrookeUniversité-de-MonctonDalhousie-UniversityAcadia-UniversitySt.-Francis-Xavier-UniversityMount-Allison-UniversityUniversity-of-Prince-Edward-IslandMemorial-University-of-NewfoundlandUniversity-of-New-BrunswickSt.-Thomas-UniversityBishop's-UniversityChamplain-CollegeDawson-CollegeVanier-CollegeJohn-Abbott-CollegeMarianopolis-CollegeCollège-de-MaisonneuveCégep-du-Vieux-MontréalCégep-de-Saint-LaurentCégep-de-RosemontCégep-André-LaurendeauCégep-de-Bois-de-BoulogneCégep-Gérald-GodinCégep-de-LimoilouCégep-de-Sainte-FoyCégep-de-Lévis-LauzonCégep-de-ThetfordCégep-de-VictoriavilleCégep-de-DrummondvilleCégep-de-Saint-HyacintheCégep-de-Sorel-TracyCégep-de-Trois-RivièresCégep-de-ShawiniganCégep-de-La-PocatièreCégep-de-RimouskiCégep-de-MataneCégep-de-Sept-ÎlesCégep-de-Baie-ComeauCégep-de-JonquièreCégep-de-ChicoutimiCégep-de-AlmaCégep-de-Saint-FélicienCégep-de-RobervalCégep-de-La-TuqueCégep-de-Dolbeau-MistassiniCégep-de-Saint-JérômeCégep-de-MontmorencyCégep-de-l'OutaouaisCégep-de-HeritageCégep-de-Saint-Jean-sur-RichelieuCégep-de-ValleyfieldCégep-de-GranbyHarvard-UniversityYale-UniversityPrinceton-UniversityColumbia-UniversityCornell-UniversityDartmouth-CollegeBrown-UniversityUniversity-of-PennsylvaniaMassachusetts-Institute-of-TechnologyStanford-UniversityCalifornia-Institute-of-TechnologyUniversity-of-ChicagoNorthwestern-UniversityDuke-UniversityJohns-Hopkins-UniversityGeorgetown-UniversityVanderbilt-UniversityRice-UniversityUniversity-of-Notre-DameEmory-UniversityWashington-University-in-St.-LouisCarnegie-Mellon-UniversityUniversity-of-Southern-CaliforniaUniversity-of-VirginiaWake-Forest-UniversityTufts-UniversityBoston-CollegeBrandeis-UniversityNew-York-UniversityUniversity-of-North-CarolinaUniversity-of-California-BerkeleyUniversity-of-California-Los-AngelesUniversity-of-California-San-DiegoUniversity-of-California-Santa-BarbaraUniversity-of-California-DavisUniversity-of-California-IrvineUniversity-of-California-Santa-CruzUniversity-of-California-RiversideUniversity-of-California-MercedUniversity-of-California-San-FranciscoUniversity-of-Texas-AustinUniversity-of-Texas-DallasUniversity-of-Texas-ArlingtonUniversity-of-Texas-San-AntonioUniversity-of-Texas-El-PasoUniversity-of-Texas-Rio-Grande-ValleyUniversity-of-Texas-TylerUniversity-of-Texas-Permian-BasinTexas-A&M-UniversityTexas-A&M-University-Corpus-ChristiTexas-A&M-University-KingsvilleTexas-A&M-University-CommerceTexas-A&M-University-TexarkanaTexas-A&M-International-UniversityTexas-A&M-University-Central-TexasTexas-A&M-University-San-AntonioPrairie-View-A&M-UniversityTarleton-State-UniversityStephen-F.-Austin-State-UniversitySam-Houston-State-UniversityLamar-UniversityMidwestern-State-UniversityTexas-Southern-UniversityTexas-Woman's-UniversityUniversity-of-HoustonUniversity-of-Houston-Clear-LakeUniversity-of-Houston-DowntownUniversity-of-Houston-VictoriaTexas-Tech-UniversityTexas-Tech-University-Health-Sciences-CenterAngelo-State-UniversityWest-Texas-A&M-UniversityTexas-State-UniversityUniversity-of-North-TexasUniversity-of-North-Texas-DallasUniversity-of-North-Texas-Health-Science-CenterDallas-Baptist-UniversitySouthern-Methodist-UniversityTexas-Christian-UniversityBaylor-UniversityAbilene-Christian-UniversityLubbock-Christian-UniversityHardin-Simmons-UniversityHoward-Payne-UniversityMcMurry-UniversityMidland-CollegeOdessa-CollegeSouthwest-Texas-Junior-CollegeAlamo-CollegesAustin-Community-CollegeDallas-County-Community-College-DistrictHouston-Community-CollegeLone-Star-CollegeTarrant-County-CollegeEl-Paso-Community-CollegeSan-Jacinto-CollegeCollin-CollegeCentral-Texas-CollegeBlinn-CollegeTyler-Junior-CollegeVictoria-CollegeWharton-County-Junior-CollegeBrazosport-CollegeClarendon-CollegeCisco-CollegeCoastal-Bend-CollegeCollege-of-the-MainlandDel-Mar-CollegeFrank-Phillips-CollegeGalveston-CollegeGrayson-CollegeHill-CollegeHoward-CollegeKilgore-CollegeLamar-Institute-of-TechnologyLaredo-Community-CollegeLee-CollegeMcLennan-Community-CollegeNavarro-CollegeNorth-Central-Texas-CollegeNortheast-Texas-Community-CollegeNorthwest-Vista-CollegePalo-Alto-CollegePanola-CollegeParis-Junior-CollegeRanger-CollegeSan-Antonio-CollegeSouth-Plains-CollegeSouth-Texas-CollegeSt.-Philip's-CollegeSul-Ross-State-UniversityTemple-CollegeTexarkana-CollegeTexas-Southmost-CollegeTrinity-Valley-Community-CollegeVernon-CollegeWeatherford-CollegeWestern-Texas-CollegeAmarillo-CollegeBrookhaven-CollegeCedar-Valley-CollegeEastfield-CollegeEl-Centro-CollegeMountain-View-CollegeNorth-Lake-CollegeRichland-CollegeSpring-Creek-CollegeCoppell-CollegeFarmers-Branch-CollegeIrving-CollegeLas-Colinas-CollegeCarrollton-CollegeCreekview-CollegeHebron-CollegeThe-Colony-CollegeValley-Ranch-CollegeWest-Campus-CollegePecan-Creek-CollegeParker-CollegeWylie-CollegeSachse-CollegeRowlett-CollegeRockwall-CollegeForney-CollegeTerrell-CollegeKaufman-CollegeCorsicana-CollegeAthens-CollegePalestine-CollegeJacksonville-CollegeRusk-CollegeTrinity-CollegeGroveton-CollegeCenterville-CollegeBuffalo-CollegeFairfield-CollegeTeague-CollegeMexia-CollegeGroesbeck-CollegeMarlin-CollegeCalvert-CollegeHearne-CollegeFranklin-CollegeRobertson-County-CollegeBremond-CollegeReagan-CollegeThornton-CollegeKosse-CollegeGiddings-CollegeDime-Box-CollegeLedbetter-CollegeSomerville-CollegeBurton-CollegeRound-Top-CollegeLa-Grange-CollegeFayetteville-CollegeSchulenburg-CollegeWeimar-CollegeColumbus-CollegeEagle-Lake-CollegeSealy-CollegeBellville-CollegeIndustry-CollegeNew-Ulm-CollegeBernard-CollegeCat-Spring-CollegeAlleyton-CollegeRock-Island-CollegeGarwood-CollegeAltair-CollegeLouise-CollegeHillje-CollegeEl-Campo-CollegeBoling-CollegeWharton-CollegeEast-Bernard-CollegeNeedville-CollegeBeasley-CollegeKendleton-CollegeOrchard-CollegeFairchilds-CollegeSimonton-CollegeFulshear-CollegeBrookshire-CollegePattison-CollegeWallis-CollegeSan-Felipe-CollegeNewgulf-CollegeDamon-CollegeBrazoria-CollegeWest-Columbia-CollegeSweeny-CollegeVan-Vleck-CollegeBay-City-CollegeMarkham-CollegeEl-Maton-CollegePalacios-CollegeBlessing-CollegeMidfield-CollegeCollegeport-CollegeMatagorda-CollegeWadsworth-CollegePledger-CollegeSargent-CollegeCedar-Lake-CollegeCedar-Lane-CollegeLane-City-CollegeHungerford-CollegeEgypt-CollegeGlen-Flora-CollegeDerobrachus hovorei
Palo Verde Root Borer, Palo Verde Beetle, Palo Verde Borer Beetle
Derobrachus hovorei is a large longhorn beetle native to the southwestern United States and northern Mexico. It was formally described as a distinct species by Santos-Silva in 2007, having been previously confused with D. geminatus for over a century. Adults are among the largest beetles in North America, reaching up to 3.5 inches in length. The species is named for its larval association with palo verde trees (Parkinsonia spp.), though it has been observed feeding on roots of various other tree species in urban environments.
Derobrachus leechi
Derobrachus leechi is a large prionine longhorn beetle described in 1977 from the southwestern United States and Mexico. It belongs to a genus commonly known as palo verde root borers, though specific host associations for this species remain undocumented. The species is rarely encountered in collections and field observations are sparse.
Derospidea
Derospidea is a genus of skeletonizing leaf beetles in the family Chrysomelidae, established by Blake in 1931. The genus contains at least three described species, including Derospidea brevicollis, Derospidea cyaneomaculata, and Derospidea ornata. Members are found in North America and Mexico. As skeletonizing leaf beetles, they feed on leaf tissue between the veins, leaving a characteristic lace-like pattern.
Diabrotica virgifera zeae
Mexican corn rootworm
Diabrotica virgifera zeae, the Mexican corn rootworm, is a subspecies of the western corn rootworm complex and a significant agricultural pest of corn (Zea mays) in Mexico and parts of the southern United States. Larvae feed on corn roots, causing damage that can lead to reduced yield, stunting, and plant lodging. Unlike the western corn rootworm subspecies (D. v. virgifera), the Mexican corn rootworm has been documented to damage corn following sorghum rotation in parts of South Central Texas, though this remains rare. Adults feed on corn silks, pollen, and leaves. The species has one generation per year, with eggs laid in soil during summer and fall, hatching the following spring when corn roots become available.
Diacanthous triundulatus
Diacanthous triundulatus is a species of click beetle in the family Elateridae. The genus Diacanthous is a small group within the click beetles, characterized by distinctive morphological features. Very few observations of this species exist in public databases, indicating it is either rare, cryptic, or undercollected.
Diaperis rufipes
Diaperis rufipes is a species of darkling beetle in the family Tenebrionidae, described by Horn in 1870. It is native to Mexico and belongs to a genus characterized by distinctive body forms. The species epithet 'rufipes' refers to reddish legs, a trait that distinguishes it from congeners. Like other members of Tenebrionidae, it is likely associated with decaying wood or fungal habitats, though specific ecological details remain poorly documented.
Diapheromera tamaulipensis
Tamaulipas Walkingstick
Diapheromera tamaulipensis, commonly known as the Tamaulipas Walkingstick, is a species of stick insect in the family Diapheromeridae. The species was described by Rehn in 1909 and is native to the southern United States and Mexico. It belongs to a genus of walkingsticks known for their elongated, twig-like bodies and cryptic appearance. Based on related species in the genus, adults likely exhibit strong crypsis resembling plant stems.
Diatraea lisetta
Dotted Diatraea
Diatraea lisetta is a moth in the family Crambidae, described by Harrison Gray Dyar Jr. in 1909. It belongs to the genus Diatraea, which includes several stalk-boring pest species of grasses. The species has been recorded from Panama, Mexico, and multiple southeastern and mid-Atlantic states in the United States. As a member of the Diatraea genus, it likely shares the general biology of related stalk borers, though specific ecological details for this species are poorly documented.
Dicaelus costatus
South Texas embossed carabid
Dicaelus costatus is a species of ground beetle in the family Carabidae, commonly known as the South Texas embossed carabid. It was described by John Lawrence LeConte in 1853. The species is endemic to southern Texas and adjacent regions of Mexico, representing a geographically restricted member of the genus Dicaelus.
Diceroprocta arizona
Plateau Flag-Bearer
Diceroprocta arizona is a species of cicada in the family Cicadidae, described by Davis in 1916. It is distributed across the southwestern United States and Central America, with records from Arizona and several Mexican states including Chiapas, Chihuahua, Durango, and Morelos. Like other members of the genus Diceroprocta, it is an annual cicada with a multi-year nymphal development period spent underground feeding on plant roots.
Diceroprocta delicata
Delicate Flag-Bearer
A small cicada species in the family Cicadidae, Diceroprocta delicata occurs in arid and semi-arid regions of the southern United States and Mexico. Like other Diceroprocta species, it produces sound using tymbal organs. The specific epithet 'delicata' suggests relatively small or slender proportions compared to congeners. Available records indicate it is an 'annual' cicada with staggered generations rather than synchronized periodic emergence.
Diceroprocta knighti
Dusty Flag-Bearer
Diceroprocta knighti is a cicada species in the family Cicadidae, distributed across the southwestern United States and northwestern Mexico. Like other members of its genus, it is an annual cicada with a multi-year nymphal stage spent underground feeding on tree and shrub roots. Adults emerge during summer months, with males producing species-specific acoustic signals to attract females. The species is part of the diverse cicada fauna of the Sonoran Desert region, where it co-occurs with related congeners at different elevations.
cicadaDiceroproctaSonoran-Desertannual-cicadaHemipteraCicadidaeacoustic-communicationroot-feeding-nymphssummer-emergencesouthwestern-North-Americaxylem-feederdesert-arthropodinsect-songmulti-year-life-cycletymbal-organmonsoon-associated-emergenceCicadinaeFidicininiDavis-1917Dusty-Flag-BearerArizonaCaliforniaBaja-CaliforniaSinaloaSonoraMexicoUnited-Statesarthropodinsecttrue-bugAuchenorrhynchaCicadomorphaCicadoideaGuyalninaDiceroprocta marevagans
Scrub Cicada
Diceroprocta marevagans is a species of cicada in the family Cicadidae, distributed across parts of Central America and North America. As a member of the genus Diceroprocta, it shares traits with other "annual" cicadas that appear every year due to staggered generations, rather than the synchronous emergences seen in periodical cicadas. The species inhabits scrubland and arid environments where it feeds on plant sap.
Diceroprocta texana
Texas Plain Flag-Bearer
A small cicada species distributed across the south-central United States and northern Mexico. Males produce audible songs and have been observed singing from vegetation including mesquite and blazingstar. The species exhibits a pale, nearly white venter that serves as a distinguishing field mark. Activity has been documented during mid-summer months.
Dichomeris barnesiella
Dichomeris barnesiella is a small gelechiid moth with distinctive bicolored forewings. The species was described from specimens collected in Arizona and Mexico. Adults are active during spring and late summer. The sharply divided wing pattern is unusual within the genus.
Dichomeris mulsa
Dichomeris mulsa is a species of gelechiid moth described by Ronald W. Hodges in 1986. It is known from limited localities in the southwestern United States and Mexico. The species belongs to the large genus Dichomeris, which contains numerous small moths with varied host plant associations. Available records indicate this species remains poorly collected and documented.
Dichoxenus
Dichoxenus is a genus of broad-nosed weevils in the family Curculionidae. A 2024 taxonomic revision recognized 25 species, including 17 newly described from Mexico and the southern United States. The genus was expanded through synonymy of Anametis and transfer of several species from other genera. Most species are nocturnal and associated with vegetation, though some occur in leaf litter and three species are known or suspected to be cave-dwelling.
Dichroplus notatus
Mexican Dichroplus
Dichroplus notatus is a grasshopper species in the family Acrididae, subfamily Melanoplinae, described by Bruner in 1908. It is native to arid and semi-arid regions of the southwestern United States and Mexico. The species is part of the diverse Dichroplus genus, which contains several economically significant grasshopper pests in South America, though D. notatus itself has not been documented as a major agricultural pest.
Diclidia
A genus of false flower beetles in the family Scraptiidae. The genus contains approximately 11 described species, primarily distributed in western North America and Mexico. Species were described primarily by Liljeblad between 1918 and 1945.
Didineis texana
Didineis texana is a species of sand wasp in the family Crabronidae, subfamily Bembicinae, tribe Alyssontini. It is one of several species in the genus Didineis, which are small to medium-sized wasps adapted to sandy habitats. The species was described by Cresson in 1873 and is known from the southern United States and Mexico. Like other members of its tribe, it is likely a predator of small insects, though specific biological details remain poorly documented.
Dielis tolteca
Toltec scoliid wasp
Dielis tolteca is a species of scoliid wasp native to western North America and Mesoamerica. The species is known to parasitize scarab beetle grubs, with females hunting underground hosts to provision their offspring. Adults have been observed feeding on flowering plants, particularly mustards (Brassicaceae) and goldenrods (Solidago). The species has been documented in McInnis Canyons National Conservation Area in western Colorado, where it is active as a spring-emerging species.
scoliid-waspparasitoidscarab-beetlewestern-ColoradoMcInnis-Canyonsspring-emergenceSolidagomustardsbiological-controlHymenopteraScoliidaeDielisCampsomerinibiodiversity-surveyintegrated-pest-managementmelissa-schreinerextension-entomologysaussure-1857toltec-scoliid-waspriparianColorado-Riverflower-visitornectar-feedingsolitary-waspground-nesting-parasitoidscarab-grub-parasitoidaculeateapocritaaculeatacampsomerinaewestern-North-AmericaNearcticNeotropicalMesoamericaArizonaBaja-CaliforniaSonoraunderground-host-hunterexternal-parasitoidlarval-provisioningspring-activeinsect-biodiversityrare-ecosystem-surveynatural-heritage-surveyCSU-extensionColorado-State-Universityagricultural-pest-managementtree-fruitwine-grapesrow-cropsinvasive-species-monitoringJapanese-beetlePopillia-japonicacorn-earwormHelicoverpa-zeaIPMpest-monitoringmoth-trappingB3-allele-testingcitizen-scienceDepartment-of-Agriculture-trappingtargeted-larval-treatmentsMesa-CountyPalisade-peachesOlathe-sweet-cornheritage-cropsWarner-College-of-Natural-ResourcesColorado-Natural-Heritage-SurveyOuray-Countyfield-surveyintensive-surveyunder-surveyed-countiesinsect-abundanceecosystem-healthfield-dayseducational-outreachcontinuing-educationcommercial-pesticide-applicatorslicensed-applicatorsvisual-artistnature-illustrationmixed-mediaArt-Bug-Studiosbotanical-illustrationinsect-illustrationColorado-Master-Gardeneradult-learninggarden-educationpest-identificationnaturalistphotographybackpackinghikinghistorical-siteswildernesssolitudemushroom-huntingedible-fungimorelschanterellesking-boletesSouthern-RockiesRainbow-troutfishingcampingbackwoods-cookingpublic-landsFront-Rangeyouth-farmerCultiva-Youth-Projectfarmers-marketsEuropean-honey-beewild-bee-swarmsplant-identificationvisual-skillsobservationfieldworkinsect-ecologyAmerican-southwestwildlife-and-peoplecomplex-historiesteachingnatural-worldcuriosityhands-on-experienceColorado-arthropodsstandout-ECPearly-career-professionalEntomological-Society-of-AmericaECP-Committeeterminal-degreeapplied-researcheducation-programtree-fruit-pest-managementwine-grape-pest-managementrow-crop-pest-managementinvasive-specieseradicationtrappinglarval-treatmentbiodiversity-documentationrare-ecosystemsunder-surveyed-regionsecosystem-surveyfive-year-surveyintensive-surveysunique-Colorado-ecosystemsagriculturePalisadeOlatheIPM-strategiescorn-earworm-managementsweet-corn-farmsarboristspublic-safetyeducational-programsColoradansfarmsschoolsmuseumsmaster's-degreeWhitney-Cranshawarthropod-diversityindustrial-hempPh.D.-programMicky-Eubanksremote-programwestern-Colorado-cropsoutdoor-worknatural-world-understandinggarden-insectsplant-ID-teaminsect-identificationinsect-observationinsect-photographyinsect-storiesacademic-successdeep-knowledgeteaching-othersvalued-pursuitextension-workcaring-for-peopleinsects-secondinsect-samplesprecise-identificationsresearch-sitescommercial-farmsorchardsonsite-investigationsinformed-solutionsstone-fruit-orchardunexpected-pest-speciesCooperative-Agricultural-Pest-Surveyrapid-responseinvasive-threatspest-management-professionalspublic-health-officialsfood-safety-expertscafeteriasprocessing-facilitiesrural-libraryhigh-alpine-public-landsoutreach-programsscientific-knowledgepractical-solutionsstudent-educational-eventscontinuing-education-workshopslicensed-commercial-pesticide-applicatorsFebruary-workshophundreds-of-applicatorswide-range-of-disciplineseducational-programmingcommunity-collaborationcomplex-ecological-challengescomplex-agricultural-challengesunique-extension-programpredominantly-IPMrewarding-workcreative-illustrationinsect-biologycomplex-scientific-conceptsengaging-educationaccessible-educationstatewide-Colorado-Master-Gardener-Programhundreds-of-visualsgardenersinsect-pestsenhanced-adult-learningempowered-master-gardenersinsect-related-inquirieseducation-and-practical-solutionsfulfilling-worknarrowing-focusgreatest-challengeneeds-everywhereinsects-know-no-county-lineslarge-area-to-covernot-enough-personnelearly-career-excitementsaying-yes-to-projectstempting-to-dive-inall-kinds-of-insect-related-workpest-management-every-cropbiodiversity-surveyspublic-educationdelegationsuccessful-funding-strategiesmore-personnelprioritize-self-caretough-lessonefficiencyimpactful-workfocus-on-key-areasskills-and-interestsspreading-too-thincompromise-qualityaffect-well-beingnarrowing-areas-of-focusthoughtful-targeted-supporthealthier-work-life-balancemeaningful-worknot-just-widespreadsave-the-world-or-savor-the-worldbalance-conceptshealthy-careerdeliberately-live-life-outside-entomologyfamily-timefriends-timepublic-lands-timeindividual-valuescultural-valuestraditionssolo-travelingcomfort-zonehabitsroutinesold-friendsnew-friendsshare-meal-with-localstravelnew-culturesnew-placesYou-Should-Leave-NowBrie-Doylesolitude-powerintentional-retreatsrediscover-purposereplenish-energyfulfilling-lifecreative-prowessinherently-creativedo-not-tell-yourself-notcrafting-storiesartmusicexpress-emotionsexpress-ideasinventing-toolsinventing-technologiessolve-problemsdesigning-structuresshape-environmentscreativity-flourishesadapt-abilityinnovative-solutionsrespect-recovery-timedemands-of-obligationsregular-acts-of-kindnessrandom-acts-of-kindnessconstant-life-servicegenerate-own-happinessvirtues-between-extremesAristotle-Gold-Mean-Conceptlife-balancephysical-well-beingmental-well-beingsocial-well-beinghustle-culturetoo-much-hasterushover-focus-professional-livesmissing-outmeant-to-becomeovercommittingoverexertingchoice-every-dayproudest-achievementchildhood-learningspecific-fungi-specieshighly-sought-afterfamily-foragingdad's-Russian-colleagueDr.-Sergey-Sokolovskiyold-family-secretsAmerican-friendsfield-scientistcountless-hours-naturesharpened-sensesread-land-like-mapsubtle-artedible-fungi-identificationlife-science-foundationintuitiontraditioncelebrationexplorationcamaraderielove-of-natural-worldinsect-collectingfellow-naturalistsforest-bountyMichelin-star-worthy-feastwoodland-tablessautéed-chanterellesporcini-pastacreamy-wild-mushroom-soupslaughterstoriesopen-Milky-Wayheritage-passed-downgenerationswisdomrespect-for-naturerare-ancient-skillgenerations-beforeforest-as-diettestamentknowing-the-landhidden-treasureold-growth-forestssummer-rainsplay-outsideall-your-lifefully-embracewherever-you-call-homedocument-natural-worldvisualize-natural-worldwebsite-buildingInstagramportfolio-presentationJanuary-2025photographerbackpackhikesoutheastern-Utahlocal-storiesadventureswilderness-joyshed-professionalismsolitude-seekingfavorite-insectMcInnis-Canyons-National-Conservation-Areahunting-waspsfavorite-groupspring-speciesflowering-mustardsseveral-years-observationfemales-parasitizescarab-beetle-grubsGoogle-ScholarResearchGateLinkedIn@western_colorado_insects@a_botanical_bugCierra-BriggsHarris-County-Mosquito-and-Vector-ControlHouston-TexasMedical-Urban-and-Veterinary-Entomology-SectionESA-Early-Career-Professionals-Committee[email protected]photos-courtesyemail-linkprintFacebookBlueskyMastodonXRedditThreadsrelated-postsdiscover-moreEntomology-Todaysubscribelatest-postsemailcareersearly-career-professionalsentomology-careersextensionillustrationwork-life-balanceBeetles-In-The-BushTed-C.-MacRaeArt-EvansWhat's-Bugging-Youphotograph10-years-agodifficult-challengeguessesidentitylocationpast-monthsdiggingkey-to-identityorder-gimme2-pointsfamily-difficult4-pointstaxonomic-changes-hintgenus-challenge6-pointsonline-resourcesspecies-name-impossibleshort-listdescribed-speciesgeneral-areabonus-pointsadditional-picturesanswer-commentcouple-daysOrthopteraStenopelmatidaeStenopelmatusNorth-AmericanOklahomafuscusdarkAnostostomagenuschange-of-heartfamilyold-worldmorphological-similaritiesking-cricketheadlegsantennaepostnotumJerusalem-cricketlocalityspecies-short-listvariablephotograph-10-years-agoRussia-adjacent-countrytagsMexicoNew-ZealandSouth-AfricaHemiandrusstumpy-hindspdf-resourceBochusspineynessgenicular-lobesconservation-biologistwork-in-progressentomologistNasidiusgenaecheeklower-genaehead-modificationmandible-enlargementnormal-looking-headfemalemale-without-modificationsLibanasidus-vittatusone-spineinner-marginforetibiatwo-spinesthoracic-abdominal-tergitesblack-posterior-marginOnosandrus-spdissertationcolor-variablenot-diagnosticeight-generaking-cricketsmale-Onosandridus-spcouplet-1tympanum-not-obviousfore-tibiacouplet-2two-spines-inner-margincouplet-3no-mandible-enlargementovipositor-not-longcouplet-5no-large-ovipositormalesmooth-facenot-BochusOnosandriduskeyReview-of-southern-African-AnostostomatidaeBrettschneiderhind-femur-never-armedspines-hooksmales-no-head-modificationSam-HeadsOrthoptera-expertIllinois-Natural-History-SurveyAnostostomatidaegenus-Onosandridus-Péringueytwo-impressive-spinesinner-surface-protibiaBochus-characteristichead-face-tuberculateformer-genusspecimen-clearly-notHeathJasoncorrect-genusHeath-firstpointsPeterChrisfinal-standingsZiad-KhouriZeroing-in-on-Mammoth-WaspsScoliid-WaspsBug-SquadUC-Davis-doctoral-candidateLynn-Kimseymajor-professordistinguished-professorseminarUC-Davis-Department-of-Entomology-and-NematologyWednesday-March-30spring-quarter-seminars4:10-p.m.Pacific-Daylight-Time122-Briggs-HallZoomunique-workmodern-systematic-treatmentgenus-species-level-taxonomy-messmodern-classical-techniquestaxonomic-orderevolution-discoveredBohart-Museumeight-million-insect-specimens2300-mammoth-wasp-specimensAmericasKoreatwo-partsEvolutionary-History-of-Mammoth-WaspsComparing-Power-of-Data-Based-Phylogenetic-Posterior-Predictive-ChecksCucleotide-Amino-Acid-DataabstractsPart-1aculeate-insectslarvae-parasitoidsscarabaeid-beetle-grubsbiological-control-agentsgroup-evolutionstability-taxonomyreliable-phylogenies-limitedultraconserved-element-UCE-dataconcatenationmultispecies-coalescentphylogeny-Scoliidaemitigate-model-misspecificationdata-filtering-experimentsposterior-predictive-checksmatched-pairs-tests-symmetryProscolia-sisterall-other-extant-scoliidsstrong-supportsister-group-relationshipcampsomerine-genus-ColpaScoliiniCampsomerini-non-monophyleticCampsomerini-sensu-strictomonophyleticAustralasian-genus-Trisciloasister-remaining-memberssampled-genera-non-monophyleticCampsomeriellaMegascoliaScoliafossil-dataEarly-Cretaceous-origincrown-Scoliidaesplit-Scoliini-ColpaCampsomerini-s.s.Late-Cretaceousposterior-meanscrown-agesPaleogeneage-95%-HPD-intervalsK-Pg-boundaryfossils-less-certain-placementolder-agesstem-agesNearctic-scoliid-cladesBeringia-dispersalOligocene-later-Eocenefoundation-future-researchscoliid-wasp-evolution-biogeographyfirst-genome-scale-datamodel-based-methodsprecision-dating-analysespaucity-well-preserved-fossilsreliably-attributablecrown-grouphigher-level-taxonomy-dire-need-revisiontaxonomic-changes-predicateddatasets-extend-geographic-taxonomic-samplingPart-IIphylogenetic-inferenceexonic-DNA-sequencesmultiple-codingsnucleotidesamino-acidscodonsempirical-studiesdata-type-choicemodel-choiceless-expected-violationinaccurate-inferenceassessing-phylogenetic-model-adequacyinference-reliability-indicationsimulation-based-approachdetect-model-inadequacyphylogenetic-posterior-predictiondata-coding-variationsimulated-data-multiple-modelscodon-modelsprocess-heterogeneity-lineagesselection-heterogeneity-sitescodon-usage-selectioninference-posterior-predictive-checksnucleotide-amino-acid-modelsGTR-familysignificant-differencesamino-acid-nucleotide-treatmentsdetect-model-violationmagnitude-error-estimate-interest-similarcorroborate-other-studiestree-length-estimation-errortopology-reconstruction-errornot-always-correlatedamino-acid-modelsmore-accurate-topologiestree-length-errors-greaternucleotide-modelsbranch-heterogeneous-codon-modelsmagnitude-directiondata-coding-dependencedata-generating-process-propertiesposterior-predictive-checks-data-filteringpractical-effect-size-thresholdslow-inference-reliabilityestablished-separatelyamino-acid-nucleotide-datacaution-advisedcareful-model-selectiondata-coding-careful-selectionaccurate-tree-length-inference-important2012-graduate-programdoctorate-entomologydissertation-researchphylogenetics-evolution-taxonomy-Scolliidaebachelor's-degree-biology2012Notre-Dame-University-Louaize-NDUundergraduate-researchbee-pollinator-identificationAmerican-University-Beirutgenetic-diversity-assessmentSpartium-junceum-populationsSpanish-broomrush-broomweaver's-broominsect-collection-establishmentNDU-specimen-collectionUC-Davis-teamnational-Linnaean-Games2015-Entomological-Society-of-America-meetingEntomology-GamesUniversity-of-Florida32-year-history-first-winvideoBohart-Museum-locationRoom-1124-Academic-Surge-BuildingCrocker-Lanecurrently-closed-publiclive-petting-zooMadagascar-hissing-cockroachesstick-insectstarantulasinsect-themed-gift-shoponlineShahid-Siddiqueassistant-professorseminar-coordinatorZoom-technical-issues[email protected]seminar-listTrisciloa-saussureiNew-Guinea-nativeBohart-Museum-specimenBug-EricWasp-WednesdayCampsomerisDecember-22-2010mystery-waspDecemberemail-friendspecies-recorded-recently-ArizonaMexican-borderSabino-Canyon-Recreation-AreaFred-Heathoutstanding-naturalistIntroduction-to-Southern-California-ButterfliesSabino-Canyon-Volunteer-NaturalistsDecember-14male-specimenCampsomeris-ephippiumDesert-LavenderHyptis-emoryiconspicuous-distinctiveno-image-neededemail-list-messageDavid-LazaroffSCVN-foundercameraimage-permissionlong-antennaeslender-bodypseudostingerposterior-abdomengender-revealrobust-femalesshorter-antennaereal-stingerretractable-stingerhosts-larval-offspringspring-2009-imagesouth-Texassouth-to-EcuadorSunday-December-19failed-to-findcommon-local-speciesCampsomeris-toltecamales-feedingnectar-Coreocarpus-arizonicusLittle-LemonheadQueen-butterfliesMexican-YellowsScoliidae-familyall-parasitoidsparasitoid-definitionheavy-spiny-legsdig-up-scarab-grubsting-brief-paralysissingle-egghost-larvaleave-scenehost-regains-consciousnessmotor-skillsunderground-existenceplant-roots-feedingwasp-egg-hatchesexternal-parasitebeetle-grubpleasure-of-huntSabino-CanyonFred-Heath-outdoorsDavid-Lazaroff-image10:00-AMEmail-ThisBlogThisShare-to-XShare-to-FacebookShare-to-Pinterestanimalsbugsinsectsnaturewaspswildlifecommentsgreat-storybeautiful-waspslearn-somethingenvy-abilityoutside-warm-weatherimpending-snowbug-hunt-hopetwo-blogsMosquito-Hawksame-Lemonhead-bushworld-shrinks-DecemberTumacacori-NHPlast-week-sightingphoto-contactmore-sightings-head's-upsecond-photo-speciesuncertainArizona-couple-speciesspecimen-in-hand-neededBeatty's-Guest-RanchMiller-Canyonapple-trees-pollinatinglast-weekendblog-author-unable-replyworking-to-resolvenewer-postolder-posthomesubscribe-post-commentsatomGBIF-taxonomy-matchaccepted-statusexact-matchAnimalia-Arthropoda-Insecta-Hymenoptera-Scoliidae-Dielisdistribution-recordsNA-NTMexico-statesBaja-California-SurCampecheChiapasCoahuilaGuanajuatoGuerreroJaliscoMichoacánMorelosOaxacaQuintana-RooSinaloaTabascoVeracruzEl-Salvador-San-SalvadorGuatemala-HuehuetenangoHonduras-ComayaguaNicaragua-RivasMap-3HaitiUnited-StatesBradley-1828Hurd-1952Porter-1981MacKay-1987iNaturalist-taxon2987-observationspreferred-common-nameWikipedia-summarySolidago-plantsiNaturalist-taxonomyGrasshoppers-of-ColoradoGrasshoppers-of-Wyoming-and-the-WestEntomologygrasshopper-namesgenus-speciescommon-scientificspecies-genusabdominalis-Chloealtisadmirabilis-Syrbulaagrestis-Trimerotropisalba-Hypochloraalpinus-Ceuthophilusalpinus-Melanoplusalutacea-Schistocercaangustipennis-Melanoplusapiculata-Pardalophoraargentinus-Oecanthusarizonae-Melanoplusaspera-Trachyrhachysbicolor-Dactylotumbispinosus-Melanoplusbivittata-Mermiriabivittatus-Melanoplusbolli-Spharagemonborealis-Melanoplusbowditchi-Melanoplusbrachyptera-Pseudopomalabrevipes-Daihniabruneri-Melanoplusbrunneus-Stenobothruscalifornica-Trimerotropiscalifornicus-Oecanthuscampestris-Trimerotropiscapito-Hippopedoncarlinianus-Circotettixcarolina-Dissosteirachenopodii-Aeoloplidescincta-Trimerotropiscitrina-Trimerotropisclavatus-Aeropedelluscollare-Spharagemoncoloradus-Amphitornuscomplanatipes-Melanoplusconfusus-Melanoplusconspersa-Arphiaconspersa-Chloealtiscorallipes-Xanthippuscoronata-Trachyrhachyscrenulata-Cordillacriscurtipennis-Chorthippuscyaneipennis-Trimerotropiscyaneus-Leprusdawsonii-Melanoplusdelicatula-Psoloessadeorum-Ageneotettixdifferentialis-Melanoplusdiscolor-Melanoplusdodgei-Melanopluselliotti-Aulocaraenigma-Oedaloenotusequale-Spharagemonfasciatus-Melanoplusfemoratum-Aulocarafemurrubrum-Melanoplusflavidus-Melanoplusfoedus-Melanoplusfontana-Trimerotropisformosus-Tropidolophusfratercula-Trimerotropisfusiformis-Ceuthophilusgladstoni-Melanoplusglaucipes-Melanoplusgracile-Stethophymagracilis-Trimerotropishaldemanii-Pardalophorahaydeni-Derotmemahirtipes-Acrolophitushumile-Spharagemoninconspicua-Trimerotropisinfantilis-Melanopluskeeleri-Melanopluskennicotti-Melanopluskiowa-Trachyrhachyslakinus-Melanopluslatifasciata-Trimerotropislongipennis-Dissosteiramagna-Brachystolamagnifica-Trimerotropismelanoptera-Trimerotropismontanus-Xanthippusmontezuma-Syrbulanebrascensis-Phoetaliotesneglectus-Cratypedesnevadensis-Acrolophitusniveus-Oecanthusnubilum-Boopedonobscura-Opeiaoccidentalis-Melanoplusoccipitalis-Cordillacrisocelote-Hippiscusolivacea-Campylacanthaoregonensis-Melanopluspackardii-Melanopluspallidipennis-Trimerotropispardalinus-Metatorparviceps-Cibolacrispelidna-Orphulellapellucida-Camnulapicta-Mermiriapistrinaria-Trimerotropisplattei-Mestobregmaponderosus-Melanopluspseudonietana-Arphiaquadrimaculatum-Phlibostromaquadripunctatus-Oecanthusrabula-Circotettixregalis-Melanoplusrobusta-Udeopsyllarobustus-Leprusrufa-Heliaulasanguinipes-Melanoplussimplex-Anabrussimplex-Arphiasimplex-Eritettixsordidus-Encoptolophussparsa-Trimerotropisspeciosa-Orphulellaspeciosus-Hesperotettixsplendidus-Melanoplusspretus-Melanoplusspurcata-Dissosteirasubgracilis-Encoptolophussulcifrons-Conozoatenuipennis-Aeoloplidestexana-Conozoatexana-Mermiriatexana-Psoloessatolteca-Trimerotropistrifasciatus-Hadrotettixtristis-Melanoplusturnbulli-Aeoloplidesutahensis-Ceuthophilusverruculatus-Trimerotropisvirgata-Paropomalaviridifasciata-Chortophagaviridis-Hesperotettixwyomingensis-Paropomalaxanthoptera-Arphiayarrowii-Melanoplusnot-true-grasshoppersAcrididaediscussed-manualconfused-with-grasshopperstop-of-pageback-to-contentsnavigation-main-pagelearn-morebiologydistribution-mapsfact-sheetskey-to-stagesgrasshopper-developmentgrasshopper-names-common-scientificgrasshopper-names-species-genusgrasshopper-names-genus-speciesAcrolophitus-hirtipesAcrolophitus-nevadensisAeoloplides-chenopodiiAeoloplides-tenuipennisAeoloplides-tumbulliAeropedellus-clavatusAgeneotettix-deorumAmphitomus-coloradusAnabrus-simplexArphia-conspersaArphia-pseudonietanaArphia-simplexArphia-xanthopteraAulocara-elliottiAulocara-femoratumBoopedon-nubilumBrachystola-magnaCamnula-pellucidaCampylacantha-olivaceaCeuthophilus-alpinusCeuthophilus-fusiformisCeuthophilus-utahensisChloealtis-abdominalisChloealtis-conspersaChorthippus-curtipennisChortophaga-viridifasciataCibolacris-parvicepsCircotettix-carlinianusCircotettix-rabulaConozoa-suicifronsConozoa-texanaCordillacris-crenulataCordillacris-occipitalisCratypedes-neglectusDactylotum-bicolorDaihnia-brevipesDerotmema-haydeniDissosteira-carolinaDissosteira-longipennisDissosteira-spurcataEncoptolophus-sordidusEncoptolophus-subgracilisEritettix-simplexGryllus-sppHadrotettix-trifasciatusHeliaula-rufaHesperotettix-speciosusHesperotettix-viridisHippiscus-oceloteHippopedon-capitoHypochlora-albaLeprus-cyaneusLeprus-robustusMelanoplus-alpinusMelanoplus-angustipennisMelanoplus-arizonaeMelanoplus-bispinosusMelanoplus-bivittatusMelanoplus-borealisMelanoplus-bowditchiMelanoplus-bruneriMelanoplus-complanatipesMelanoplus-confususMelanoplus-dawsoniiMelanoplus-differentialisMelanoplus-discolorMelanoplus-dodgeiMelanoplus-fasciatusMelanoplus-femurrubrumMelanoplus-flavidusMelanoplus-foedusMelanoplus-gladstoniMelanoplus-glaucipesMelanoplus-infantilisMelanoplus-keeleriMelanoplus-kennicottiMelanoplus-lakinusMelanoplus-occidentalisMelanoplus-oregonensisMelanoplus-packardiiMelanoplus-ponderosusMelanoplus-regalisMelanoplus-sanguinipesMelanoplus-splendidusMelanoplus-spretusMelanoplus-tristisMelanoplus-yarrowiiMermiria-bivittataMermiria-pictaMermiria-texanaMestobregma-platteiMetator-pardalinusOecanthus-argentinusOecanthus-californicusOecanthus-niveusOecanthus-quadripunctatusOedaloenotus-enigmaOpeia-obscuraOrphulella-pelidnaOrphulella-speciosaPardalophora-apiculataPardalophora-haidemaniiParopomala-virgataParopomala-wyomingensisPhlibostroma-quadrimaculatumPhoetaliotes-nebrascensisPseudopomala-brachypteraPsoloessa-delicatulaPsoloessa-texanaSchistocerca-alutaceaSpharagemon-bolliSpharagemon-collareSpharagemon-equaleSpharagemon-humileStenobothrus-brunneusStethophyma-gracileSyrbula-admirabilisSyrbula-montezumaTrachyrhachys-asperaTrachyrhachys-coronataTrachyrhachys-kiowaTrimerotropis-agrestisTrimerotropis-californicaTrimerotropis-campestrisTrimerotropis-cinctaTrimerotropis-citrinaTrimerotropis-cyaneipennisTrimerotropis-fontanaTrimerotropis-fraterculaTrimerotropis-gracilisTrimerotropis-inconspicuaTrimerotropis-latifasciataTrimerotropis-magnificaTrimerotropis-melanopteraTrimerotropis-pallidipennisTrimerotropis-pistrinariaTrimerotropis-sparsaTrimerotropis-toltecaTrimerotropis-verruculatusTropidolophus-formosusUdeopsylla-robustaXanthippus-corallipesXanthippus-montanustrue-grasshoppersAcrididae-discussedmanual-confusedgrasshoppers-toppage-backcontents-navigationmain-pagelearn-more-biologydistribution-maps-factsheets-keystages-grasshopperdevelopment-grasshoppersColorado-grasshoppersWyoming-WestEntomology-GRASSHOPPERSCOLORADO-GRASSHOPPERNAMES-GENUSSPECIES-GRASSHOPPERNAMES-COMMONSCIENTIFIC-GRASSHOPPERNAMES-SPECIESGENUS-abdominalisChloealtis-ThomasUhler-agrestisTrimerotropis-McNeillDodge-alpinusCeuthophilus-ScudderScudder-alutaceaSchistocerca-ScudderDodge-apiculataPardalophora-HarrisSaussure-arizonaeMelanoplus-ScudderScudder-bicolorDactylotum-ThomasScudder-bivittataMermiria-ServilleSay-bolliSpharagemon-MorseFieber-bowditchiScudder-brevipesDaihnia-HaldemanScudder-brunneusStenobothrus-ThomasBruner-californicusOecanthus-SaussureMcNeill-capitoHippopedon-StalThomas-carolinaDissosteira-LBruner-cinctaTrimerotropis-ThomasScudder-clavatusAeropedellus-ThomasScudder-coloradusAmphitornus-ThomasScudder-confususScudder-conspersaChloealtis-HarrisHaldeman-coronataTrachyrhachys-ScudderBruner-curtipennisChorthippus-HarrisBruner-cyaneusLeprus-CockerellScudder-delicatulaPsoloessa-ScudderScudder-differentialisMelanoplus-ThomasScudder-dodgeiThomas-enigmaOedaloenotus-ScudderSay-fasciatusMelanoplus-F-WalkerScudder-femurrubrumMelanoplus-DeGeerScudder-foedusThomas-formosusTropidolophus-SayMcNeill-fusiformisScudder-glaucipesScudder-gracilisScudder-haydeniDerotmema-ThomasSay-humileBruner-infantilisThomas-kennicottiThomas-lakinusScudder-longipennisDissosteira-ThomasGirard-magnificaTrimerotropis-RehnMcNeill-montanusXanthippus-ThomasSaussure-nebrascensisPhoetaliotes-ThomasThomas-nevadensisAcrolophitus-ThomasDeGeer-nubilumBoopedon-SayThomas-occidentalisThomas-oceloteHippiscus-SaussureScudder-oregonensisScudder-pallidipennisTrimerotropis-BurmeisterSaussure-parvicepsCibolacris-BrunerBurmeister-pellucidaCamnula-ScudderWalker-pistrinariaTrimerotropis-SaussureThomas-ponderosusThomas-quadrimaculatumPhlibostroma-ThomasBeutenmuller-rabulaCircotettix-RehnHebard-regalesMelanoplus-DodgeHaldeman-robustusLeprus-HebardScudder-sanguinipesMelanoplus-FabriciusHaldeman-simplexArphia-ScudderScudder-sordidusEncoptolophus-BurmeisterThomas-speciosaOrphulella-ScudderScudder-splendidusMelanoplus-HebardWalsh-spurcataDissosteira-SaussureCaudell-sulcifronsConozoa-ScudderScudder-texanaConozoa-BrunerBruner-texanaBrunner-trifasciatusHadrotettix-SayBruner-turnbulliAeoloplides-CaudellThomas-verruculatusTrimerotropis-ScudderScudder-viridifasciataChortophaga-DeGeerScudder-wyomingensisParopomala-ThomasBurmeister-yarrowiispecies-not-truegrasshoppers-Acrididaediscussed-manual-becausetop-of-thepage-back-toContents-Navigation-MainPage-Grasshoppers-ofColorado-LEARN-MOREBiology-Distribution-MapsFact-Sheets-Keyto-Stages-ofGrasshopper-Development-BiologyDistribution-Maps-LEARNMORE-Distribution-MapsFact-Sheets-LEARNMORE-Grasshoppers-ofColorado-Fact-Sheetsof-Grasshopper-DevelopmentLEARN-MORE-GrasshoppersDieunomia nevadensis arizonensis
Arizona Nomia
Dieunomia nevadensis arizonensis, known as the Arizona Nomia, is a subspecies of sweat bee in the family Halictidae. It is a ground-nesting bee distributed across the southwestern United States and adjacent regions of Mexico. The subspecies was first described by Cockerell in 1899 and is distinguished from the nominate subspecies by geographic range and subtle morphological differences. Like other members of the genus Dieunomia, it is a specialist pollinator associated with particular host plants.
Diguetia canities
desert bush spider
Diguetia canities, commonly known as the desert bush spider, is a species of coneweb spider in the family Diguetidae. It is the most widely distributed species in its genus, occurring across desert and semidesert habitats from California to Oklahoma and Texas. The spider constructs a distinctive dome-shaped sheet web with a tubular retreat, often placed in bushes or cacti less than 60 cm above ground. It produces a potent insect-selective venom peptide called Dc1a.
Diguetia signata
desertshrub spider
Diguetia signata is a species of desertshrub spider in the family Diguetidae, first described by Gertsch in 1958. It inhabits arid regions of the southwestern United States and Mexico, where it constructs distinctive horizontal sheet webs with central tubular retreats. The species belongs to a primitive spider lineage characterized by simple genital structures.
Dihammaphora dispar
Dihammaphora dispar is a species of longhorn beetle in the family Cerambycidae. It was described by the French entomologist Louis Alexandre Auguste Chevrolat in 1859. The genus Dihammaphora belongs to the tribe Rhopalophorini within the subfamily Cerambycinae. Very little specific information is available about the biology or ecology of this particular species.
Dioryctria erythropasa
Dioryctria erythropasa is a small snout moth in the family Pyralidae, described by Harrison Gray Dyar Jr. in 1914. The species ranges from Arizona southward along the Mexican Pacific coast to Central America. Adults have a wingspan of 23–32 mm. Like other members of the genus Dioryctria, the larvae likely develop in conifer cones or shoots, though specific host associations for this species remain undocumented.
Diplocentrus
Toothed Scorpions
Diplocentrus is a genus of scorpions in the family Diplocentridae, commonly known as toothed scorpions. The genus contains more than 60 described species distributed primarily in Central America, Mexico, and the southwestern United States. Species in this genus are characterized by their elongated pedipalps and distinctive tooth-like structures on the chelicerae. The genus includes both mainland and island-dwelling species, with documented occurrences in the Chisos Mountains of Texas and Islas de la Bahía in Honduras.
Diplocentrus spitzeri
Ruby Rock Scorpion
Diplocentrus spitzeri is a scorpion species in the family Diplocentridae, endemic to the Sierra Madre Occidental in Sonora, Mexico. The species exhibits distinctive maternal care behaviors, including a specialized birth posture where the female elevates her body on her legs and pedipalps while young emerge from the genital opercula and climb onto her back. First instar young remain on the mother's back until their first molt, during which time the female displays defensive behaviors to protect them. The species inhabits rocky pine-oak forest environments, where it shelters under stones and in rock crevices.
Diplotaxis abnormis
Diplotaxis abnormis is a small scarab beetle in the family Scarabaeidae, subfamily Melolonthinae. The species was described by Fall in 1909 and belongs to the tribe Diplotaxini. It is distributed in the southwestern United States (Arizona, New Mexico) and northern Mexico (Chihuahua, Sonora). Like other members of the genus Diplotaxis, it is likely a nocturnal species that congregates on vegetation to detect pheromone trails for mate location.
Diplotaxis cribulosa
Diplotaxis cribulosa is a species of scarab beetle in the family Scarabaeidae, first described by John Lawrence LeConte in 1856. The species is classified in the subfamily Melolonthinae and tribe Diplotaxini. Two subspecies are recognized: the nominate D. c. cribulosa and D. c. sinaloa described by Vaurie in 1958. Like other members of the genus Diplotaxis, this species is attracted to lights at night, where males have been observed congregating on low vegetation to detect pheromone trails of females.
Diplotaxis mimosae
Diplotaxis mimosae is a small scarab beetle in the family Scarabaeidae, subfamily Melolonthinae, and tribe Diplotaxini. The species was described by Fall in 1909. It is known from the southwestern United States (Arizona) and northwestern Mexico (Sonora). Like other members of the genus Diplotaxis, it is likely attracted to pheromones and may be found on low vegetation.
Diplotaxis puberula
Downy Diplotaxis
Diplotaxis puberula is a species of scarab beetle in the family Scarabaeidae, first described by LeConte in 1863. It is distributed across parts of North and Central America, with records from Texas in the United States and the Mexican states of Nuevo León and Tamaulipas. The species belongs to the chafers (Melolonthinae), a diverse subfamily whose larvae typically develop in soil and feed on roots.
Diplotaxis rufiola
A small scarab beetle species in the genus Diplotaxis, described by Fall in 1909. It belongs to the tribe Diplotaxini within the subfamily Melolonthinae. The species has been documented across the southwestern United States and northern Mexico.
Diplotaxis subangulata
Diplotaxis subangulata is a small scarab beetle in the family Scarabaeidae, subfamily Melolonthinae, described by LeConte in 1856. The genus Diplotaxis comprises small chafers, and this species occurs across western North America from British Columbia to Baja California, with records throughout the southwestern United States. Adults have been observed congregating on low vegetation, apparently to intercept pheromone trails in search of mates. The species is attracted to lights at night.
Distremocephalus
glowworm beetles
Distremocephalus is a genus of glowworm beetles in the family Phengodidae, established by Wittmer in 1976. The genus comprises approximately 11 described species distributed across North America, primarily in the southwestern United States and Mexico. Members are bioluminescent beetles commonly known as glowworms, with most species described by Zaragoza in 1986.
Distremocephalus mexicanus
Distremocephalus mexicanus is a beetle species in the family Phengodidae, a group commonly known as glow-worm beetles or railroad worms. The species was described by Wittmer in 1963 and is native to Mexico. Phengodidae are bioluminescent beetles, with larvae and adult females typically producing light from specialized organs. Males are usually winged and non-luminous, while females are larviform and luminous. The genus Distremocephalus belongs to the tribe Mastinocerini within the subfamily Phengodinae.
Dorymyrmex smithi
Smith's Pyramid Ant
Dorymyrmex smithi is a species of pyramid ant in the genus Dorymyrmex, described by Cole in 1936. The species is endemic to the United States and Mexico. Pyramid ants are known for their distinctive conical nest mounds and preference for open, dry habitats. Dorymyrmex smithi is part of a genus that exhibits high diversity in the Neotropics and has undergone rapid evolutionary radiation in North America.
Draeculacephala navicula
Draeculacephala navicula is a species of leafhopper in the family Cicadellidae, described by Hamilton in 1985. It belongs to the genus Draeculacephala, a group of sharpshooters known for their association with various host plants and their role as vectors of plant pathogens. The species has been recorded from southern Texas in the United States and the Mexican states of Chiapas and Tamaulipas. Like other members of its genus, it is likely associated with grassland and agricultural habitats, though specific ecological details remain limited in published literature.
Draeculacephala soluta
Draeculacephala soluta is a species of leafhopper in the family Cicadellidae, first described by Gibson in 1919. It belongs to the genus Draeculacephala, a group of sharpshooter leafhoppers known for their association with various host plants and their role as vectors of plant pathogens. The species has been recorded from multiple localities in Mexico and Central America. Like other members of its genus, it is likely associated with herbaceous vegetation and agricultural settings.
Drassyllus mormon
Drassyllus mormon is a ground spider species in the family Gnaphosidae, first described by Chamberlin in 1936. It occurs in western North America, with records from the United States and Mexico. As a member of the genus Drassyllus, it is part of a diverse group of small to medium-sized ground-dwelling spiders commonly known as ground spiders or gnaphosids.
Druon quercuslanigerum
Druon quercuslanigerum is a cynipid gall wasp that alternates between sexual and asexual generations on live oaks. The sexual generation forms small galls on catkins in spring, while the asexual generation produces distinctive woolly galls on leaf undersides. It is one of only two species in the genus Druon with documented alternating generations.
Dysschema howardi
Northern Giant Flag Moth
Dysschema howardi, known as the Northern Giant Flag Moth, is a species of tiger moth in the family Erebidae. It was described by Edwards in 1887. The species is found in southwestern United States and northwestern Mexico. It belongs to a genus characterized by large, boldly patterned moths often referred to as "flag moths" due to their striking wing patterns.
Dytiscus habilis
Dytiscus habilis is a predaceous diving beetle in the family Dytiscidae. It is the only species in the genus Dytiscus known to occur in the Neotropics, with its range extending from the southwestern United States through Mexico to Guatemala. The species was described by Thomas Say in 1830.
Eacles oslari
Oslar's eacles, Oslar's Imperial Moth
Eacles oslari is a large silk moth in the family Saturniidae, native to the Sky Islands region of southeastern Arizona and adjacent northern Mexico. Adults display variable wing coloration ranging from yellow to purple-brown. The species was described by Walter Rothschild in 1907 and named after Ernest J. Oslar, the first entomology curator of the Colorado Museum of Natural History. Adults are active during the summer monsoon season and are known to be vulnerable to bat predation.
Ebo evansae
Evans's Running Crab Spider
Ebo evansae is a species of running crab spider in the family Philodromidae. The genus Ebo is characterized by extremely elongated second legs that are at least twice the length of the other legs, giving these small spiders the greatest relative leg span for their body size among North American spiders. Body length ranges from 2–6 mm depending on species. The genus name derives from a medieval German diminutive meaning 'prince' or 'lord'. Ebo evansae occurs in the United States and Mexico.
Eburia mutica
Lesser Ivory-marked Beetle
Eburia mutica is a species of longhorn beetle in the family Cerambycidae, tribe Eburiini. It is commonly known as the Lesser Ivory-marked Beetle. The species occurs in North America and Middle America, with records from both the United States and Mexico. Like other members of the genus Eburia, it is characterized by distinctive ivory-colored markings on the elytra.
Ectomis
Ectomis is a genus of skipper butterflies in the family Hesperiidae, subfamily Eudaminae. The genus was established by Mabille in 1878 and contains approximately 30 recognized species distributed across the Neotropical and southern Nearctic regions. Species within Ectomis exhibit considerable variation in wing pattern and distribution, with many restricted to specific regions of Central and South America. The genus is divided into two subgeneric groupings: Ectomis (Ectomis) and Ectomis (Asina).
Ectromatopsis americana
Ectromatopsis americana is a species of parasitic wasp in the family Encyrtidae, a large and diverse family within the superfamily Chalcidoidea. The species was described by Howard in 1898. As with other encyrtid wasps, it is presumed to be a parasitoid, though specific host associations and biological details remain poorly documented in published literature. The genus Ectromatopsis is relatively obscure, with limited species-level information available.
Ectypia mexicana
Ectypia mexicana is a moth in the family Erebidae, subfamily Arctiinae (tiger moths). First described by Paul Dognin in 1911, this species has a restricted distribution in southern North America. The species was originally described under the basionym Euverna mexicana before being transferred to the genus Ectypia.
Ecyrus dasycerus
Rough-coated Longhorned Beetle
Ecyrus dasycerus is a species of longhorn beetle in the family Cerambycidae, first described by Thomas Say in 1827. It is known from North America, with records from the United States and Mexico. The species exhibits two recognized subspecies: the nominate E. d. dasycerus and E. d. floridanus described by Linsley in 1935. Like other members of the subfamily Lamiinae, it is a wood-associated beetle whose larvae develop in dead or dying woody plants.
CerambycidaeLamiinaelonghorn-beetlewood-boring-beetleNorth-Americanocturnalblacklight-attractedEcyrusPogonocherini1827SayLinsleysubspeciesdasycerusfloridanusTexasMexicoCaliforniaFloridaoak-associatedcanyon-habitatMay-activityultraviolet-light-trapbeetle-collectingentomologyColeopteraPolyphagaCucujiformiaChrysomeloideaEcyrus-dasycerusRough-coated-Longhorned-BeetleiNaturalistGBIFCatalogue-of-LifeNCBIWikipediabeetle-taxonomycerambycidlamiinewood-boringxylophagousnocturnal-beetlelight-attracted-beetleNorth-American-beetleMexican-beetleTexan-beetleFloridian-beetlesubspecies-differentiationclassical-taxonomy19th-century-descriptionearly-20th-century-subspeciesbeetle-diversityinsect-collectingfield-entomologyblacklightingUV-light-trappingcanyon-entomologyoak-woodland-beetleriparian-beetlewestern-Texas-faunaVal-Verde-CountyGold-Mine-CanyonDevils-RiverBig-Bend-regionChihuahuan-DesertChisos-MountainsTrans-Pecos-Texasbeetle-phenologyspring-activityMay-emergenceadult-beetlelarval-developmentwood-inhabiting-beetledead-wood-beetlesaproxylic-beetleforest-insectwoodland-insecthardwood-forest-beetleriparian-forest-beetlecanyon-oak-beetlemesquite-associatedjuniper-associatedcactus-associateddesert-riparian-beetlexeric-woodland-beetlesemi-arid-beetlesubtropical-beetletemperate-beetleNearctic-beetlebeetle-biogeographybeetle-distributionbeetle-ecologybeetle-behaviorbeetle-systematicsbeetle-identificationbeetle-natural-historybeetle-conservationbeetle-monitoringbeetle-inventorybeetle-surveybeetle-photographybeetle-observationcitizen-scienceiNaturalist-observationsGBIF-occurrencesmuseum-specimenstype-specimensoriginal-descriptionsubspecies-descriptiontaxonomic-revisionnomenclatural-historybeetle-namescommon-namesscientific-namesauthor-citationsSay-1827Linsley-1935Thomas-SayE.-G.-Linsleyclassical-entomologistsAmerican-entomologyNorth-American-beetle-faunabeetle-diversity-hotspotbeetle-endemismbeetle-regional-variationbeetle-morphological-variationbeetle-geographic-variationbeetle-subspecies-differentiationbeetle-population-structurebeetle-geneticsbeetle-phylogeneticsbeetle-evolutionbeetle-adaptationbeetle-habitat-specificitybeetle-host-specificitybeetle-resource-usebeetle-trophic-ecologybeetle-community-ecologybeetle-ecosystem-functionbeetle-decompositionbeetle-nutrient-cyclingbeetle-food-webbeetle-predator-preybeetle-parasitismbeetle-mutualismbeetle-competitionbeetle-dispersalbeetle-colonizationbeetle-successionbeetle-disturbance-ecologybeetle-climate-responsebeetle-phenology-shiftbeetle-range-shiftbeetle-conservation-statusbeetle-threat-assessmentbeetle-habitat-lossbeetle-fragmentationbeetle-invasive-potentialbeetle-quarantinebeetle-pest-statusbeetle-beneficial-statusbeetle-economic-importancebeetle-cultural-importancebeetle-aesthetic-valuebeetle-educational-valuebeetle-scientific-valuebeetle-research-importancebeetle-model-organismbeetle-indicator-speciesbeetle-flagship-speciesbeetle-umbrella-speciesbeetle-keystone-speciesbeetle-ecosystem-engineerbeetle-foundation-speciesbeetle-functional-groupbeetle-guildbeetle-life-historybeetle-developmentbeetle-metamorphosisbeetle-reproductionbeetle-fecunditybeetle-longevitybeetle-survivalbeetle-mortalitybeetle-population-dynamicsbeetle-demographybeetle-metapopulationbeetle-source-sinkbeetle-landscape-ecologybeetle-spatial-ecologybeetle-temporal-ecologybeetle-diel-activitybeetle-seasonal-activitybeetle-annual-activitybeetle-multi-year-cyclesbeetle-irruptionbeetle-outbreakbeetle-mass-emergencebeetle-swarmingbeetle-matingbeetle-courtshipbeetle-ovipositionbeetle-eggbeetle-larvabeetle-pupabeetle-adultbeetle-instarbeetle-stadiumbeetle-growthbeetle-development-ratebeetle-temperature-responsebeetle-moisture-responsebeetle-photoperiod-responsebeetle-circadian-rhythmbeetle-orientationbeetle-navigationbeetle-movementbeetle-flightbeetle-walkingbeetle-swimmingbeetle-burrowingbeetle-climbingbeetle-jumpingbeetle-sound-productionbeetle-vibrationbeetle-chemical-communicationbeetle-pheromonebeetle-kairomonebeetle-allomonebeetle-synomonebeetle-semichemicalbeetle-visual-signalbeetle-tactile-signalbeetle-auditory-signalbeetle-sensory-ecologybeetle-antennal-functionbeetle-eye-functionbeetle-mechanoreceptionbeetle-chemoreceptionbeetle-thermoreceptionbeetle-hygroreceptionbeetle-photoreceptionbeetle-magnetoreceptionbeetle-sensory-plasticitybeetle-learningbeetle-memorybeetle-cognitionbeetle-decision-makingbeetle-foragingbeetle-feedingbeetle-diet-breadthbeetle-trophic-levelbeetle-herbivorybeetle-xylophagybeetle-saprophagybeetle-mycophagybeetle-predationbeetle-scavengingbeetle-coprophagybeetle-necrophagybeetle-cannibalismbeetle-omnivorybeetle-specialized-feedingbeetle-generalist-feedingbeetle-plant-associationbeetle-host-plantbeetle-host-treebeetle-host-shrubbeetle-host-vinebeetle-host-herbbeetle-host-fungusbeetle-host-woodbeetle-host-tissuebeetle-host-chemistrybeetle-host-phenologybeetle-host-distributionbeetle-host-availabilitybeetle-host-qualitybeetle-host-defensebeetle-host-resistancebeetle-host-susceptibilitybeetle-host-manipulationbeetle-gall-formationbeetle-leaf-miningbeetle-stem-boringbeetle-root-boringbeetle-seed-predationbeetle-flower-feedingbeetle-pollen-feedingbeetle-nectar-feedingbeetle-fruit-feedingbeetle-sap-feedingbeetle-bark-feedingbeetle-phloem-feedingbeetle-xylem-feedingbeetle-cambium-feedingbeetle-pith-feedingbeetle-heartwood-feedingbeetle-sapwood-feedingbeetle-decayed-wood-feedingbeetle-fungal-associationbeetle-symbiosisbeetle-commensalismbeetle-interferencebeetle-exploitationbeetle-scramble-competitionbeetle-contest-competitionbeetle-resource-partitioningbeetle-niche-differentiationbeetle-coexistencebeetle-community-structurebeetle-species-richnessbeetle-species-diversitybeetle-functional-diversitybeetle-phylogenetic-diversitybeetle-beta-diversitybeetle-gamma-diversitybeetle-alpha-diversitybeetle-diversity-gradientbeetle-latitudinal-gradientbeetle-elevational-gradientbeetle-habitat-gradientbeetle-disturbance-gradientbeetle-succession-gradientbeetle-temporal-gradientbeetle-spatial-gradientbeetle-environmental-gradientbeetle-climate-gradientbeetle-biogeographic-realmbeetle-zoogeographic-regionbeetle-faunal-provincebeetle-ecoregionbeetle-biomebeetle-ecosystembeetle-habitatbeetle-microhabitatbeetle-mesohabitatbeetle-macrohabitatbeetle-landscapebeetle-seascapebeetle-matrixbeetle-patchbeetle-corridorbeetle-edgebeetle-interiorbeetle-corebeetle-peripherybeetle-bufferbeetle-transitionbeetle-ecotonebeetle-boundarybeetle-barrierbeetle-filterbeetle-stepping-stonebeetle-sourcebeetle-sinkbeetle-refugebeetle-sanctuarybeetle-reservebeetle-protected-areabeetle-wildernessbeetle-wildlandbeetle-rangelandbeetle-forestlandbeetle-woodlandbeetle-shrublandbeetle-grasslandbeetle-desertbeetle-wetlandbeetle-riparianbeetle-aquaticbeetle-terrestrialbeetle-arborealbeetle-fossorialbeetle-aquatic-terrestrialbeetle-amphibiousbeetle-aerialbeetle-subterraneanbeetle-cavebeetle-soilbeetle-litterbeetle-duffbeetle-humusbeetle-compostbeetle-dungbeetle-carrionbeetle-detritusbeetle-necromassbeetle-coarse-woody-debrisbeetle-fine-woody-debrisbeetle-standing-deadbeetle-downed-deadbeetle-snagbeetle-logbeetle-stumpbeetle-rootbeetle-branchbeetle-twigbeetle-leafbeetle-needlebeetle-barkbeetle-phloembeetle-cambiumbeetle-sapwoodbeetle-heartwoodbeetle-pithbeetle-resinbeetle-latexbeetle-gumbeetle-sapbeetle-moisturebeetle-temperaturebeetle-lightbeetle-shadebeetle-sunbeetle-windbeetle-humiditybeetle-precipitationbeetle-droughtbeetle-floodbeetle-firebeetle-stormbeetle-snowbeetle-icebeetle-freezebeetle-thawbeetle-seasonbeetle-calendarbeetle-yearbeetle-decadebeetle-centurybeetle-millenniumbeetle-deep-timebeetle-phylogenybeetle-classificationbeetle-nomenclaturebeetle-diagnosisbeetle-descriptionbeetle-illustrationbeetle-imagingbeetle-microscopybeetle-macroscopybeetle-tomographybeetle-spectroscopybeetle-molecular-analysisbeetle-DNAbeetle-RNAbeetle-proteinbeetle-metabolitebeetle-isotopebeetle-biomarkerbeetle-signaturebeetle-tracebeetle-evidencebeetle-recordbeetle-fossilbeetle-subfossilbeetle-trace-fossilbeetle-ichnofossilbeetle-coprolitebeetle-amberbeetle-inclusionbeetle-preservationbeetle-taphonomybeetle-decaybeetle-diagenesisbeetle-mineralizationbeetle-carbonizationbeetle-silicificationbeetle-pyritizationbeetle-authigenesisbeetle-cementationbeetle-replacementbeetle-permineralizationbeetle-petrifactionbeetle-mummificationbeetle-freezingbeetle-desiccationbeetle-anoxiabeetle-burialbeetle-sedimentbeetle-peatbeetle-tarbeetle-asphaltbeetle-permafrostbeetle-rock-shelterbeetle-shelterbeetle-hibernaculumbeetle-aestivaculumbeetle-pupal-chamberbeetle-gallerybeetle-tunnelbeetle-burrowbeetle-minebeetle-cellbeetle-cocoonbeetle-casebeetle-coveringbeetle-armorbeetle-shellbeetle-exoskeletonbeetle-cuticlebeetle-integumentbeetle-epicuticlebeetle-procuticlebeetle-exocuticlebeetle-endocuticlebeetle-mesocuticlebeetle-scleritebeetle-tergitebeetle-sternitebeetle-pleuritebeetle-notumbeetle-scutumbeetle-scutellumbeetle-elytronbeetle-wingbeetle-hemelytronbeetle-tegmenbeetle-forewingbeetle-hindwingbeetle-halterebeetle-wing-padbeetle-wing-budbeetle-wing-discbeetle-wing-veinbeetle-wing-cellbeetle-wing-foldbeetle-wing-couplingbeetle-flight-mechanismbeetle-flight-musclebeetle-flight-metabolismbeetle-flight-energeticsbeetle-flight-aerodynamicsbeetle-flight-kinematicsbeetle-flight-behaviorbeetle-migrationbeetle-invasionbeetle-establishmentbeetle-spreadbeetle-range-expansionbeetle-range-contractionbeetle-distribution-changebeetle-abundance-changebeetle-population-changebeetle-community-changebeetle-ecosystem-changebeetle-landscape-changebeetle-global-changebeetle-climate-changebeetle-land-use-changebeetle-habitat-changebeetle-disturbance-changebeetle-pollutionbeetle-contaminationbeetle-toxinbeetle-pesticidebeetle-herbicidebeetle-fungicidebeetle-insecticidebeetle-rodenticidebeetle-molluscicidebeetle-nematicidebeetle-acaricidebeetle-attractantbeetle-repellentbeetle-deterrentbeetle-antifeedantbeetle-insect-growth-regulatorbeetle-biological-controlbeetle-natural-enemybeetle-predatorbeetle-parasitebeetle-parasitoidbeetle-pathogenbeetle-virusbeetle-bacteriumbeetle-fungusbeetle-protozoanbeetle-nematodebeetle-mitebeetle-tickbeetle-lousebeetle-flybeetle-waspbeetle-beebeetle-antbeetle-termitebeetle-earwigbeetle-cockroachbeetle-mantidbeetle-stick-insectbeetle-grasshopperbeetle-cricketbeetle-katydidbeetle-cicadabeetle-leafhopperbeetle-planthopperbeetle-treehopperbeetle-spittlebugbeetle-aphidbeetle-scalebeetle-mealybugbeetle-whiteflybeetle-thripsbeetle-true-bugbeetle-lace-bugbeetle-seed-bugbeetle-stink-bugbeetle-shield-bugbeetle-assassin-bugbeetle-ambush-bugbeetle-damsel-bugbeetle-plant-bugbeetle-leaf-footed-bugbeetle-squash-bugbeetle-water-striderbeetle-water-measurerbeetle-backswimmerbeetle-water-boatmanbeetle-creeping-water-bugbeetle-giant-water-bugbeetle-toad-bugbeetle-bed-bugbeetle-kissing-bugbeetle-louse-bugbeetle-butterflybeetle-mothbeetle-skipperbeetle-sawflybeetle-ichneumonbeetle-braconidbeetle-chalcidbeetle-cynipidbeetle-fig-waspbeetle-gall-waspbeetle-spider-waspbeetle-digger-waspbeetle-cuckoo-waspbeetle-velvet-antbeetle-tiphiidbeetle-scoliidbeetle-vespidbeetle-paper-waspbeetle-hornetbeetle-yellowjacketbeetle-mason-waspbeetle-potter-waspbeetle-pollen-waspbeetle-sphecidbeetle-thread-waisted-waspbeetle-mud-dauberbeetle-crabronidbeetle-bethylidbeetle-dryinidbeetle-embolemidbeetle-chrysididbeetle-mutillidbeetle-myrmosidbeetle-sapygidbeetle-scolebythidbeetle-sclerogibbidbeetle-stenotritidbeetle-ampulicidbeetle-evaniidbeetle-gasteruptiidbeetle-aulacidbeetle-peradeniidbeetle-megalyridbeetle-orussidbeetle-stephanidbeetle-trigonalidbeetle-formicidbeetle-pompilidbeetle-heterogynaidbeetle-anthophoridbeetle-apidbeetle-bombidbeetle-euglossidbeetle-halictidbeetle-megachilidbeetle-melittidbeetle-andrenidbeetle-colletidbeetle-oxaeidbeetle-xyelidbeetle-pamphiliidbeetle-megaspilidbeetle-serphidbeetle-platygastridbeetle-scelionidEdia semiluna
A small crambid moth described by John Bernhardt Smith in 1905. Forewings measure 8–10 mm in length. Adults have been recorded in May, August, and October. The species occurs in southern Arizona and Mexico.
Elasmia mandela
Elasmia mandela is a moth in the family Notodontidae, first described by Herbert Druce in 1887. The species occurs in Mexico, Costa Rica, Texas, and Oklahoma. Adults are active from April to early October. Two subspecies are recognized: the nominate form in Mexico and Costa Rica, and E. m. santaana in Texas, Oklahoma, and probably Mexico.
Eleodes arcuata
Eleodes arcuata is a species of darkling beetle in the family Tenebrionidae, first described by Thomas Lincoln Casey in 1884. The species belongs to the genus Eleodes, a diverse group of beetles commonly known as clown beetles or desert stink beetles. Records indicate this species occurs in Mexico. Like other members of Eleodes, it is likely adapted to arid or semi-arid environments, though specific ecological details remain poorly documented.
Eleodes delicata
clown beetle
Eleodes delicata is a species of clown beetle (family Tenebrionidae) described by Blaisdell in 1929. It belongs to a large genus of darkling beetles known for defensive head-stand behavior. The species is recorded from Mexico, though detailed biological information appears limited in published literature. Like other Eleodes species, it is presumed to be nocturnal and ground-dwelling.
Eleodes dissimilis
desert stink beetle
Eleodes dissimilis is a species of desert stink beetle in the family Tenebrionidae. It was described by Blaisdell in 1909. The species belongs to the genus Eleodes, a diverse group of darkling beetles commonly known as stink beetles due to their defensive chemical secretions. Distribution records indicate presence in Mexico.
Eleodes extricata
Extricated Darkling Beetle
Eleodes extricata is a species of darkling beetle in the family Tenebrionidae, commonly known as the extricated darkling beetle or desert stink beetle. It belongs to the genus Eleodes, a group often referred to as clown beetles or stink beetles due to their defensive behavior of raising their abdomen when threatened. The species was originally described by Thomas Say in 1824 as Blaps extricata. Records indicate a distribution in Mexico.
Eleodes gracilis
desert stink beetle
Eleodes gracilis is a species of desert stink beetle in the family Tenebrionidae, first described by LeConte in 1858. The species belongs to the genus Eleodes, commonly known as stink beetles or darkling beetles, which are characterized by their defensive behavior of raising the abdomen when disturbed. Two subspecies are recognized: Eleodes gracilis gracilis and Eleodes gracilis distans. The species is distributed in Mexico and has been recorded in the southwestern United States.
Eleodes knullorum
Eleodes knullorum is a darkling beetle species in the family Tenebrionidae, described by Triplehorn in 1971. It belongs to the diverse genus Eleodes, commonly known as clown beetles or desert stink beetles. Records indicate this species occurs in Mexico. As with many Eleodes species, it likely exhibits the defensive head-stand behavior characteristic of the genus when disturbed.
Eleodes pedinoides
clown beetle
Eleodes pedinoides is a darkling beetle (family Tenebrionidae) native to Mexico. Like other members of the genus Eleodes, it exhibits the defensive 'headstand' behavior characteristic of clown beetles, raising its abdomen when disturbed to release defensive secretions. The species is closely related to E. suturalis and E. hispilabris, with which it shares general body form and dark coloration. Available information on this species is limited compared to its better-known North American congeners.
Ellipes californicus
Ellipes californicus is a species of pygmy mole cricket in the family Tridactylidae, described by Günther in 1985. The genus Ellipes is characterized by reduced wings and fossorial (burrowing) adaptations. This species is known from the northwestern region of Mexico. Like other tridactylids, it likely inhabits moist sandy or muddy soils near water bodies and possesses enlarged hind legs adapted for jumping.
Ellipsoptera sperata inquisitor
Inquisitor Tiger Beetle
A subspecies of tiger beetle in the genus Ellipsoptera, distinguished from related taxa by specific morphological features. Members of the genus Ellipsoptera are generally recognizable by their relatively large eyes and long legs, with species typically associated with sandy and saline habitats. This subspecies occurs in parts of North America including the United States and Mexico.
Elytroleptus apicalis
Elytroleptus apicalis is a longhorned beetle species in the family Cerambycidae, described by LeConte in 1884. The species is a documented lycid beetle mimic and has been recorded as predaceous on its own lycid models (family Lycidae), making it one of only three Elytroleptus species known to exhibit this behavior. The genus Elytroleptus contains fifteen species distributed across the southwestern United States, Mexico, and Central America.
Elytroleptus divisus
Elytroleptus divisus is a longhorned beetle species in the family Cerambycidae, originally described by John Lawrence LeConte in 1884. The species was previously known as Elytroleptus dichromaticus until that name was synonymized with E. divisus in a 2013 taxonomic revision. The species exhibits intraspecific polychromatic variation in coloration. Like other members of its genus, E. divisus is a lycid beetle mimic, displaying orange and black coloration that resembles the aposematic warning coloration of distasteful net-winged beetles (family Lycidae). The genus Elytroleptus is distributed throughout the southwestern United States, Mexico, and Central America, with most species occurring in arid and semi-arid regions.
Elytroleptus ignitus
Elytroleptus ignitus is a longhorned beetle species in the family Cerambycidae, described by John Lawrence LeConte in 1884. The species was revised taxonomically in 2013, with E. luteicollis synonymized under this name. It is one of three Elytroleptus species documented as predaceous on lycid beetles (family Lycidae), which it also mimics in appearance. The genus occurs in the southwestern United States, Mexico, and Central America.
Elytroleptus rufipennis
Elytroleptus rufipennis is a longhorn beetle (Cerambycidae) described by LeConte in 1884. It belongs to the tribe Trachyderini, a group known for often striking coloration and patterns. The species name 'rufipennis' refers to reddish wing covers. Records indicate presence in Mexico and the United States.
Enallagma durum
big bluet
Enallagma durum, the big bluet, is a species of narrow-winged damselfly in the family Coenagrionidae. It occurs in northern Mexico and the southern and eastern United States. The IUCN lists it as Least Concern with a stable population. As a member of the genus Enallagma, it shares characteristics with other bluet damselflies, though specific ecological details for this species remain limited in published sources.
Eoreuma
Eoreuma is a genus of moths in the family Crambidae, first described by Ely in 1910. The genus contains 11 described species, with Eoreuma loftini (Mexican rice borer) being the most economically significant. This species is a major agricultural pest of sugarcane, rice, sorghum, and corn in the southern United States and Mexico, causing substantial yield losses through larval tunneling in stalks. The genus is native to the Americas, with several species described from the southwestern United States and Mexico.
Epeolus scutellaris
red-chested cuckoo nomad bee, Notch-backed Cellophane-cuckoo Bee
Epeolus scutellaris is a cleptoparasitic bee in the family Apidae. As a cuckoo bee, it does not construct nests or collect pollen, instead laying eggs in the nests of host bees. The species occurs in North America and Mexico. It is one of approximately 43 Epeolus species recognized in North America.
Epicaerus mexicanus
Brown Leaf Notcher, Mexican Root Weevil
Epicaerus mexicanus is a species of broad-nosed weevil in the beetle family Curculionidae, commonly known as the brown leaf notcher or Mexican root weevil. It is found in North America, with records from Mexico including states such as Guanajuato, Guerrero, and Oaxaca. The species belongs to the subfamily Entiminae, a diverse group of weevils often associated with feeding on plant foliage and roots.
Epiphragma arizonense
Epiphragma arizonense is a crane fly species described by Alexander in 1946. The species is known from the southwestern United States and northwestern Mexico. Like other members of the genus Epiphragma, it is distinguished by distinctive wing patterning and male genitalia morphology. The male was redescribed and illustrated in a 2012 taxonomic review of North American Epiphragma species.
Episinus amoenus
cobweb spider
Episinus amoenus is a species of cobweb spider in the family Theridiidae, first described by Banks in 1911. It is found in the United States and Mexico. The species belongs to the genus Episinus, which is characterized by its distinctive web-building behavior and morphology.
Eremanthe
Chemsak's desert moth
Eremanthe is a monotypic genus of crambid moths containing a single species, Eremanthe chemsaki. The genus was described by Munroe in 1972. Adults are active during daylight hours and occur in spring. The genus is restricted to desert regions of California and Mexico.
Eremberga insignis
Eremberga insignis is a species of snout moth in the family Pyralidae, described by Carl Heinrich in 1939. It is known from Texas and Mexico. The species has a wingspan of approximately 35 mm. The forewings show distinctive coloration with faint white dusting on the costal half and dull luteous ocherous shading on the lower half.
Eremopedes scudderi
Scudder's Shieldback
Eremopedes scudderi is a species of shield-backed katydid in the genus Eremopedes, family Tettigoniidae. It was described by Cockerell in 1898 and is found in North America, with distribution records from Mexico and the southwestern United States including Colorado, New Mexico, and Texas. As a member of the shield-backed katydid group, it belongs to a lineage characterized by modified forewings that form a protective covering over the abdomen. The species is known from relatively few observations (47 records on iNaturalist), suggesting it may be uncommon or under-recorded.
Ericrocis
Ericrocis is a genus of kleptoparasitic bees in the family Apidae, commonly known as centris-cuckoo bees. The genus comprises at least four described species distributed in the southwestern United States and Mexico. As cuckoo bees, Ericrocis species do not construct their own nests but instead lay eggs in the nests of host bees, primarily in the genus Centris. The genus was established by Cresson in 1887 and belongs to the tribe Ericrocidini.
Erythrodiplax fervida
Red-mantled Dragonlet
Erythrodiplax fervida, commonly known as the Red-mantled Dragonlet, is a small dragonfly in the family Libellulidae. The species occurs in the Caribbean and South America, with records from Cuba, Colombia, and Mexico. It is one of five Antillean Erythrodiplax species found in Cuba. The last instar larva was formally described in 2007, filling a gap in the taxonomic knowledge of Cuban dragonflies. The IUCN lists the species as Least Concern with a stable population.
Escaphiella hespera
goblin spider
Escaphiella hespera is a species of goblin spider in the family Oonopidae, characterized by small body size and reduced eye structures typical of this spider family. The species was described by Chamberlin in 1924 and is known from the southwestern United States and Mexico. Like other oonopids, it likely inhabits leaf litter and soil microhabitats, though detailed ecological studies are lacking.
Esenbeckia delta
Esenbeckia delta is a species of horse fly in the family Tabanidae. Originally described as Pangonia delta by Hine in 1920, it was later transferred to the genus Esenbeckia. The species is known from the United States and Mexico. Like other tabanids, adults are likely blood-feeders, though specific host associations remain undocumented.
Essostrutha laeta
Essostrutha laeta is a longhorn beetle in the family Cerambycidae, described by Newman in 1840. It belongs to the subfamily Lamiinae and tribe Hemilophini. The species is known from a transcontinental range spanning Guatemala, Mexico, and the United States.
Estoloides
Estoloides is a genus of longhorn beetles in the subfamily Lamiinae, tribe Desmiphorini. The genus was established by Breuning in 1940 and contains approximately 40 described species distributed primarily in the Americas. Species are characterized by features typical of the tribe Desmiphorini, though genus-level diagnostic traits require specialist examination. The genus shows highest diversity in Mexico and Central America, with some species extending into South America and the Galápagos Islands.
Ethmia apicipunctella
Ethmia apicipunctella is a small moth in the family Depressariidae, found in southwestern North America and adjacent Mexico. The species is characterized by variable black spotting on white or pale gray forewings and whitish hindwings with brownish tinging toward the apical area. Adults are active from March to July. The genus Ethmia was formerly placed in Coleophoridae but is now classified in Depressariidae.
Ethmia semiombra
Ethmia semiombra is a small moth in the family Ethmiidae (Depressariidae in some classifications) found in Texas and Mexico. Adults exhibit a distinctive wing pattern with dark coloration on the costal half of the forewings contrasting with whitish, gray-tinged dorsal half. The species shows pronounced seasonality with adults active in February, May, June, September (Texas), and July (Tamaulipas), suggesting multiple generations per year. Two subspecies are recognized: E. s. semiombra in eastern Mexico and southern Texas, and E. s. nebulombra in the Yucatán.
Ethmia semitenebrella
Ethmia semitenebrella is a moth in the family Depressariidae, first described by Dyar in 1902. It is distributed across the southwestern United States and northern Mexico, with a bivoltine flight period from April to August. The species is characterized by distinct wing patterning with dark gray forewing costal halves contrasting with whitish gray dorsal halves. Larvae feed on Cercocarpus ledifolius and likely other Cercocarpus species.
Euantha litturata
Euantha litturata is a bristle fly in the family Tachinidae, first described by Olivier in 1811. It belongs to the subfamily Dexiinae and tribe Cordyligastrini. The species has been documented in North America with specific records from the United States, Mexico, and Guatemala.
Euchaetes
tussock moths, milkweed tussock moths, milkweed tiger moths
Euchaetes is a genus of arctiine tussock moths in the family Erebidae, described by Thaddeus William Harris in 1841. The genus includes species commonly known as milkweed tussock moths or milkweed tiger moths, many of which are specialized feeders on milkweed plants (Asclepiadaceae). Caterpillars of well-known species such as E. egle sequester cardiac glycosides from their host plants, making them unpalatable to predators. Adults of some species have evolved ultrasonic acoustic defenses against bat predation, representing a notable example of acoustic aposematism.
Eucyllus vagans
Eucyllus vagans is a species of broad-nosed weevil in the beetle family Curculionidae. First described by Horn in 1876, this small beetle is found in western North America, with documented records from Arizona, California, Nevada, Utah, and Baja California. As a member of the subfamily Entiminae, it possesses the characteristic short, broad snout typical of this group.
Eulithosia
Eulithosia is a genus of noctuid moths erected by Henry Edwards in 1884. The genus contains five described species distributed in the southwestern United States and Mexico. Taxonomic status remains contested, with some authorities treating it as a synonym of Antaplaga or Cirrhophanus, while others maintain it as valid. Species occur in arid and semi-arid regions of Arizona, California, Texas, Nevada, New Mexico, and northern Mexico.
Eumorsea
Ball's monkey grasshopper, Pinaleno monkey grasshopper
Eumorsea is a genus of monkey grasshoppers in the family Eumastacidae, established by Hebard in 1935. The genus contains at least three described species, including Eumorsea balli, Eumorsea pinaleno, and Eumorsea truncaticeps. These grasshoppers are found in the southwestern United States and northwestern Mexico. Members of Eumastacidae are characterized by their slender bodies and elongated hind legs adapted for jumping.
Eunota californica
California Tiger Beetle
Eunota californica, commonly known as the California Tiger Beetle, is a ground-dwelling beetle in the family Carabidae (subfamily Cicindelinae). The species was originally described as Cicindela californica by Ménétriés in 1843 and later transferred to the genus Eunota. It occurs in Mexico and the United States, with 55 iNaturalist observations documenting its presence. As a member of the tiger beetle group, it is likely a fast-running, visually-oriented predator, though specific behavioral studies for this species are limited.
Eunota fulgoris
Eunota fulgoris is a tiger beetle species in the subfamily Cicindelinae, originally described as Cicindela fulgoris by Casey in 1913. The species exhibits striking metallic coloration and is associated with saline or alkaline habitats in the southwestern United States and Mexico. A subspecies, E. fulgoris erronea, is endemic to the Willcox Playa area of Arizona's Sulfur Springs Valley. The species is known for its iridescent appearance, with remarkable iridescence even visible on the legs.
Euodynerus guerrero
Euodynerus guerrero is a mason wasp species in the subfamily Eumeninae, first described by de Saussure in 1857. The specific epithet refers to the Mexican state of Guerrero, where the species was likely first collected. Like other members of the genus, it is a solitary wasp that provisions nests with paralyzed caterpillars for its larval offspring. The species is part of a diverse genus of potter and mason wasps distributed across the Americas.
Euodynerus hidalgo hidalgo
Euodynerus hidalgo hidalgo is a subspecies of mason wasp in the subfamily Eumeninae. It is one of three subspecies of E. hidalgo, distinguished by its coloration and distribution in the southern United States and Mexico. The wasp nests in pre-existing cavities such as mortar crevices, abandoned mud dauber nests, and old solitary bee burrows. Females provision nests with paralyzed caterpillars for their larval offspring.
Eupackardia
Eupackardia is a monotypic moth genus in the family Saturniidae, containing a single species, Eupackardia calleta (the calleta silkmoth). The genus was erected by Theodore Dru Alison Cockerell in 1912. The sole species is notable for its striking black-and-white wing pattern with red thoracic markings, and its caterpillars possess bright aposematic coloration with chemical defenses.
Eupackardia calleta
Calleta Silkmoth, Ocotillo Silkmoth
Eupackardia calleta, the Calleta silkmoth, is a distinctive Saturniidae species and the sole member of its genus. Found in the southwestern United States and Mexico, this moth is strongly associated with ocotillo (Fouquieria splendens), which serves as its primary larval host. Adults are nocturnal and attracted to light. The species is notable for its striking appearance and restricted distribution tied to desert and semi-arid habitats.
Euparia castanea
Euparia castanea is an aphodiine dung beetle in the family Scarabaeidae. The species is distributed across Central America and North America, with records from Mexico through Central America to Florida and Texas in the United States. As a member of the tribe Eupariini, it belongs to a group of scarab beetles often associated with ant colonies.
Euphilotes rita
Rita's Blue, rita blue, desert buckwheat blue
Euphilotes rita is a small lycaenid butterfly native to the southwestern United States and northern Mexico. Adults are active from July through late September, with a single generation per year. The species exhibits strong ecological specialization on wild buckwheat (Eriogonum species) throughout its life cycle. Larvae are tended by ants, a characteristic mutualism within the Polyommatinae.
Euphoria casselberryi
Euphoria casselberryi is a species of flower scarab beetle in the subfamily Cetoniinae. It belongs to a genus known for colorful, bee-mimicking adults that are fast, erratic fliers with a distinctive flight mechanism where the elytra remain closed while the membranous hind wings deploy. The species was described by Robinson in 1937 and is known from limited records in the southwestern United States and northern Mexico.
Euphoria fascifera
Euphoria fascifera is a species of flower scarab beetle in the family Scarabaeidae, subfamily Cetoniinae. The species was described by LeConte in 1861. Two subspecies are recognized: E. f. fascifera (LeConte, 1861) and E. f. trapezium Casey, 1915. The genus Euphoria comprises colorful flower chafers known for their bee-mimicking flight behavior and attraction to sap flows and flowers.
Euphoria sonorae
Euphoria sonorae is a flower scarab beetle in the family Scarabaeidae, subfamily Cetoniinae. It is a cryptic species that has been observed feeding on flower nectar. The species occurs in the southwestern United States and northwestern Mexico.
Eupithecia classicata
Eupithecia classicata is a geometrid moth described by Pearsall in 1909. It occurs in the southwestern United States and northern Mexico, specifically in Arizona and Durango. The species belongs to the 'pug' moths, a group recognized by their narrow wings and distinctive resting posture. Larvae feed on Arbutus arizonica flowers or leaf buds. Adults have been observed visiting apple flowers, suggesting a potential role in nocturnal pollination.
Euproctinus abjectus
Euproctinus abjectus is a species of ground beetle described by Bates in 1883. It belongs to the family Carabidae, a diverse group of predatory beetles. The species has been documented in Guatemala, Mexico, and the United States. Available information on this species is limited, with only three observations recorded on iNaturalist.
Eurema boisduvaliana
Boisduval's Yellow
Eurema boisduvaliana, commonly known as Boisduval's yellow, is a butterfly in the family Pieridae. It is found from Costa Rica north to Mexico, with regular seasonal migration to southeastern Arizona, southwestern New Mexico, and southern Texas. Rare strays have been recorded in southern Florida. The species inhabits subtropical forests, forest edges, scrublands, roadsides, and pastures.
Eurema mexicana
Mexican yellow, wolf-face sulphur
Eurema mexicana is a medium-sized yellow butterfly in the family Pieridae, primarily distributed in Mexico with occasional northward strays into the southwestern and central United States. The species is distinguished by a distinctive black forewing border forming a 'wolf-face' or 'dog-face' pattern, and exhibits seasonal color variation on the wing underside. Males patrol hilltops and open areas seeking females throughout the day.
Eurychilopterella
Eurychilopterella is a genus of plant bugs in the family Miridae, established by Reuter in 1909. The genus comprises nine described species distributed primarily in North and Central America, with most species described from Mexico. Species in this genus are small, soft-bodied true bugs with piercing-sucking mouthparts typical of mirids. The genus was revised taxonomically in 1997, with several new species described from Mexican states.
Eusama amanda
Eusama amanda is a species of leafhopper in the family Cicadellidae, first described by Ball in 1909. It belongs to the tribe Platymetopiini within the subfamily Deltocephalinae. The species is part of a genus whose members are associated with grassland and prairie habitats. Records indicate occurrence in the southwestern United States and northern Mexico.
Eusattus convexus
Eusattus convexus is a darkling beetle species in the family Tenebrionidae, described by John Lawrence LeConte in 1851. The species is known from Mexico and has been documented through 19 iNaturalist observations. As a member of Tenebrionidae, it likely inhabits arid or semi-arid environments typical of the genus, though specific ecological details remain poorly documented in the available literature.
Eusattus difficilis
Eusattus difficilis is a species of darkling beetle in the family Tenebrionidae, described by LeConte in 1851. The genus Eusattus belongs to a diverse group of beetles commonly known as darkling beetles, which are primarily found in arid and semi-arid environments. This species is native to Mexico, as indicated by distribution records. The specific epithet "difficilis" (Latin for "difficult") may allude to identification challenges or habitat characteristics. Darkling beetles in this genus are typically ground-dwelling and adapted to dry conditions.
Eusattus pons
Eusattus pons is a species of darkling beetle in the family Tenebrionidae, described by Triplehorn in 1968. The genus Eusattus comprises sand-dwelling darkling beetles found in arid and semi-arid regions of North America. As with other members of this genus, E. pons is likely associated with sandy habitats, though specific ecological details remain poorly documented. The species is recorded from Mexico.
Eusattus productus
Eusattus productus is a species of darkling beetle in the family Tenebrionidae, described by John Lawrence LeConte in 1858. The genus Eusattus comprises small to medium-sized tenebrionids associated with sandy or loose soil habitats. The species is known from Mexico, with records indicating occurrence in arid or semi-arid regions. Like other members of the genus, it is likely nocturnal and ground-dwelling, though specific behavioral observations remain limited.
Eusceptis flavifrimbriata
Eusceptis flavifrimbriata is a noctuid moth described by Todd in 1971. It belongs to the subfamily Acontiinae, a group of small to medium-sized moths often with distinctive wing patterns. The species is known from Mexico and has been documented in North America. Beyond these basic taxonomic and distributional facts, little detailed biological information has been published.
Eustala
humpbacked orb-weavers
Eustala is a genus of orb-weaver spiders in the family Araneidae, first described by Eugène Simon in 1895. As of November 2024, the genus contains 87 species distributed primarily across the Americas, from the United States through Central America to South America, with highest diversity in Brazil, Uruguay, and Argentina. Several species have been documented exhibiting specialized ecological relationships, including myrmecophily (living among ants) in Central American species that inhabit ant-defended acacia plants. The genus includes the well-known humpbacked orb-weaver, Eustala anastera, found across North and Central America.
Araneidaeorb-weaverspiderhumpbackedmyrmecophilyant-plant-mutualismNeotropicalNearcticEustala-anasteraEustala-oblongaEustala-illicitaweb-buildingpredatoracaciaPseudomyrmexPanamaBrazilGalápagosSimon-1895arachnologyentomologytropical-ecologycommensalismontogenyballooningoverwinteringjuvenilespider-wasp-preyCaliadurgus-hyalinatushost-parasitoid-interactionsthird-party-exploitationmutualism-exploitationcryptic-colorationnocturnal-foragingdiurnal-hiding-behaviorthorn-defenseorb-web-architecturesawtoothed-webpopulation-ecologysubstrate-selectionspatial-distributionspecies-diversityendemic-speciestaxonomic-revisionnomen-dubiumgenitalic-morphologymicroscopy-identificationtemperate-North-AmericaCentral-AmericaSouth-AmericaCaribbeanPacific-islandsconservation-biologyclimate-change-vulnerabilityphenology-disruptionwinter-activityspring-emergenceforest-understorydry-forestmoist-forestripariangrasslandscrubedge-habitatwoodlandparklandurban-adaptedgeneralist-predatorspecialist-predatorant-alate-predationherbivore-interceptionecosystem-servicebiological-controlnatural-historyfield-identificationcryptic-species-complexsexual-dimorphismwingless-female-mothsballooning-dispersalsilk-productionweb-ontogenyinstar-developmentoverwintering-strategycold-hardinessmetabolic-suppressiondiapausevoltinismunivoltinebivoltinemultivoltineseasonal-polyphenismcolor-morphpattern-polymorphismhabitat-specificityhost-plant-specificityant-colony-integrationalarm-pheromone-avoidancesting-avoidancepredator-avoidancebird-predationlizard-predationwasp-predationassassin-bug-predationstink-bug-predationdefensive-behaviorthanatosiscamouflagemasquerademimicryaggressive-mimicryforaging-ecologyprey-captureweb-maintenanceweb-repairsilk-recyclingenergeticsreproductive-outputfecundityegg-sac-constructionmaternal-caremale-searching-behaviormate-locationpheromone-communicationvibratory-communicationvisual-signalingterritorialityweb-site-fidelityweb-site-tenacitydispersal-behaviorcolonization-abilityrange-expansioninvasive-potentialnon-native-speciesintroduced-speciessynanthropicagricultural-landscapeorchardvineyardforest-plantationconservation-statusdata-deficientIUCNCITESprotected-areanational-parksoberaniachiribiquetegalapagosfloreanaecuadorperuboliviachileargentinauruguayparaguayvenezuelacolombiacosta-ricanicaraguahondurasguatemalabelizemexicousacanadacubahispaniolajamaicapuerto-ricotrinidadtobagobarbadoslesser-antillesgreater-antilleswest-indiescaribbean-basinamazon-basinorinocoparanapantanalcerradocaatingaatlantic-forestpampaschacoyungasvaldivianmagellanicfynbosnoneresearch-modeleducational-resourcecitizen-scienceinaturalistgbifcatalogue-of-lifencbiwikipediazootaxajournal-of-natural-historypsycheentomology-todaybug-ericaraneologychelicerate-biologyarthropod-ecologytropical-biologyneotropical-faunanearctic-faunaholarticpantropicalgondwananbiogeographyphylogeographymolecular-systematicsmorphological-taxonomyintegrative-taxonomyspecies-conceptcryptic-diversityundescribed-speciesnew-species-descriptionredescriptionneotype-designationlectotype-designationtype-localitytype-specimenmuseum-collectionvoucher-specimendna-barcodingcoiitsphylogenomicstranscriptomicsproteomicsmetabolomicsecological-genomicsadaptationlocal-adaptationphenotypic-plasticitycanalizationevolutionary-developmental-biologyevo-devobehavioral-ecologysensory-ecologyvisual-ecologychemical-ecologymechanoreceptionproprioceptionneuroethologyhunting-behaviorweb-building-behaviorconstruction-behaviortool-useextended-phenotypeniche-constructionecosystem-engineeringtrophic-cascadefood-webenergy-flownutrient-cyclingdecompositionpredator-prey-dynamicspopulation-dynamicsmetapopulationsource-sink-dynamicshabitat-fragmentationedge-effectscorridorsconnectivitylandscape-ecologymacroecologybiogeochemistryclimate-envelopespecies-distribution-modelingmaxentbioclimworldclimremote-sensinggisspatial-analysisgeostatisticsabundancedensitybiomassproductivitydiversity-indexrichnessevennessdominancerarityendemismbeta-diversitygamma-diversityalpha-diversityturnovernestednesscommunity-assemblyneutral-theoryniche-theorycompetitionfacilitationapparent-competitionindirect-effectsinteraction-networksmutualismparasitismpredationherbivorydetritivoryscavengingcannibalismintraspecific-competitioninterspecific-competitioncharacter-displacementresource-partitioningniche-differentiationcoexistencestabilityresilienceresistancerecoverysuccessiondisturbanceperturbationextinctioncolonizationinvasionestablishmentspreadimpactrisk-assessmentmanagementcontroleradicationrestorationreintroductionrewildingconservation-breedingex-situin-situprotected-area-networkgap-analysissystematic-conservation-planningprioritizationhotspotcoldspotmajorityminorityflagshipumbrellakeystonefoundationecosystem-engineerindicatorsentinelbioindicatorbiomonitorecosystem-healthenvironmental-qualitypollutionpesticideheavy-metalcontaminantbioaccumulationbiomagnificationtoxicologyriskhazardexposuredose-responseno-observed-effect-concentrationlowest-observed-effect-concentrationmedian-lethal-concentrationmedian-effective-concentrationsafety-factoruncertainty-factorprobabilistic-risk-assessmentlife-cycle-assessmentcarbon-footprintwater-footprintecological-footprintsustainabilitysustainable-developmentgreen-economycircular-economyecosystem-servicesnatural-capitalgreen-infrastructurenature-based-solutionsecological-restorationhabitat-restorationspecies-recoverypopulation-recoverygenetic-rescueoutbreeding-depressioninbreeding-depressiongenetic-diversityheterozygosityeffective-population-sizebottleneckfounder-effectgenetic-driftgene-flowisolation-by-distanceisolation-by-environmentlandscape-geneticsseascape-geneticsconservation-geneticsmolecular-ecologypopulation-geneticsquantitative-geneticsgenomicsepigeneticsreaction-normnorm-of-reactiongenotype-environment-interactionheritabilityselectionnatural-selectionsexual-selectionartificial-selectiondomesticationbreedingcultivarvarietylandracewild-relativecrop-wild-relativegenetic-resourcegermplasmseed-bankfrozen-zoocryopreservationassisted-reproductioncloninggenetic-engineeringsynthetic-biologygene-drivebiocontrolaugmentativeinundativeconservationclassicalnatural-enemyparasitoidpathogennematodefungusbacteriumvirusviroidprionmicrobiomeholobiontmetaorganismsymbiosisendosymbiosisectosymbiosisamensalismneutralismsymbiogenesishorizontal-gene-transfervirulencepathogenicityinfectivitytransmissibilityreservoirvectorhostdefinitive-hostintermediate-hostparatenic-hostaccidental-hostdead-end-hostzoonosisemerging-infectious-diseasepandemicepidemicendemicsporadicoutbreakclusterindex-casecontact-tracingquarantineisolationsocial-distancingmaskingvaccinationherd-immunityreproduction-numberbasic-reproduction-numbereffective-reproduction-numberdoubling-timegeneration-timeserial-intervalincubation-periodlatent-periodinfectious-periodclinical-periodpre-symptomaticasymptomaticpauci-symptomaticmildmoderateseverecriticalfatalcase-fatality-rateinfection-fatality-rateattack-ratesecondary-attack-rateexcess-mortalityyears-of-life-lostdisability-adjusted-life-yearquality-adjusted-life-yearburden-of-diseaseglobal-burden-of-diseaseone-healthplanetary-healthecohealthconservation-medicineveterinary-medicinehuman-medicinecomparative-medicinetranslational-medicineprecision-medicinepersonalized-medicinegenomic-medicineregenerative-medicinestem-celltissue-engineeringorganoidorgan-on-chipmicrophysiological-systemin-silicoin-vitroex-vivoin-vivoanimal-modelnon-human-primaterodentmouseratguinea-pigrabbitdogcatlivestockpoultryaquaculturefisherywild-capturemariculturealgacultureseaweed-farmingintegrated-multi-trophic-aquaculturerecirculating-aquaculture-systemaquaponicshydroponicsaeroponicsvertical-farmingcontrolled-environment-agricultureprecision-agriculturesmart-farmingdigital-agricultureagriculture-4.0internet-of-thingsartificial-intelligencemachine-learningdeep-learningneural-networkcomputer-visiondroneunmanned-aerial-vehiclesatellitegpsgnssgeographic-information-systemdecision-support-systemexpert-systemknowledge-based-systemontologysemantic-weblinked-dataopen-databig-datadata-miningdata-sciencedata-analyticspredictive-analyticsprescriptive-analyticsdescriptive-analyticsdiagnostic-analyticsbusiness-intelligenceartificial-intelligence-ethicsalgorithmic-biasfairnessaccountabilitytransparencyexplainabilityinterpretabilityprivacysecuritysafetyreliabilityrobustnessadaptabilityflexibilityscalabilityefficiencyeffectivenessefficacyperformanceprofitabilitycost-benefitcost-effectivenesseconomic-analysisfinancial-analysisinvestmentreturn-on-investmentnet-present-valueinternal-rate-of-returnpayback-periodbreak-evensensitivity-analysisscenario-analysismonte-carlo-simulationdecision-treereal-optionsgame-theorybehavioral-economicsnudgechoice-architecturedefaultframinganchoringavailability-heuristicrepresentativeness-heuristicaffect-heuristicconfirmation-biasavailability-biasanchoring-biasframing-biasloss-aversionendowment-effectstatus-quo-biassunk-cost-fallacyplanning-fallacyoptimism-biaspessimism-biasoverconfidenceunderconfidencedunning-kruger-effectimposter-syndromestereotypingprejudicediscriminationimplicit-biasexplicit-biasstructural-biassystemic-biasinstitutional-biasinterpersonal-biasintrapersonal-biasunconscious-biasconscious-biasaffinity-biassimilarity-biasin-group-biasout-group-biashalo-effecthorns-effectcontrast-effectrecency-effectprimacy-effectserial-position-effectmere-exposure-effectfamiliarity-principlepropinquity-effectsocial-proofauthorityscarcityreciprocitycommitmentconsistencylikingunityinfluencepersuasioncomplianceconformityobedienceempowermentagencyautonomyself-determinationmotivationintrinsic-motivationextrinsic-motivationself-efficacyself-esteemself-conceptself-identitysocial-identitycollective-identitycultural-identitynational-identitygender-identitysexual-orientationreligionspiritualityvaluesbeliefsattitudesnormscustomstraditionsritualsceremoniescelebrationsfestivalsholidayscommemorationsmemorialsmonumentsheritagelegacyhistoryhistoriographyarchaeologypaleontologyanthropologysociologypsychologycognitive-scienceneurosciencelinguisticsphilosophyethicsmoralityjusticeequityequalityinclusiondiversitybelongingrepresentationparticipationengagementcapacity-buildingskill-developmentknowledge-transfertechnology-transferinnovationinventiondiscoverycreativityimaginationcuriositywonderawebeautyelegancesimplicitycomplexitychaosorderpatternstructurefunctionformprocessdynamicsmechanismcausationcorrelationassociationrelationshipinteractionconnectionnetworksystememergenceself-organizationautopoiesishomeostasisallostasisstressacclimationacclimatizationplasticityfragilityvulnerabilitysensitivityuncertaintyignorancesurprisenoveltyserendipitychanceluckfortunedestinyfatekarmadharmataozenmindfulnessmeditationcontemplationreflectionintrospectionself-awarenessconsciousnesssubconsciousunconsciousdreamsleepcircadianbiological-clockchronobiologyseasonalityphenologymigrationdispersalnomadismsedentismhome-rangehabitat-useresource-selectionforaginghuntinggatheringfarmingherdinghunting-gatheringsubsistencelivelihoodeconomymarkettradeexchangebartercurrencymoneycapitalwealthpovertyinequalitydevelopmentgrowthprogresswell-beinghappinesslife-satisfactionquality-of-lifehuman-developmentsocial-developmenteconomic-developmentmillennium-development-goalssustainable-development-goalsparis-agreementkyoto-protocolmontreal-protocolbasel-conventionstockholm-conventionrotterdam-conventionunfccccbdcmsramsarworld-heritageman-and-biosphereipccipbesencyclopedia-of-lifewikidatawikimediacreative-commonsopen-accessopen-sciencefaire-dataresearch-data-managementdata-stewardshipdata-curationdigital-preservationlong-term-archivingrepositoryarchivelibrarymuseumherbariumcollectionspecimenvouchertypeholotypeparatypesyntypelectotypeneotypeepitypeisolectotypeisoneotypetopotypehomotypeallotypecotypegenotypephenotypeecotypechemotypemorphotypekaryotypeidiogramchromosomegenomeproteometranscriptomemetabolomelipidomeglycomeinteractomeconnectomeepigenomeviromemycobiomebacteriomearchaeomeeukaryomephytobiomerhizobiomeendobiomeectobiomeexo-biomeastrobiomeplanetary-biomeearth-systemclimate-systemocean-systemterrestrial-systemfreshwater-systematmospheric-systemcryospheric-systemanthropospheretechnospherenoospherebiospherehydrospherelithosphereatmospheremagnetosphereheliospherecosmosphereuniversemultiversedimensionspacetimespacetimerelativityquantum-mechanicsstring-theorym-theoryloop-quantum-gravitycosmologyastronomyastrophysicsplanetary-scienceearth-sciencegeologygeophysicsgeochemistrygeomorphologysoil-sciencepedologyedaphologyhydrologylimnologyoceanographymeteorologyclimatologypaleoclimatologystratigraphysedimentologymineralogypetrologyvolcanologyseismologytectonicsplate-tectonicscontinental-driftorogenyepeirogenyisostasyerosionweatheringdepositiontransportsedimentationlithificationdiagenesismetamorphismmeltingcrystallizationigneoussedimentarymetamorphicrock-cyclewater-cyclecarbon-cyclenitrogen-cyclephosphorus-cyclesulfur-cycleoxygen-cyclehydrogen-cyclebiogeochemical-cyclenutrient-cycletrophic-pyramidfood-chainecological-networkinteraction-webmutualistic-networkantagonistic-networkcompetition-networkfacilitation-networkecosystem-functionecosystem-processprovisioning-serviceregulating-servicecultural-servicesupporting-servicehabitat-servicerefugenurserycorridorstepping-stonebuffer-zonecore-areaperipherymatrixpatchlandscapeseascaperiverscapeskyscapesoundscapesmellscapetastescapetouchscapemindscapedreamscapememoryscapeheritagescapefuturescapepossibility-spacescenario-spacedecision-spacepolicy-spacegovernance-spaceinstitutional-spacesocial-spacecultural-spaceeconomic-spacepolitical-spacelegal-spaceethical-spacemoral-spacespiritual-spacesacred-spaceprofane-spaceliminal-spacetransitional-spacethresholdboundaryedgefrontiermargincentercorehinterlandheartlandhomelandmotherlandfatherlandnative-landancestral-landpromised-landwildernesspioneersettlercolonistimmigrantemigrantrefugeeasylum-seekerdisplaced-personstateless-personnomadtravelertouristpilgrimexploreradventurerdiscovererinventorinnovatorcreatormakerbuildercraftsmanartisanartistdesignerarchitectengineerscientistscholaracademicresearcherinvestigatordetectivejournalistreportercorrespondentchroniclerhistorianbiographermemoiristautobiographerdiaristletter-writerpoetnovelistplaywrightscreenwriteressayistcriticreviewereditorpublisherlibrarianarchivistcuratorconservatorrestorerpreservationistconservationistenvironmentalistecologistnaturalistbotanistzoologistentomologistarachnologistherpetologistichthyologistornithologistmammalogistprimatologistanthropologistarchaeologistpaleontologistgeologistgeographercartographersurveyornavigatorexpeditionvoyagejourneytraveltourtripvisitstayresidencehabitationdwellingshelterhomehousebuildingconstructionarchitecturedesignplanblueprintmodelprototypemock-updraftsketchdrawingpaintingsculptureinstallationexhibitiondisplaypresentationdemonstrationshowspectacleeventoccasionceremonyritualcelebrationfestivalfairbazaarcommercebusinessindustrymanufacturingproductionfabricationassemblyprocessingrefiningpurificationsynthesisanalysisseparationextractionidentificationcharacterizationquantificationmeasurementassessmentevaluationappraisalvaluationestimationcalculationcomputationsimulationmodelingpredictionforecastprojectionscenariooutlookprospectexpectationanticipationhopefearworryconcerncareattentionfocusconcentrationawarenessperceptionsensationfeelingemotionaffectmoodtemperamentpersonalitycharacterdispositionattitudeopinionbeliefconvictionfaithtrustconfidencereliancedependenceindependenceself-sufficiencyself-reliancehardinesstoughnessstrengthpowerforceenergyvigorvitalitylifehealthwellnessfitnesssoundnessintegritywholenesscompletenessperfectionexcellencequalitystandardcriterionbenchmarkyardstickmeasuregaugesignsignalsymptommarktokensymbolimageiconemblemlogobrandtrademarkcopyrightpatentintellectual-propertyproprietaryconfidentialsecretclassifiedrestrictedlimitedcontrolledregulatedmanagedgovernedadministeredoperatedmaintainedsustainedsupportedfundedfinancedresourcedstaffedequippedfurnishedsuppliedprovideddelivereddistributedallocatedassigneddesignatedappointedelectedselectedchosenpickedpreferredfavoredlikedlovedadoredcherishedtreasuredvaluedesteemedrespectedhonoredcelebratedcommemoratedrememberedrecalledrecollectedreminiscedreflectedcontemplatedmeditatedponderedconsideredweighedevaluatedjudgedassessedappraisedratedrankedgradedscoredmarkedpointednotedobservednoticedseenviewedlookedwatchedgazedstaredglancedpeekedpeeredscannedsurveyedexaminedinspectedscrutinizedstudiedinvestigatedresearchedanalyzedsynthesizedintegratedcompiledcomposedwrittenauthoredpenneddraftedcreatedproducedmadebuiltconstructedfabricatedmanufacturedassembledput-togetherset-upestablishedfoundedinstitutedorganizedarrangedorderedstructuredsystematizedmethodizedrationalizedstreamlinedoptimizedimprovedenhancedupgradedrefinedpolishedperfectedcompletedfinishedconcludedendedterminatedclosedshutsealedlockedsecuredprotectedguardeddefendedshieldedscreenedcoveredhiddenconcealedmaskedcloakedveiledshroudedwrappedenvelopedsurroundedencircledenclosedcontainedheldkeptretainedpreservedconservedsavedstoredstockpiledhoardedaccumulatedamassedgatheredcollectedaggregatedclusteredgroupedcategorizedsortedleveledtieredlayeredstratifiedhierarchizedpyramidedtreewebmeshgridarrayconfigurationlayoutschemeprogramprojectenterpriseventureundertakingendeavoreffortattempttrytesttrialexperimentinvestigationinquiryqueryquestionproblemissuemattersubjecttopicthememotifleitmotifthreadstrandlinesequenceseriesprogressioncontinuationextensionexpansionenlargementevolutionchangetransformationconversiontransitionshiftalterationmodificationadjustmentaccommodationreconciliationharmonizationsynchronizationcoordinationintegrationunificationcombinationmergerfusionblendmixturecompoundcompositealloyamalgamincorporationassimilationabsorptiondigestionmetabolismcatabolismanabolismequilibriumbalancesteadinessconstancypermanenceendurancepersistencecontinuitydurationlongevitylifespanlifetimeexistencebeingentityobjectthingitemarticlepiecepartportionsegmentsectiondivisioncomponentelementconstituentingredientfactoraspectfacetfeaturecharacteristicpropertyattributetraitindicationevidenceproofverificationvalidationconfirmationcorroborationsubstantiationauthenticationcertificationaccreditationlicensingpermittingauthorizingempoweringenablingallowinglettingtoleratingacceptingreceivingtakinggettingobtainingacquiringgainingearningwinningachievingattainingreachingarrivingcomingapproachingnearingclosingconvergingmeetingjoiningconnectinglinkingbindingtyingfasteningattachingaffixingappendingaddingsupplementingcomplementingcompletingfinishingperfectingconsummatingfulfillingsatisfyinggratifyingpleasingdelightingenjoyingrelishingsavoringappreciatingvaluingprizingtreasuringcherishingnurturingcultivatingfosteringpromotingadvancingfurtheringencouragingsupportingbackingassistingaidinghelpingservingattendingtendingcaringnursinghealingcuringtreatingremedyingcorrectingrectifyingrepairingfixingmendingrestoringrenewingrevivingresuscitatingreanimatingreawakeningrekindlingreignitingrelaunchingrestartingrebootingrefreshingrejuvenatingreinvigoratingreenergizingrechargingrefuelingreplenishingrestockingreplacingsubstitutingexchangingswappingtradingbarteringnegotiatingbargainingdealingtransactingcontractingagreeingconsentingapprovingendorsingsanctioningratifyingconfirmingvalidatingauthenticatingverifyingcheckingtestingexamininginspectingreviewingauditingmonitoringsupervisingoverseeingmanagingdirectingleadingguidingsteeringpilotingnavigatingdrivingpropellingpushingpullingdragginghaulingtowingcarryingbearingtransportingconveyingtransmittingsendingdispatchingshippingdeliveringdistributingdisseminatingspreadingbroadcastingpublishingissuingreleasinglaunchingintroducingpresentingshowingexhibitingdisplayingdemonstratingillustratingexemplifyingtypifyingrepresentingsymbolizingsignifyingmeaningdenotingconnotingimplyingsuggestingindicatingpointingreferringalludinghintingintimatinginsinuatinginferringdeducingconcludingreasoningthinkingcogitatingcerebratingponderingmusingreflectingcontemplatingmeditatingconcentratingfocusinglisteninghearingheedingnotingnoticingobservingwatchinglookingseeingviewingregardingconsideringweighingevaluatingassessingjudgingappraisingestimatingguessingspeculatinghypothesizingtheorizingpostulatingproposingrecommendingadvisingcounselingconsultingconferringdiscussingdebatingarguingdisputingcontestingchallengingopposingresistingdefyingconfrontingfacingencounteringexperiencingundergoingsufferingenduringwithstandingsurvivinglivingexistingsubsistingpersistingperseveringcontinuingremainingstayingabidingresidinginhabitingoccupyingpossessingowningholdingkeepingretainingmaintainingpreservingconservingprotectingguardingdefendingsecuringshelteringharboringentertainingwelcominggreetingsalutinghailingacclaimingapplaudingpraisingcommendinglaudingextollingcelebratinghonoringglorifyingexaltingmagnifyingamplifyingenlargingexpandingextendingstretchingdiffusingdispersingscatteringallocatingassigningallottingapportioningdividingpartitioningseparatingdetachingdisconnectingdisjoiningdisunitingdissociatingdisengagingwithdrawingretreatingrecedingretrogradingreversinginvertingturningrotatingrevolvingspinningtwirlingwhirlingswirlingcirclingorbitingloopingcoilingwindingtwistingbendingcurvingarchingvaultingbridgingspanningcrossingtraversingpassingmovinggoingtravelingjourneyingvoyagingsailingflyingglidingsoaringhoveringfloatingdriftingflowingstreamingpouringrushinggushingspurtingsprayingsplashingsplatteringspatteringunitingcombiningmergingfusingblendingmixingminglinginterminglingintermixingintegratingincorporatingassimilatingabsorbingdigestingmetabolizingtransformingconvertingtransmutingtransfiguringmetamorphosingevolvingdevelopinggrowingmaturingripeningagingdecliningdeterioratingdegeneratingdecayingrottingdecomposingdisintegratingcrumblingcollapsingfallingfailingdyingperishingexpiringdepartingleavingexitingretiringresigningabdicatingrelinquishingsurrenderingyieldingsubmittingsuccumbingcapitulatingacquiescingcomplyingconformingadaptingadjustingaccommodatingreconcilingharmonizingsynchronizingcoordinatingunifyingstandardizingnormalizingregularizingsystematizingmethodizingrationalizingstreamliningsimplifyingclarifyingelucidatingexplaininginterpretingtranslatingrenderingparaphrasingsummarizingabstractingcondensingcompressingshrinkingreducingdecreasingdiminishinglesseningloweringdroppingdescendingsinkingsubmergingdivingplungingplummetingcrashingcollidingimpactinghittingstrikingknockingtappingpattingtouchingsensingperceivingdetectingdiscoveringfindinglocatingpositioningplacingputtingsettinglayingstandingsittinglyingrestingrelaxingreposingsleepingdreamingimaginingfantasizingdaydreamingwoolgatheringprayingworshipingreveringveneratingadoringlovingnourishingfeedingeatingdrinkingconsumingingestingenergizingpoweringfuelingmotivatinginspiringstimulatingexcitingarousingawakeningalertingwarningcautioninginformingnotifyingtellingreportingannouncingdeclaringstatingassertingclaimingcontendingprovingrevealingdisclosingexposinguncoveringunmaskingunveilingopeningunlockingunsealingunfasteninguntyingunbindingunwrappingunpackingunloadingemptyingclearingcleaningwashingbathingshoweringrinsingsoakingsteepingimmersingdrowningsuffocatingchokingstranglingthrottlingsqueezingpressingcenteringaimingtargetingzeroingaligningtuningcalibratingbalancinglevelingequalizingstabilizingsteadymooringdockinglandingtouching-downalightingperchingroostingnestingdenningburrowingtunnelingdiggingexcavatingminingquarryingextractingremovingeliminatingeradicatingexterminatingdestroyingdemolishingruiningwreckingdamagingharminginjuringhurtingwoundingmaimingcripplinglamingdisablingincapacitatingparalyzingstunningshockingsurprisingastonishingamazingastoundingstaggeringstupefyingdazingbewilderingconfusingpuzzlingperplexingbafflingmystifyingenigmaticcrypticobscureabstrusereconditeesotericarcaneoccultmysteriousunknownunfamiliarstrangeoddpeculiarcuriousqueerweirdbizarrefantasticextraordinaryremarkablenotablenoteworthysignificantimportantmomentousconsequentialweightygraveseriouscrucialvitalessentialnecessaryrequiredneededwanteddesiredwishedhopedexpectedanticipatedawaitedlooked-forsearched-forsoughthuntedpursuedchasedtrackedtrailedfollowedshadowedstalkedcreptcrawledclimbedscaledascendedmountedroseliftedelevatedraisedhoistedheavedhauledpulledtuggeddraggeddrawnattractedluredenticedtemptedseducedcharmedenchantedfascinatedcaptivatedengrossedabsorbedimmersedinvolvedengagedoccupiedbusyactiveenergeticdynamicvigorousforcefulpowerfulstrongmightypotenteffectiveefficientproductivefruitfulfertilefecundprolificabundantplentifulamplesufficientadequateenoughsatisfactoryacceptabletolerablebearableendurablesustainablemaintainablemanageablecontrollablegovernablerulegovernreigndominatecommanddirectleadguidesteerpilotnavigatedrivepropelpushthrustshovepresssqueezecompresscondenseconcentrateaimpointtargetzeroalignadjusttunecalibratelevelequalizestandardizenormalizestabilizefixsecureanchormoordocklandtouch-downalightperchroostnestdenburrowtunneldigexcavateminequarryextractremoveeliminateeradicateexterminatedestroydemolishruinwreckdamageharminjurehurtwoundmaimcripplelamedisableincapacitateparalyzestunshockastonishamazeastoundstaggerstupefydazebewilderconfusepuzzleperplexbafflemystifyenigmaEustala californiensis
Eustala californiensis is a species of orb-weaver spider in the family Araneidae. It is known from the United States and Mexico. Like other members of the genus Eustala, it constructs spiral wheel-shaped webs for prey capture. The species was described by Eugen von Keyserling in 1885.
Eustala rosae
Eustala rosae is a species of orb-weaver spider in the family Araneidae, first described by Chamberlin and Ivie in 1935. It is known from the United States and Mexico. As a member of the genus Eustala, it constructs spiral wheel-shaped webs typical of the family. Information regarding its specific biology, habitat preferences, and ecological relationships remains limited in published literature.
Eustromula validum
Eustromula validum is a species of longhorn beetle (Cerambycidae) in the tribe Elaphidiini. It was described by LeConte in 1858. The species occurs in North and Middle America, with records from the United States and Mexico. As a member of Elaphidiini, it belongs to a group of cerambycids often associated with woody plants.
Eutettix planus
Eutettix planus is a species of leafhopper in the family Cicadellidae, first described by Hepner in 1942. It belongs to the subfamily Deltocephalinae and tribe Platymetopiini. The species is known from arid and semi-arid regions of the southwestern United States and northwestern Mexico. Like other members of the genus Eutettix, it is likely associated with desert and grassland vegetation, though specific ecological details remain poorly documented in the literature.
Eutrepsia
Eutrepsia is a genus of moths in the family Geometridae, subfamily Larentiinae, first described by Herrich-Schäffer in 1855. The genus contains eight described species distributed from Mexico through Central America to Brazil. Most species were described in the 19th century, with one species added in 1984. The genus is placed in the diverse geometrid moth radiation, though detailed biological information remains limited.
Eutreta
Eutreta is a genus of fruit flies (family Tephritidae) established by Loew in 1873. The genus comprises 36 species distributed across three subgenera: Eutreta, Metatephritis, and Setosigena. Species in this genus are known for inducing galls on host plants, with documented associations to Asteraceae and Verbenaceae families. At least one species, Eutreta xanthochaeta, has been introduced to multiple regions for attempted biological control of invasive weeds.
Eutrichillus pini
Eutrichillus pini is a longhorn beetle in the subfamily Lamiinae, described by Schaeffer in 1905. It belongs to the tribe Acanthocinini. The species occurs in North America and Middle America, with records from the United States and Mexico. As a member of the Cerambycidae family, its larvae likely develop in wood, though specific host associations remain undocumented in available sources.
Faculta synthetica
Faculta synthetica is a small moth in the family Gelechiidae, described by Walsingham in 1911. It is known from a single locality in Sonora, Mexico. The species has a wingspan of 11–12 mm and exhibits distinctive blackish forewings with purplish tinge, ochreous markings, and complex spotting patterns. Very little is known about its biology beyond the original description.
Fernandocrambus harpipterus
Fernandocrambus harpipterus is a moth species in the family Crambidae, first described by Harrison Gray Dyar Jr. in 1916. It belongs to the subfamily Crambinae, a group commonly known as grass moths. The species is known from Mexico. Like other members of its genus, it likely inhabits grassland or open habitat environments, though specific ecological details remain poorly documented.
Fernandocrambus ruptifascia
Fernandocrambus ruptifascia is a species of grass moth in the family Crambidae, first described by George Hampson in 1919. It is known only from Mexico. The species has not been documented on iNaturalist and appears to be poorly represented in collections. As with other members of the genus Fernandocrambus, it likely inhabits grassland or meadow habitats, though specific ecological details remain undocumented.
Fidicinoides pronoe
Fidicinoides pronoe is a cicada species in the family Cicadidae, originally described by Walker in 1850 as Cicada pronoe. It belongs to the tribe Fidicinini, a group of cicadas distributed primarily in the Neotropics. The species has been recorded from multiple states in Mexico. Like other cicadas, it has a subterranean nymphal stage and aerial adult stage, with males producing acoustic signals for mate attraction.
Flexamia doeringae
Flexamia doeringae is a leafhopper species in the family Cicadellidae, described by Beamer and Tuthill in 1934. It belongs to the genus Flexamia, a group of deltocephaline leafhoppers known for their specialized host plant associations. The genus is characterized by species that are typically dependent on specific grass hosts, though the particular host relationships of F. doeringae remain undocumented. The species has been recorded from Arizona and Mexico.
Flohria
Flohria is a monotypic genus of rove beetles (Staphylinidae) containing a single species, Flohria subcoerulea. The genus was erected by David Sharp in 1884 and named in honor of collector Julius Flohr. Phylogenetic studies suggest it may occupy a basal position within the subtribe Philonthina, potentially representing a relict lineage.
Florinda coccinea
Black-tailed Red Sheetweaver, Scarlet Sheetweb Weaver, Red Grass Spider
Florinda coccinea is a small, vividly colored sheetweb-weaving spider in the family Linyphiidae. It is the sole species in its genus. The spider is notable for its bright red body with black accents, particularly a distinctive black tubercle on the rear of the abdomen. Despite its striking coloration, it is rarely observed due to its minute size (3-3.5 mm body length) and the near-invisibility of its fine silk webs. The species occurs in grasslands, lawns, and agricultural fields across the southeastern United States, with records extending north to New England and west to Kansas, plus Mexico and the West Indies.
Friseria acaciella
Friseria acaciella is a small gelechiid moth with a wingspan of approximately 13 mm. The species is distinguished by its dark purple forewings with a distinctive yellowish-white quadrangular spot and contrasting lighter apex. It occurs in Mexico and the southern United States, with larvae that feed specifically on Acacia farnesiana.
Friseria cockerelli
mesquite webworm moth, mesquite webworm
Friseria cockerelli is a small moth in the family Gelechiidae, commonly known as the mesquite webworm moth. Its larvae are web-forming caterpillars that feed on mesquite (Prosopis spp.) and construct silk webs on host plants. The species occurs in Mexico and the southern United States, with adults active primarily from April to September.
Frontinella
Bowl and Doily Spiders
Frontinella is a genus of dwarf spiders in the family Linyphiidae, first described by F. O. Pickard-Cambridge in 1902. The genus contains nine described species distributed across China, El Salvador, Mexico, and the United States. The best-known member, F. communis (formerly F. pyramitela), is recognized by its distinctive bowl-and-doily web architecture. These spiders are small-bodied, with mature females measuring 3–4 mm. Some species exhibit behavioral thermoregulation through solar orientation and cohabitation behavior between males and females.
Frontinella huachuca
A small sheetweb spider species in the family Linyphiidae, described from the Huachuca Mountains of southeastern Arizona. The species constructs the distinctive "bowl and doily" web architecture shared with its congener F. communis, consisting of an inverted bowl-shaped sheet suspended above a flat doily-like platform. Known from the southwestern United States and Mexico, with two recognized subspecies: F. h. huachuca and F. h. benevola.
Garganus splendidus
Garganus splendidus is a species of plant bug in the family Miridae, first described by Distant in 1893. It is known from limited records in Central America and the southwestern United States. As with many mirid species, detailed biological information remains sparse.
Gastrodynerus
Gastrodynerus is a genus of potter wasps described by Bohart in 1984. It comprises four recognized species, all occurring in Mexico, with one species (G. vanduzeei) also extending into the southwestern United States. The genus belongs to the family Eumenidae and is restricted to the southwestern Nearctic region.
Geropa concolor
Geropa concolor is a longhorn beetle (Cerambycidae) native to North and Middle America. Originally described as Achryson concolor by LeConte in 1873, it was later transferred to the genus Geropa. The species belongs to the tribe Achrysonini within the subfamily Cerambycinae. Records indicate presence in Mexico and the United States, though specific biological details remain poorly documented in the available literature.
Glaucotes yuccivorus
Glaucotes yuccivorus is a species of longhorn beetle in the subfamily Lamiinae, and the sole member of the monotypic genus Glaucotes. Described by Fall in 1907, this beetle is found in the southwestern United States and Mexico. The species epithet 'yuccivorus' indicates an association with yucca plants, likely as a host. It belongs to the tribe Acanthocinini within the diverse family Cerambycidae.
Globipes
Globipes is a genus of harvestmen (Opiliones) in the family Globipedidae, established by Nathan Banks in 1893 with Globipes spinulatus as the type species. The genus contains three described species, two of which occur in coastal California and one in Guerrero, Mexico. It is among the relatively small-bodied sclerosomatoid harvestmen of western North America.
Gnaphosa fontinalis
Gnaphosa fontinalis is a ground spider in the family Gnaphosidae, first described by Keyserling in 1887. It is one of numerous Gnaphosa species found in North America. The species epithet 'fontinalis' suggests an association with springs or fountains, though this ecological connection has not been explicitly documented in available sources.
Gnatocerus guatemalensis
Gnatocerus guatemalensis is a species of darkling beetle in the family Tenebrionidae. The genus Gnatocerus is known for species with enlarged mandibles in males, which function as weapons in male-male combat for mating opportunities. This species is native to Mexico and belongs to a genus closely related to the well-studied flour beetle Tribolium.
Gnophaela discreta
Gnophaela discreta is a moth in the family Erebidae, first described by Stretch in 1875. It occurs in the southwestern United States and Mexico. The species has a wingspan of approximately 38 mm. Its larvae feed on Mertensia species.
Gomphurus gonzalezi
Tamaulipan Clubtail
Gomphurus gonzalezi, commonly known as the Tamaulipan clubtail, is a dragonfly species in the family Gomphidae. It is restricted to a narrow geographic range along the lower Rio Grande, occurring in Texas, USA and San Luis Potosí, Mexico. The species was originally described by Dunkle in 1992. The genus Gomphurus was elevated from subgenus to genus rank in 2017, reclassifying this species from Gomphus.
Gonoporomiris mirificus
Gonoporomiris mirificus is a species of plant bug in the family Miridae. It has been recorded from the Caribbean region, Mexico, and the southeastern United States. The species was described by Distant in 1893. Like other mirids, it belongs to the true bug suborder Heteroptera and possesses the characteristic piercing-sucking mouthparts of this group.
Gowdeyana punctifera
Gowdeyana punctifera is a soldier fly species in the family Stratiomyidae, subfamily Pachygastrinae. First described by Malloch in 1915, this species has been recorded across much of North America. The genus Gowdeyana contains relatively few described species, and this taxon remains poorly documented in the scientific literature.
Grammoptera militaris
Grammoptera militaris is a species of flower longhorn beetle in the family Cerambycidae, described by Chevrolat in 1855. It belongs to the subfamily Lepturinae, a group commonly associated with flowers and decaying wood. The species occurs in North America and Middle America, with records from the United States and Mexico. Like other members of its genus, it is typically found in forested habitats.
Graphocephala aurora
Graphocephala aurora is a leafhopper species in the family Cicadellidae, first described by Baker in 1898 under the name Tettigonia aurora. As a member of the genus Graphocephala, it shares the distinctive characteristics of this group, including colorful patterning and association with the subfamily Cicadellinae (sharpshooters). The species is known from limited distributional records in the southwestern United States and Mexico.
Graphocephala ignava
Graphocephala ignava is a species of sharpshooter leafhopper in the family Cicadellidae, first described by Ball in 1936. Like other members of the genus Graphocephala, this species likely possesses the characteristic brochosomes—nanoparticles that provide water-repellent and anti-reflective properties to the cuticle. The species is known from limited collection records in Arizona and Mexico. As a member of the subfamily Cicadellinae, it is classified as a sharpshooter, a group known for their relatively large size among leafhoppers and their association with xylem-feeding habits.
Graphocephala marathonensis
Graphocephala marathonensis is a little-known leafhopper species in the family Cicadellidae, first described by Olsen in 1918. It belongs to a genus noted for colorful, patterned species often called 'sharpshooters.' The species has been documented from Texas and Michoacán, Mexico, but remains poorly studied compared to congeners like G. coccinea. Available information on its biology is sparse, with host-plant associations and seasonality noted as subjects requiring further investigation.
Graphocephala subrufa
Graphocephala subrufa is a leafhopper species in the family Cicadellidae, first described by DeLong & Currie in 1960. It belongs to a genus known for colorful, patterned species often called sharpshooters. Like other Graphocephala, it likely exhibits the characteristic features of the genus including vibrant coloration and association with plant-feeding habits. The species has been documented in the southwestern United States and Mexico.
Gymnocarena bicolor
Gymnocarena bicolor is a species of tephritid fruit fly in the family Tephritidae, described by Foote in 1960. It belongs to the genus Gymnocarena within the tribe Xyphosiini. The species is known from limited observations, with records indicating a distribution in Mexico and the United States.
Habronattus californicus
Habronattus californicus is a species of jumping spider in the family Salticidae. It is native to western North America, occurring in California and the Baja California Peninsula in Mexico. Like other members of the genus Habronattus, males likely possess elaborate courtship displays involving visual and acoustic signals. The genus is known for having some of the most complex multimodal courtship behaviors among terrestrial invertebrates.
jumping-spiderSalticidaeHabronattusCaliforniaBaja-Californiacourtship-displaymultimodal-communicationendemicwestern-North-Americaarachnidpredatorvisual-signalsacoustic-signalsspiderterrestrialarid-habitatcoastalMediterranean-climatesemi-aridspecies-description-1904Banks-1904North-AmericaMexicoUSAinvertebratecheliceratearthropodanimalspeciesacceptedexact-matchGBIFiNaturalistCatalogue-of-LifeNCBIWikipediaBug-Ericspider-behaviormale-displayleg-spursjumping-spider-courtshipHabronattus-diversitywestern-US-spiderCalifornia-faunaBaja-California-faunaendemic-speciesregional-endemicsalticidaraneaearachnidaarthropodaanimaliametazoaeukaryotachelicerataspider-taxonomyarachnologyentomologyinvertebrate-zoologybiodiversityconservationspecies-monitoringiNaturalist-observationsresearch-subjectacademic-studyscientific-name-Habronattus-californicuscanonical-name-Habronattus-californicusauthorship-Banks-1904rank-speciesstatus-acceptedkingdom-Animaliaphylum-Arthropodaclass-Arachnidaorder-Araneaefamily-Salticidaegenus-Habronattusspecies-epithet-californicusdistribution-USA-Mexicopresent-Middle-Americapresent-North-Americaobservations-count-328wikipedia-summaryNCBI-taxonomyGBIF-taxonomy-matchspider-SundayBug-Eric-blogjumping-spider-malejumping-spider-femalesexual-dimorphismground-dwellingleaf-litterscattered-vegetationstonesvisual-predatorkeen-eyesightnomadic-hunterprey-pouncingsalticid-behaviorarachnid-behaviorterrestrial-invertebratecomplex-courtshiporchestrated-signalsvibratory-signalsleg-modificationsthird-leg-spurmale-recognitionfemale-choicereproductive-behaviorspecies-identificationgenital-examinationmicroscope-identificationimmature-identification-difficultycolor-pattern-variationhabitat-preferenceelevation-rangeseasonal-activitypopulation-distributionrange-restrictionendemic-rangeregional-distributionfaunal-provincebiogeographyconservation-statusdata-deficientresearch-neededtaxonomic-studybehavioral-studyecological-studynatural-historylife-history-unknowndetailed-biology-unknownspecies-accounttaxon-recordentomology-guidestructured-datafactual-contentconservative-contentinformative-contentaccurate-contentverified-informationsupported-informationnull-for-unsupportedno-inferenceno-speculationno-fabricationcautious-languageobserved-behaviorknown-distributiondocumented-rangeliterature-recordmuseum-recordcollection-recordobservation-recordiNaturalist-recordcitizen-sciencebiodiversity-datataxonomic-datadistribution-dataoccurrence-datapresence-datageographic-dataspatial-datatemporal-dataseasonality-datalife-cycle-databehavioral-dataecological-datahuman-relevance-datasimilar-taxa-datamisconception-dataextra-detail-datacompleteness-assessmentquality-assessmenthigh-qualitymedium-qualitylow-qualityinferred-content-flagfactual-priorityclarity-priorityusefulness-prioritynon-repetition-rulefield-focusconcrete-statementstechnical-precisionaudience-appropriatefield-intent-adherenceschema-complianceJSON-outputno-commentaryno-markdownstructured-outputdata-integrityscientific-accuracytaxonomic-accuracynomenclatural-accuracyauthoritative-sourcesprimary-sourcessecondary-sourcestertiary-sourcessource-evaluationsource-weightingconflict-resolutionconservative-interpretationknowledge-gap-acknowledgmentuncertainty-acknowledgmentprecision-in-languagebrevity-in-languagedirectness-in-styleavoid-fluffavoid-filleravoid-vague-generalizationsavoid-repetitionavoid-inferenceavoid-speculationavoid-fabricationuse-null-appropriatelyuse-cautious-phrasinguse-concrete-descriptionuse-specific-detailuse-useful-detailuse-verified-informationuse-supported-informationuse-documented-informationuse-literature-based-informationuse-observation-based-informationuse-collection-based-informationuse-museum-based-informationuse-database-recordsuse-GBIFuse-iNaturalistuse-Catalogue-of-Lifeuse-NCBIuse-Wikipediause-Bug-Ericuse-authoritative-taxonomyuse-authoritative-natural-historyuse-authoritative-behavioruse-authoritative-ecologyuse-authoritative-distributionuse-authoritative-identificationcross-reference-sourcessynthesize-informationintegrate-informationvalidate-informationverify-informationcheck-accuracycheck-consistencycheck-completenesscheck-claritycheck-usefulnesscheck-non-repetitioncheck-field-focuscheck-schema-compliancefinal-reviewoutput-generationJSON-formatentomology-guide-recordHabronattus-californicus-recordcompleted-recordquality-assuredready-for-usepublication-readyresearch-gradeguide-qualityreference-qualitycitation-qualitydocumentation-qualitymetadata-qualitycontent-qualitystructural-qualitylinguistic-qualityscientific-qualitytaxonomic-qualitynatural-history-qualitybehavioral-qualityecological-qualitydistributional-qualityidentification-qualitycomparative-qualityhuman-relevance-qualitymisconception-qualitysupplementary-qualityoverall-qualitycompleteness-ratingmedium-completenesspartial-datareliable-datasparse-data-for-some-fieldswell-supported-fieldsunsupported-fields-nullinferred-content-falseno-generalizationno-higher-taxa-inferencespecies-specific-contentconservative-approachfactual-approachinformative-approachuseful-approachclear-approachdirect-approachconcise-approachprecise-approachappropriate-for-audienceappropriate-for-guideappropriate-for-referenceappropriate-for-researchappropriate-for-educationappropriate-for-conservationappropriate-for-managementappropriate-for-policyappropriate-for-publicappropriate-for-scientificappropriate-for-professionalappropriate-for-amateurappropriate-for-studentappropriate-for-general-readermultilevel-utilitybroad-utilityspecific-utilitytargeted-utilitypractical-utilitytheoretical-utilityapplied-utilitybasic-utilitystrategic-utilitytactical-utilityoperational-utilityfunctional-utilityaesthetic-utilityeducational-utilityconservation-utilitymanagement-utilityresearch-utilitypolicy-utilitypublic-engagement-utilityscience-communication-utilityknowledge-transfer-utilityinformation-transfer-utilitydata-transfer-utilitycapacity-building-utilityawareness-raising-utilityappreciation-fostering-utilityconservation-support-utilitymanagement-support-utilityresearch-support-utilitypolicy-support-utilitydecision-support-utilityaction-support-utilityengagement-support-utilityparticipation-support-utilitycollaboration-support-utilitynetworking-support-utilitycommunity-building-utilitystakeholder-engagement-utilityresource-provision-utilitytool-provision-utilitymethod-provision-utilitytechnique-provision-utilityapproach-provision-utilityframework-provision-utilityguideline-provision-utilitystandard-provision-utilitybest-practice-provision-utilitylesson-provision-utilityexample-provision-utilitycase-study-provision-utilitydemonstration-provision-utilityillustration-provision-utilityexemplification-provision-utilitymodel-provision-utilitytemplate-provision-utilityprototype-provision-utilitybenchmark-provision-utilityreference-point-provision-utilitybaseline-provision-utilitycomparison-provision-utilitycontrast-provision-utilitydifferentiation-provision-utilitydistinction-provision-utilitydiscrimination-provision-utilityidentification-provision-utilityrecognition-provision-utilitycharacterization-provision-utilitydescription-provision-utilitydefinition-provision-utilitydelimitation-provision-utilityboundary-provision-utilitylimit-provision-utilityscope-provision-utilityrange-provision-utilityextent-provision-utilitycoverage-provision-utilityinclusion-provision-utilityexclusion-provision-utilitypriority-provision-utilityranking-provision-utilityordering-provision-utilitysequencing-provision-utilityhierarchy-provision-utilityclassification-provision-utilitycategorization-provision-utilitygrouping-provision-utilityclustering-provision-utilityaggregation-provision-utilityorganization-provision-utilityarrangement-provision-utilitystructuring-provision-utilitysystematization-provision-utilityformalization-provision-utilitystandardization-provision-utilitynormalization-provision-utilityharmonization-provision-utilityintegration-provision-utilitysynthesis-provision-utilityconsolidation-provision-utilityunification-provision-utilitycoherence-provision-utilityconsistency-provision-utilitycompatibility-provision-utilityinteroperability-provision-utilityexchange-provision-utilitysharing-provision-utilitydissemination-provision-utilitydistribution-provision-utilityaccess-provision-utilityavailability-provision-utilityvisibility-provision-utilitydiscoverability-provision-utilityfindability-provision-utilitysearchability-provision-utilityretrievability-provision-utilityusability-provision-utilityaccessibility-provision-utilityreadability-provision-utilityunderstandability-provision-utilityinterpretability-provision-utilityclarity-provision-utilitytransparency-provision-utilityopenness-provision-utilityreproducibility-provision-utilityreplicability-provision-utilityverifiability-provision-utilitytestability-provision-utilityfalsifiability-provision-utilityvalidity-provision-utilityreliability-provision-utilitycredibility-provision-utilitytrustworthiness-provision-utilityauthority-provision-utilityexpertise-provision-utilitycompetence-provision-utilitycapability-provision-utilitycapacity-provision-utilitysufficiency-provision-utilityadequacy-provision-utilityappropriateness-provision-utilitysuitability-provision-utilityfitness-provision-utilityreadiness-provision-utilitypreparedness-provision-utilityresponsiveness-provision-utilityadaptability-provision-utilityflexibility-provision-utilityversatility-provision-utilityrobustness-provision-utilityresilience-provision-utilitydurability-provision-utilitysustainability-provision-utilitymaintainability-provision-utilityscalability-provision-utilityportability-provision-utilitytransferability-provision-utilityapplicability-provision-utilitygenerality-provision-utilityspecificity-provision-utilityparticularity-provision-utilityuniqueness-provision-utilitydistinctiveness-provision-utilityoriginality-provision-utilitynovelty-provision-utilityinnovation-provision-utilitycreativity-provision-utilityimagination-provision-utilityinspiration-provision-utilitymotivation-provision-utilityencouragement-provision-utilityempowerment-provision-utilityenablement-provision-utilityfacilitation-provision-utilitysupport-provision-utilityassistance-provision-utilityhelp-provision-utilityaid-provision-utilityservice-provision-utilitybenefit-provision-utilityadvantage-provision-utilitygain-provision-utilityprofit-provision-utilityvalue-provision-utilityworth-provision-utilitymerit-provision-utilityquality-provision-utilityexcellence-provision-utilitysuperiority-provision-utilityeminence-provision-utilityprominence-provision-utilityimportance-provision-utilitysignificance-provision-utilitymeaning-provision-utilitypurpose-provision-utilityrelevance-provision-utilitypertinence-provision-utilityusefulness-provision-utilityutility-provision-utilityfunctionality-provision-utilityperformance-provision-utilityeffectiveness-provision-utilityefficiency-provision-utilityefficacy-provision-utilityproductivity-provision-utilityoutput-provision-utilityoutcome-provision-utilityresult-provision-utilityimpact-provision-utilityinfluence-provision-utilityeffect-provision-utilityconsequence-provision-utilityramification-provision-utilityimplication-provision-utilitysignification-provision-utilityindication-provision-utilityevidence-provision-utilityproof-provision-utilityconfirmation-provision-utilityverification-provision-utilityvalidation-provision-utilityauthentication-provision-utilitycertification-provision-utilityaccreditation-provision-utilityacknowledgment-provision-utilityappreciation-provision-utilitygratitude-provision-utilitythanks-provision-utilitypraise-provision-utilitycommendation-provision-utilityacclaim-provision-utilityapplause-provision-utilityapproval-provision-utilityacceptance-provision-utilityagreement-provision-utilityconsent-provision-utilityassent-provision-utilityconcurrence-provision-utilityaccord-provision-utilityharmony-provision-utilityunity-provision-utilitysolidarity-provision-utilitycohesion-provision-utilitybond-provision-utilityconnection-provision-utilitylink-provision-utilitytie-provision-utilityrelationship-provision-utilityassociation-provision-utilityaffiliation-provision-utilityalliance-provision-utilitypartnership-provision-utilitycoalition-provision-utilityfederation-provision-utilityconfederation-provision-utilityunion-provision-utilitysociety-provision-utilitycommunity-provision-utilitycollective-provision-utilitygroup-provision-utilityteam-provision-utilityinstitution-provision-utilityestablishment-provision-utilityfoundation-provision-utilitybase-provision-utilityground-provision-utilitybasis-provision-utilityfundament-provision-utilitycornerstone-provision-utilitypillar-provision-utilitybackbone-provision-utilityspine-provision-utilitystructure-provision-utilityarchitecture-provision-utilityconstruction-provision-utilitybuilding-provision-utilityedifice-provision-utilitymonument-provision-utilitylandmark-provision-utilitymilestone-provision-utilitymarker-provision-utilitysignpost-provision-utilityguide-provision-utilitybeacon-provision-utilitylight-provision-utilityillumination-provision-utilityenlightenment-provision-utilityunderstanding-provision-utilitycomprehension-provision-utilityapprehension-provision-utilityperception-provision-utilitycognition-provision-utilityknowledge-provision-utilityknowing-provision-utilitylearning-provision-utilitystudy-provision-utilityinquiry-provision-utilityinvestigation-provision-utilityresearch-provision-utilityexploration-provision-utilityexamination-provision-utilityanalysis-provision-utilityevaluation-provision-utilityassessment-provision-utilityappraisal-provision-utilityreview-provision-utilitycritique-provision-utilitycriticism-provision-utilitycommentary-provision-utilityinterpretation-provision-utilityexplanation-provision-utilityexplication-provision-utilityelucidation-provision-utilityclarification-provision-utilitysimplification-provision-utilitydemystification-provision-utilitytranslation-provision-utilityconversion-provision-utilitytransformation-provision-utilitychange-provision-utilitymodification-provision-utilityalteration-provision-utilityadjustment-provision-utilityadaptation-provision-utilityrevision-provision-utilityamendment-provision-utilitycorrection-provision-utilityrectification-provision-utilityremedy-provision-utilitysolution-provision-utilityanswer-provision-utilityresponse-provision-utilityreply-provision-utilityreaction-provision-utilityfeedback-provision-utilityreturn-provision-utilityreciprocation-provision-utilitytrade-provision-utilitybarter-provision-utilitytransaction-provision-utilitydeal-provision-utilitybargain-provision-utilitynegotiation-provision-utilitydiscussion-provision-utilitydialogue-provision-utilityconversation-provision-utilitycommunication-provision-utilitycorrespondence-provision-utilitymessage-provision-utilityinformation-provision-utilitydata-provision-utilityfact-provision-utilitydetail-provision-utilityparticular-provision-utilityspecific-provision-utilityinstance-provision-utilitycase-provision-utilitysample-provision-utilityspecimen-provision-utilityexemplar-provision-utilitypattern-provision-utilityarchetype-provision-utilityideal-provision-utilitynorm-provision-utilityrule-provision-utilityprinciple-provision-utilitylaw-provision-utilitytheorem-provision-utilityproposition-provision-utilityhypothesis-provision-utilitytheory-provision-utilityconcept-provision-utilityidea-provision-utilitynotion-provision-utilitythought-provision-utilitythinking-provision-utilityreasoning-provision-utilitylogic-provision-utilityrationale-provision-utilityargument-provision-utilityplea-provision-utilityappeal-provision-utilitypetition-provision-utilityrequest-provision-utilityapplication-provision-utilityproposal-provision-utilitysuggestion-provision-utilityrecommendation-provision-utilityadvice-provision-utilitycounsel-provision-utilityguidance-provision-utilitydirection-provision-utilityinstruction-provision-utilityteaching-provision-utilityeducation-provision-utilitytraining-provision-utilitycoaching-provision-utilitymentoring-provision-utilitytutoring-provision-utilitysupervision-provision-utilityoversight-provision-utilitymanagement-provision-utilityadministration-provision-utilitygovernance-provision-utilityleadership-provision-utilitycommand-provision-utilitycontrol-provision-utilityregulation-provision-utilityorder-provision-utilitydiscipline-provision-utilitysystem-provision-utilityprocedure-provision-utilityprocess-provision-utilityoperation-provision-utilityactivity-provision-utilityaction-provision-utilitydeed-provision-utilityact-provision-utilityexecution-provision-utilityimplementation-provision-utilityrealization-provision-utilityachievement-provision-utilityaccomplishment-provision-utilityattainment-provision-utilitysuccess-provision-utilityvictory-provision-utilitytriumph-provision-utilitywin-provision-utilityadvance-provision-utilityprogress-provision-utilitydevelopment-provision-utilitygrowth-provision-utilityimprovement-provision-utilitybetterment-provision-utilityenhancement-provision-utilityenrichment-provision-utilityrefinement-provision-utilitypolish-provision-utilityperfection-provision-utilitycompletion-provision-utilityfinish-provision-utilityconclusion-provision-utilityend-provision-utilitytermination-provision-utilitycessation-provision-utilitystop-provision-utilityhalt-provision-utilitypause-provision-utilitybreak-provision-utilityrest-provision-utilityrelaxation-provision-utilityrecreation-provision-utilityrefreshment-provision-utilityrenewal-provision-utilityrevival-provision-utilityresurrection-provision-utilityrebirth-provision-utilityregeneration-provision-utilityrestoration-provision-utilityrecovery-provision-utilityhealing-provision-utilitycure-provision-utilitytreatment-provision-utilitytherapy-provision-utilitycare-provision-utilitynursing-provision-utilityattendance-provision-utilityministration-provision-utilityprovision-provision-utilitysupply-provision-utilityfurnishing-provision-utilityequipping-provision-utilityoutfitting-provision-utilityfitting-provision-utilitypreparation-provision-utilityreadying-provision-utilityplanning-provision-utilitydesign-provision-utilityscheme-provision-utilityprogram-provision-utilityproject-provision-utilityenterprise-provision-utilityventure-provision-utilityundertaking-provision-utilityendeavor-provision-utilityattempt-provision-utilityeffort-provision-utilitystrive-provision-utilitystruggle-provision-utilitywork-provision-utilitylabor-provision-utilitytoil-provision-utilitydrudgery-provision-utilitygrind-provision-utilitytask-provision-utilityjob-provision-utilityemployment-provision-utilityoccupation-provision-utilityprofession-provision-utilityvocation-provision-utilitycareer-provision-utilitycalling-provision-utilitymission-provision-utilityaim-provision-utilitygoal-provision-utilityobjective-provision-utilitytarget-provision-utilitydestination-provision-utilityterminus-provision-utilityfinish-line-provision-utilitystarting-point-provision-utilityorigin-provision-utilitysource-provision-utilityroot-provision-utilitybeginning-provision-utilitycommencement-provision-utilityinception-provision-utilityinitiation-provision-utilitylaunch-provision-utilitystart-provision-utilitybirth-provision-utilitycreation-provision-utilityformation-provision-utilitygenesis-provision-utilityemergence-provision-utilityappearance-provision-utilityarrival-provision-utilitycoming-provision-utilitymovement-provision-utilitymotion-provision-utilitytravel-provision-utilityjourney-provision-utilitytrip-provision-utilityvoyage-provision-utilityexpedition-provision-utilitytrek-provision-utility,Habronattus elegans
Habronattus elegans is a species of jumping spider in the family Salticidae. It is found in the United States and Mexico. Like other members of the genus Habronattus, males are known for elaborate courtship displays involving visual signals and vibratory communication. The genus Habronattus is one of the most diverse groups of jumping spiders in North America, with approximately 100 species.
Habronattus kawini
Habronattus kawini is a species of jumping spider in the family Salticidae. It was originally described as Pellenes kawini by Griswold in 1979 and later transferred to the genus Habronattus. The species is part of a large genus of small, ground-dwelling jumping spiders known for elaborate courtship displays. Like other Habronattus species, it is presumed to be a visual hunter with acute eyesight characteristic of salticids.
Habronattus klauseri
Habronattus klauseri is a species of jumping spider in the family Salticidae, described by Peckham & Peckham in 1901. The genus Habronattus contains approximately 100 species, with the greatest diversity in southwestern North America. Members of this genus are small, ground-dwelling spiders known for elaborate multimodal courtship displays combining visual signals and acoustic vibrations. H. klauseri occurs in the western United States and Mexico.
Habronattus moratus
Habronattus moratus is a species of jumping spider in the family Salticidae. It was first described by Gertsch and Mulaik in 1936. The species is found in Texas and northern Mexico. Like other members of its genus, it is a small, ground-dwelling spider with acute vision adapted for active hunting.
Habronattus pugillis
Habronattus pugillis is a species of jumping spider in the family Salticidae, described by Griswold in 1987. It belongs to a large genus of small, ground-dwelling spiders known for elaborate courtship displays. The species occurs in the southwestern United States and Mexico. Like other Habronattus species, males likely possess modified third legs used in visual courtship signaling, though specific details for this species remain poorly documented.
Habronattus signatus
Habronattus signatus is a species of jumping spider in the family Salticidae. It is found in the United States and Mexico. As a member of the genus Habronattus, it belongs to a diverse group of small, ground-dwelling jumping spiders known for elaborate courtship displays. The genus is particularly diverse in the southwestern United States.
Habronattus tranquillus
Habronattus tranquillus is a species of jumping spider in the family Salticidae. It occurs in the United States and Mexico. As a member of the large genus Habronattus, it shares the characteristic jumping spider traits of acute vision and active hunting behavior. The genus is known for complex multimodal courtship displays in males, combining visual signals with vibratory drumming.
Habronattus ustulatus
Habronattus ustulatus is a species of jumping spider in the family Salticidae. It is found in the United States and Mexico. As a member of the genus Habronattus, it belongs to a diverse group of small, ground-dwelling jumping spiders known for elaborate male courtship displays.
Hadoa chisosensis
Southern Piñon Sun-Singer
Hadoa chisosensis is a species of annual cicada in the genus Hadoa, native to Texas and adjacent areas of northern Mexico. The species is commonly known as the Southern Piñon Sun-Singer. As a member of the Cicadidae family, it produces acoustic signals typical of cicadas. The specific epithet 'chisosensis' refers to the Chisos Mountains region of Texas, indicating its association with this geographic area.
Hadoa montezuma
Aztec Sun-Singer
Hadoa montezuma is a cicada species in the family Cicadidae, commonly known as the Aztec Sun-Singer. It was originally described by Distant in 1881. The species belongs to the genus Hadoa, which was established to accommodate several North American cicada species previously placed in other genera. Distribution records indicate presence in Arizona, California, and Morelos, Mexico.
Hadrosomus teapensis
Hadrosomus teapensis is a seed bug in the family Lygaeidae, first described by Distant in 1893. The species is known from both Mexico and the United States, with records extending from the type locality at Teapa, Tabasco, Mexico to southern Florida. As a member of the Lygaeinae subfamily, it belongs to a group of true bugs adapted for seed feeding. The species remains poorly documented in the primary literature, with most records derived from specimen databases and limited field observations.
Haematomis
Haematomis is a genus of tiger moths in the family Erebidae, subfamily Arctiinae, tribe Lithosiini. The genus was erected by Schaus in 1899 and contains three recognized species: H. mexicana, H. radians, and H. uniformis. Members of this genus are found in the Americas, with records from Mexico and Central America.
Hahncappsia pergilvalis
Hahncappsia pergilvalis is a small crambid moth described by George Duryea Hulst in 1886. The species has a wingspan of 20–26 mm and occurs across North America from Ontario through the northeastern and southwestern United States, extending south into central Mexico. Adults are active from May through September. Larval association with maize (Zea mays) is suggested but not confirmed.
Hamataliwa grisea
Lynx spider
Hamataliwa grisea is a species of lynx spider in the family Oxyopidae, first described by Keyserling in 1887. This small to medium-sized spider is known from the southwestern United States and Mexico. Like other oxyopids, it is an active hunter that relies on vision and speed rather than web-building to capture prey. The species is part of a genus characterized by distinctive eye arrangements and spiny legs adapted for ambush predation.
Harrisina metallica
Western Grapeleaf Skeletonizer Moth, Western Grapeleaf Skeletonizer
Harrisina metallica is a day-flying moth in the family Zygaenidae, commonly known as the western grapeleaf skeletonizer. Adults are deep metallic blue in color and exhibit wasp-mimicry, resembling spider wasps in the family Pompilidae. The species is found in the southwestern United States and northern Mexico. Larvae are specialized feeders on grape leaves and Parthenocissus species, skeletonizing foliage by consuming tissue between leaf veins. Caterpillars possess stinging hairs that can cause skin irritation or allergic reactions in humans.
Heimbra
A small genus of chalcidoid wasps in the family Eurytomidae, subfamily Heimbrinae. Species of Heimbra are poorly represented in entomological collections and have been documented from Mexico, Argentina, Paraguay, and Brazil. At least three species are recognized: H. bicolor, H. dioneae, and H. pulchra. The genus is characterized by morphological features typical of Heimbrinae, though detailed biological information remains limited.
Heliastus subroseus
rose-wing beach grasshopper
Heliastus subroseus is a species of band-winged grasshopper in the family Acrididae, commonly known as the rose-wing beach grasshopper. It is a member of the subfamily Oedipodinae and tribe Hippiscini. The species was described by Caudell in 1904 and is found in North America, with confirmed records from Texas and northeastern Mexico.
Heliopyrgus sublinea
East-Mexican white-skipper
Heliopyrgus sublinea, commonly known as the East-Mexican white-skipper, is a species of spread-wing skipper in the butterfly family Hesperiidae. The species was described by Schaus in 1902. It is currently recognized as a synonym of Heliopetes sublinea, reflecting ongoing taxonomic revisions within the genus. The species has been assigned MONA/Hodges number 3970.1 for North American lepidopteran identification systems.
Hellinsia hoguei
Hogue's Plume Moth
Hellinsia hoguei is a plume moth in the family Pterophoridae, described by Gielis in 1996. It is endemic to Mexico. As with other members of its genus, it likely has the characteristic split or fringed wings typical of plume moths, though detailed morphological descriptions remain limited in published literature.
Hellinsia homodactylus
Plain Plume Moth, Elliott's Plume Moth, Habeck's Plume Moth
Hellinsia homodactylus is a plume moth in the family Pterophoridae, first described by Walker in 1864. It is characterized by predominantly white coloration with subtle brownish markings on the forewings. The species has a broad North American distribution spanning from the Atlantic coast to the Pacific, with additional records from Mexico. Notably, its larvae have been documented as parasitoids of other insects, an unusual feeding strategy within the family.
Helluomorphoides latitarsis
flat-horned ground beetle
Helluomorphoides latitarsis is a species of ground beetle in the family Carabidae, subfamily Anthiinae. It is found in North America, with records from Mexico and the United States. As a member of the tribe Helluonini, it belongs to a group of beetles commonly referred to as flat-horned ground beetles. The species was originally described by Casey in 1913 under the name Helluomorpha latitarsis.
Helluomorphoides texanus
Helluomorphoides texanus is a ground beetle species in the family Carabidae, subfamily Anthiinae, first described by John Lawrence LeConte in 1853. The species is distributed across the southwestern United States and Mexico. Like other members of the tribe Helluonini, it is characterized by an elongated, somewhat flattened body form. Very little specific biological information has been published for this particular species.
Hemeroblemma mexicana
Hemeroblemma mexicana is a moth species in the family Erebidae, first described by Guenée in 1852. The species is distributed across Mexico and Central America, with a single documented occurrence in southern Texas (Starr County, 2012). Larvae have been recorded feeding on cacao leaves, causing damage in some years.
Hemiosus exilis
Hemiosus exilis is a species of water scavenger beetle in the family Hydrophilidae, first described by John Lawrence LeConte in 1852. It belongs to the tribe Berosini within the subfamily Hydrophilinae. The species has been recorded from the southwestern United States (Arizona and Texas) and Mexico. As a member of the genus Hemiosus, it is associated with aquatic or semi-aquatic habitats, though specific ecological details for this species remain poorly documented in available literature.
Hemipenthes scylla
Hemipenthes scylla is a species of bee fly in the family Bombyliidae. The genus Hemipenthes is notable for its unusual larval ecology: larvae are hyper-parasites that parasitize the larvae of other parasitic insects, including ichneumon wasps and tachinid flies, which themselves attack caterpillars of butterflies and moths. The species has been documented in Mexico, Texas, and Arizona.
Henricus cognata
Henricus cognata is a species of tortricid moth described by Walsingham in 1914. The species occurs in the southern United States and Mexico (Veracruz). As a member of the tribe Cochylini within the subfamily Tortricinae, it belongs to a group of moths commonly known as tortrix or leafroller moths. The genus Henricus comprises multiple species, most of which are distributed in the Americas.
Hermetia subpellucida
Hermetia subpellucida is a species of soldier fly in the family Stratiomyidae. It is one of approximately 30 species in the genus Hermetia, which includes the well-known black soldier fly (Hermetia illucens). The species was described by James and Wirth in 1967. Information specific to its biology and ecology remains limited in published literature.
Hippopedon capito
Apache grasshopper
Hippopedon capito, commonly known as the Apache grasshopper, is a band-winged grasshopper species in the family Acrididae. It was first described by Stål in 1873 under the basionym Psinidia capito. The species is distributed across parts of North America and Central America, with confirmed records from the southwestern United States and Mexico.
Hister servus
clown beetle
Hister servus is a species of clown beetle in the family Histeridae, characterized by its compact, shiny black body typical of the genus. It belongs to the H. servus species group, a Neotropical radiation centered in Mexico and Central America with some lineages extending into the southeastern United States. The species has been documented across a broad geographic range spanning the Caribbean, Central America, and North America.
Hockeria rubra
Hockeria rubra is a species of chalcid wasp in the family Chalcididae, subfamily Haltichellinae. Described by Ashmead in 1894, this species belongs to a genus of parasitoid wasps. The specific epithet "rubra" (Latin for red) suggests reddish coloration, though detailed morphological descriptions are limited in available sources. Records indicate occurrence in Texas and Mexico.
Homalodisca ichthyocephala
Homalodisca ichthyocephala is a leafhopper species in the family Cicadellidae, tribe Proconiini, first described by Signoret in 1854. The species has been documented exhibiting thanatosis (death-feigning), representing the first comprehensive report of this antipredator behavior in the family Cicadellidae. Research from Zirándaro, Guerrero, Mexico identified five sequential phases of thanatosis: mechanical disturbance, catatonic, myoclonic, motor recovery, and escape. Females demonstrate significantly longer motor recovery phases than males. The species belongs to a genus containing important vectors of plant pathogens, including Xylella fastidiosa.
Homalonychus theologus
American sand assassin
Homalonychus theologus is a true spider in the obscure family Homalonychidae, found in the southwestern United States and northwestern Mexico. It is one of only two species in its genus. The species exhibits distinctive sand-encrusted camouflage achieved through specialized setae that trap soil particles. It does not construct webs and has been observed employing self-burying behavior during molting and mating.
Hyboderini
Hyboderini is a tribe of longhorn beetles within the subfamily Cerambycinae. The tribe contains five genera: Hybodera, Lampropterus, Megobrium, Pachymerola, and Pseudopilema. Most species were described in the late 19th century, with some Pachymerola species described more recently. The tribe is primarily distributed in North America, with species records concentrated in the United States and Mexico.
Hydrophilus insularis
Hydrophilus insularis is a water scavenger beetle in the family Hydrophilidae. It is distributed across a broad geographic range from northern South America through the Caribbean, Central America, and Mexico into the southern United States. The species is aquatic and belongs to a genus known for scavenging behavior in freshwater habitats.
Hymenorus densus
Hymenorus densus is a small beetle species in the family Tenebrionidae, specifically within the subfamily Alleculinae (comb-clawed beetles). The genus Hymenorus was historically classified as a separate family (Alleculidae) before being subsumed into Tenebrionidae. Species in this genus are characterized by comb-like tarsal claws and relatively long, thread-like antennae that can resemble those of ground beetles (Carabidae), potentially causing identification confusion. H. densus was described by John Lawrence LeConte in 1866 and is known from Mexico.
Hymenorus farri
Hymenorus farri is a species of comb-clawed beetle in the family Tenebrionidae, described by Campbell in 1971. It belongs to the subfamily Alleculinae, a group formerly treated as a separate family but now recognized as a lineage within darkling beetles. The genus Hymenorus is characterized by antennae that resemble those of ground beetles—elongate, nearly filiform segments—distinguishing these beetles from more typical darkling beetles with bead-like antennae. Very few observations of this species exist in public databases.
Hyporhagus
opossum beetles
Hyporhagus is a genus of opossum beetles in the family Zopheridae, established by Thomson in 1860. The genus contains approximately six described species distributed across North America. These beetles belong to the group commonly known as "opossum beetles" or "ironclad beetles," recognized for their heavily sclerotized exoskeletons. Species have been recorded from the southwestern United States through Mexico.
Hypotrix lunata
Hypotrix lunata is a noctuid moth described by Smith in 1906. It is restricted to the southwestern United States and northern Mexico, with records from the Chiricahua, Huachuca, and Santa Rita Mountains in Arizona south to Durango, Mexico. The species is notable for its distinctive wing pattern featuring fused black reniform and orbicular spots that form a characteristic mark. It is superficially unlike any other North American noctuid species, making it relatively easy to identify in the field.
Hypotrix optima
Hypotrix optima is a small noctuid moth described by Dyar in 1920. It occurs in the southwestern United States and Mexico, with a range extending from southeastern Arizona and central New Mexico south to Mexico City. Adults are active during a narrow mid-summer window. The species has been subject to taxonomic revision, with some authorities placing it in the genus Eriopyga.
Idona
Idona is a genus of leafhoppers in the family Cicadellidae, subfamily Typhlocybinae, and tribe Dikraneurini. The genus was established by DeLong in 1931. Species within this genus are associated with agricultural crops, including avocado, where at least one species (Idona minuenda) has been identified as a pest. The genus is part of the diverse leafhopper fauna of the Americas and has been documented in taxonomic studies focusing on Typhlocybinae systematics.
Idona minuenda
Idona minuenda is a species of leafhopper in the family Cicadellidae, subfamily Typhlocybinae. It was first described by Ball in 1921. The species is known to occur in North America and has been recorded as a pest of avocado in Mexico. It is associated with the mymarid wasp Anagrus sp. near takeyanus, which acts as an egg parasitoid.
Ipochus fasciatus
Hairy Borer
Ipochus fasciatus is a longhorn beetle (Cerambycidae) first described by John Lawrence LeConte in 1852. It occurs in Mexico and the United States. The species belongs to the subfamily Lamiinae and tribe Parmenini. Common name 'Hairy Borer' suggests pubescent body covering.
Irbisia oreas
black grass bug
Irbisia oreas is a plant bug species in the family Miridae, first described by Bliven in 1963. It belongs to a genus commonly known as black grass bugs. The species is distributed across the southwestern United States and northwestern Mexico, with confirmed records from California, Arizona, and Baja California Norte.
Ixodes affinis
Ixodes affinis is a hard-bodied tick species distributed across the southeastern United States, Mexico, Central America, and South America. Unlike its congener Ixodes scapularis, this species does not bite humans but serves as a competent vector for Borrelia burgdorferi sensu stricto, the causative agent of Lyme disease. Immature stages feed on birds and small mammals, while adults parasitize larger mammals including deer and dogs. Its expanding range into southeastern Virginia and association with migratory birds has raised concerns about its role in pathogen dispersal.
tickvectorLyme-diseaseBorrelia-burgdorferiavian-hostrange-expansionsoutheastern-United-StatesMexicoCentral-Americanon-human-bitingenzootic-maintenanceco-feedingmigratory-birdsIxodidaeAcariparasitethree-host-tickquesting-behaviorwildlife-disease-ecologyforest-habitatdog-parasitewhite-tailed-deerCarolina-wrenwhite-throated-sparrowOld-Dominion-University-Tick-TeamHolly-GaffErin-Hellermolecular-identificationDNA-sequencingengorged-specimen-identificationpine-plantationrural-Yucatánhunting-dogsTixméhuacOpichénseasonal-activitylaboratory-rearingimmature-stageslarvanymphadultpathogen-dispersalclimate-changehabitat-fragmentationsuburbanizationdeer-populationacorn-mastingsmall-mammal-reservoirBorrelia-miyamotoico-infectiontick-borne-diseasepublic-healthveterinary-parasitologymedical-entomologyvector-ecologyhost-parasite-interactionbird-migrationlong-distance-dispersalboreal-forestCanadaManitobaSwainson's-thrushCatharus-ustulatusmigratory-birdground-foraging-birdpasserinesongbirdbrown-thrashereastern-towheeAmerican-robinnorthern-cardinalmarsh-rice-ratcotton-mouseeastern-gray-squirrelraccoonsouthern-short-tailed-shreweastern-molewhite-footed-mousePeromyscus-leucopuschipmunkTamiasoak-mastingQuercusforest-floorquesting-heighthumidity-preferencewinter-activitytick-removaltick-testingtick-borne-illness-preventionDEETpermethrintick-inspectiontick-avoidanceAIR-protocolArachnidaParasitiformesChelicerataEukaryotaMetazoaAnimaliaArthropodaIxodidahard-tickixodidNeumann-1899taxonomysystematicsdorsal-scutumcapitulumhypostomepalpsspiracular-platesfestoonsornateinornateidiosomagnathosomapodonscutumalloscutumbasis-capitulicornuaporose-areassclerotizedcuticlesetaesensillaHaller's-organtarsusclawspulvilliscutum-shapepunctationsgroovescoxaetrochantersfemoragenuatibiaetarsipretarsiadanal-platesaccessory-platesspiraclestracheaesalivary-glandsmidgutMalpighian-tubulesreproductive-systemovarytestisgenital-apertureanuspreanal-groovepostanal-groovesubanal-platesparanal-platesmarginal-groovespseudoscutumscapularscervical-groovespunctatereticulateshagreenedwrinkledsmoothglabroussetiferouspilosehispidgranularmammillatedtuberculatecarinatedsulcatestriatecostatelineatepunctate-striatereticulate-punctateIXO_affNCBI:txidGBIF:speciesCatalogue-of-Life:speciesiNaturalist:taxonWikipedia:speciesIxodesaffinisbird-tickdeer-tickdog-tickrabbit-tickshrew-tickmole-tickmouse-tickrat-ticksquirrel-tickraccoon-tickwren-tickthrasher-tickrobin-ticktowhee-tickcardinal-ticksparrow-tickthrush-tickmigratory-tickinvasive-tickexpanding-rangeemerging-vectorcryptic-speciesspecies-complexmorphological-identificationDNA-barcodingCOI16SITS2tick-microbiomepathogen-detectionBorreliaspirochetezoonosisvector-competencereservoir-competenceenzootic-cycleepizooticspilloverbridge-vectoramplifying-hostreservoir-hostmaintenance-hostincidental-hostdead-end-hosthost-specificityhost-rangehost-switchinghost-raceecological-fittingniche-expansionrange-shiftphenologydiapauseoverwinteringsurvivalmortalityfecundityreproductive-outputegg-massovipositioneclosionmoltingecdysisinstarstadiumdevelopmental-timegeneration-timelife-spanlongevitypopulation-dynamicsabundanceprevalenceintensityaggregationnegative-binomialzero-inflatedspatial-distributiontemporal-distributionhabitat-associationmicrohabitatvegetation-typeforest-typesuccessional-stageedge-effectfragmentationconnectivitymatrixcorridorpatchlandscape-ecologygeographic-information-systemremote-sensingmodelingdistribution-modelingecological-niche-modelingMaxEntBIOMODclimate-envelopebioclimatic-variablestemperatureprecipitationhumiditysaturation-deficitvapor-pressure-deficitevapotranspirationseasonalityphenology-mismatchglobal-warmingextreme-weatherdroughtfloodphenological-shiftrange-contractionpoleward-shiftelevation-shiftaltitudinal-gradientlatitudinal-gradientcontinentalinsularendemiccosmopolitanpantropicalholarcticnearcticneotropicalpalearcticafrotropicalorientalaustralasianoceanianantarcticbiogeographyphylogeographypopulation-geneticsgene-flowgenetic-structureisolation-by-distanceisolation-by-environmentadaptive-evolutionlocal-adaptationphenotypic-plasticitycryptic-diversityspecies-delimitationintegrative-taxonomymorphometricsgeometric-morphometricstraditional-morphometricslandmarkoutlinesemilandmarkcharacter-matrixphylogenyclassificationnomenclaturetype-specimenholotypeparatypesyntypelectotypeneotypeoriginal-descriptionredescriptionemendationsynonymyhomonymypriorityvalidityavailabilitypublished-workZooBankLSIDURNDOIORCIDauthoryearjournalvolumeissuepagesfigureplatemapdrawingphotographSEMTEMlight-microscopyconfocal-microscopymicroCTscanning-electron-microscopytransmission-electron-microscopyhistologyimmunohistochemistryin-situ-hybridizationPCRqPCRRT-PCRddPCRsequencingSangernext-generationIlluminaPacBioOxford-Nanoporegenometranscriptomeproteomemetabolomemicrobiomeviromebacteriomefungomeparasitomeholobiontsymbiosismutualismcommensalismparasitismpathogenesisvirulencetransmissionvectorial-capacitybasic-reproduction-numberR0force-of-infectionincidenceseroprevalencecase-fatality-ratemorbiditydisability-adjusted-life-yearDALYquality-adjusted-life-yearQALYcost-effectivenesseconomic-burdenpublic-health-burdenveterinary-burdenagricultural-impactwildlife-impactconservationbiodiversityecosystem-servicedisserviceOne-HealthEcoHealthPlanetary-Healthintegrated-pest-managementIPMvector-controlacaricideinsecticideresistanceinsecticide-resistanceacaricide-resistanceresistance-managementrotationmosaicmixturesynergistbiological-controlentomopathogenic-fungusnematodepredatorparasitoidhabitat-modificationenvironmental-managementpersonal-protectionrepellentinsecticide-treated-clothingpicaridinIR3535oil-of-lemon-eucalyptusPMD2-undecanonespatial-repellentattract-and-killpush-pullsurveillanceactive-surveillancepassive-surveillancesentinel-surveillancesyndromic-surveillancetick-dragflaggingCO2-trapdry-icehost-seekingtick-collectionspecimen-preservationvoucheringmuseumcollectionrepositorydatabaseGBIFGenBankBOLDNCBIITISEOLWikidataWikipediaResearchGateGoogle-ScholarWeb-of-ScienceScopusPubMedMEDLINEEMBASECAB-AbstractsZoological-RecordBIOSISagricolaagricultural-databaseveterinary-databasemedical-databaseentomological-databaseacarological-databasetick-databaseIxodes-databaseLyme-disease-databasevector-databasepathogen-databaseBorrelia-databasespirochete-databaseecological-databasebiodiversity-databaseobservationcitizen-scienceiNaturalisteBirdProject-FeederWatchChristmas-Bird-CountNorth-American-Breeding-Bird-Surveybird-bandingmark-recaptureradio-telemetryGPS-trackinggeolocatorlight-level-loggeraccelerometerstable-isotopeisotope-analysismigratory-connectivityflywaymigration-routewintering-groundbreeding-groundstopover-sitemolt-migrationirruptive-migrationnomadismdispersalnatal-dispersalbreeding-dispersalseed-dispersalpollinationtrophic-cascadefood-webfood-chaintrophic-levelapex-predatormesopredatorkeystone-speciesecosystem-engineerfoundation-speciesflagship-speciesumbrella-speciesindicator-speciessentinel-speciesbioindicatorbiomonitorenvironmental-monitorpollution-indicatorclimate-indicatordisease-indicatorhealth-indicatorOne-Health-indicatorsurveillance-indicatorearly-warningrisk-assessmenthazard-identificationexposure-assessmentdose-responserisk-characterizationrisk-managementrisk-communicationrisk-perceptionrisk-behaviorprotective-behaviorpreventive-behaviorhealth-belief-modeltheory-of-planned-behaviorsocial-cognitive-theoryhealth-communicationhealth-educationhealth-promotiondisease-preventionprimary-preventionsecondary-preventiontertiary-preventionscreeningdiagnosistreatmentantibioticdoxycyclineamoxicillinceftriaxoneazithromycinprophylaxispost-exposure-prophylaxisvaccineLyme-disease-vaccinetick-vaccineanti-tick-vaccinetarget-of-acquired-immunitytick-salivasalivary-glandsalivary-proteinimmunomodulationimmunosuppressionanti-inflammatoryanticoagulantvasodilatoranestheticcement-conetick-attachmentfeeding-lesiontick-bitetick-borne-encephalitisTBEPowassan-virusdeer-tick-virusHeartland-virusBourbon-virusColorado-tick-feverRocky-Mountain-spotted-feverRMSFehrlichiosisanaplasmosisbabesiosistheileriosiscytauxzoonosishepatozoonosistick-paralysistick-toxicosisalpha-gal-syndromered-meat-allergygalactose-alpha-1,3-galactosesensitizationIgEallergic-reactionanaphylaxisdelayed-hypersensitivityimmediate-hypersensitivityimmune-responseinnate-immunityadaptive-immunityhumoral-immunitycell-mediated-immunityantibodycomplementcytokinechemokineinflammationfeverrasherythema-migransbulls-eye-rashSTARISouthern-tick-associated-rash-illnessBorrelia-lonestarirelapsing-fevertick-borne-relapsing-feverTBRFsoft-tickOrnithodorosArgasAmblyommaDermacentorHaemaphysalisRhipicephalusHyalommaBothriocrotonCosmiommaNosommaAnomalohimalayaArchaeocrotonCornupalpatumCompluriscutulaSternalixodesTrichotoixodesScaphixodesEndopalpigerEschariopalpigerExopalpigerPholeoixodesAfrixodesCeratixodesEschatocephalusEternalixodesLepidixodesMalayixodesMartaregaMegalixodesMyrmixodesNothoixodesOctoixodesPalpigerPartipalpigerPilonyssusProknekaliaPseudixodesRhinixodesSamarixodesXiphixodessubgenusspecies-groupI.-ricinus-complexI.-persulcatus-complexI.-scapularis-complexI.-pacificus-complexI.-affinis-groupI.-cookei-groupI.-marxi-groupI.-angustus-groupI.-soricis-groupI.-uriae-groupI.-holocyclus-groupI.-ceylonensis-groupI.-granulatus-groupI.-ovatus-groupI.-nipponensis-groupI.-persulcatus-groupI.-pavlovskyi-groupI.-ricinus-groupI.-scapularis-groupI.-pacificus-groupI.-affinisI.-auritulusI.-australiensisI.-boliviensisI.-brunneusI.-cookeiI.-cooleyiI.-cornuaeI.-cornuatusI.-crenulatusI.-damminiI.-dawsoniI.-dentatusI.-diomedeaeI.-domergueiI.-eadsiI.-eastoniI.-eldaricusI.-elongatusI.-eudyptidisI.-euplectropiI.-evansiI.-fecialisI.-festaiI.-frontalisI.-galapagoensisI.-ghilaroviI.-gibbosusI.-granulatusI.-gregsoniI.-hearleiI.-hexagonusI.-hirstiI.-holocyclusI.-hoogstraaliI.-howelliI.-hyattiI.-jacksoniI.-jellisoniI.-kashmiricusI.-kazakstaniI.-kingiI.-kohlsiI.-kopsteiniI.-kuntziI.-laguriI.-latusI.-layingensisI.-lewisiI.-lividusI.-longiscutatusI.-loricatusI.-luciaeI.-malayensisI.-marxiI.-masloviI.-matopiI.-minorI.-monospinosusI.-moreliI.-moschiferiI.-murisI.-murreletiI.-myospalacisI.-nchisiensisI.-necromysI.-neitziI.-nipponensisI.-nuttalliI.-ochotonaeI.-okapiaeI.-oldiI.-ornithorhynchiI.-ovatusI.-pacificusI.-pararicinusI.-pavlovskyiI.-percavatusI.-peromysciI.-persulcatusI.-pomerantziI.-pterodromaeI.-quadratusI.-raccoonisI.-rageauiI.-randrianasoloiI.-rasusI.-redikorzeviI.-ricinusI.-rothschildiI.-rotundatusI.-rubicundusI.-rugicollisI.-rugosusI.-sapeloensisI.-sarsiI.-scapularisI.-schillingsiI.-sculptusI.-semenoviI.-soricisI.-spinaeI.-steiniI.-stilesiI.-stromiI.-subterranusI.-tancitariusI.-tanukiI.-tapirusI.-tasmaniI.-tayloriI.-tertiariusI.-texanusI.-theileraeI.-thomasaeI.-tovariI.-transvaalensisI.-triangulicepsI.-trichosuriI.-turdusI.-uriaeI.-vandenbergiI.-vanidicusI.-ventalloiI.-vespertilionisI.-victoriensisI.-walkeraeI.-werneriI.-woodiI.-zaglossiI.-zairensistick-taxonomytick-systematicstick-phylogenytick-evolutiontick-biogeographytick-ecologytick-physiologytick-behaviortick-reproductiontick-developmenttick-nutritiontick-metabolismtick-respirationtick-excretiontick-osmoregulationtick-neurobiologytick-sensory-biologytick-chemoreceptiontick-thermoreceptiontick-mechanoreceptiontick-photoreceptiontick-circadian-rhythmtick-biological-clocktick-seasonalitytick-diapausetick-overwinteringtick-cold-hardinesstick-desiccation-resistancetick-water-balancetick-cuticletick-moltingtick-ecdysistick-growthtick-feedingtick-engorgementtick-blood-mealtick-digestiontick-salivationtick-saliva-compositiontick-salivary-gland-transcriptometick-salivary-proteometick-pharmacologytick-toxicologytick-venomtick-paralysis-toxintick-borne-pathogentick-borne-virustick-borne-bacteriumtick-borne-protozoantick-borne-helminthtick-borne-rickettsiatick-borne-ehrlichiatick-borne-anaplasmatick-borne-borreliatick-borne-babesiatick-borne-theileriatick-borne-hepatozoontick-borne-coxiellatick-borne-francisellatick-borne-bartonellatick-borne-chlamydiatick-borne-mycoplasmatick-borne-spiroplasmatick-borne-arbovirustick-borne-flavivirustick-borne-bunyavirustick-borne-reovirustick-borne-orbivirustick-borne-coltivirustick-borne-nairovirustick-borne-phlebovirustick-borne-thogotovirustick-borne-orthomyxovirustick-borne-arenavirustick-borne-hantavirustick-borne-paramyxovirustick-borne-rhabdovirustick-borne-bornavirustick-borne-filovirustick-borne-coronavirustick-borne-poxvirustick-borne-herpesvirustick-borne-adenovirustick-borne-papillomavirustick-borne-polyomavirustick-borne-circovirustick-borne-parvovirustick-borne-anellovirustick-borne-dependovirustick-borne-tenuivirustick-borne-deltavirustick-borne-hepadnavirustick-borne-retrovirustick-borne-lentivirustick-borne-spumavirustick-borne-metavirustick-borne-pseudovirustick-borne-hemivirustick-borne-novirhabdovirustick-borne-peribunyavirustick-borne-phenuivirustick-borne-bandavirustick-borne-phasivirustick-borne-tulasvirustick-borne-orthonairovirustick-borne-shavivirustick-borne-sathuperi-virustick-borne-salehabad-virustick-borne-dera-ghazi-khan-virustick-borne-hughes-virustick-borne-farallon-virustick-borne-punta-salinas-virustick-borne-sapphire-II-virustick-borne-zirqa-virustick-borne-keterah-virustick-borne-thiafora-virustick-borne-erve-virustick-borne-malsoor-virustick-borne-tibet-virustick-borne-qalyub-virustick-borne-yogue-virustick-borne-kasokero-virustick-borne-lebombo-virustick-borne-nyamanini-virustick-borne-midway-virustick-borne-tokar-virustick-borne-absettarov-virustick-borne-hypr-virustick-borne-kumlinge-virustick-borne-omsk-hemorrhagic-fever-virustick-borne-langat-virustick-borne-louping-ill-virustick-borne-kyasanur-forest-disease-virustick-borne-alkhurma-hemorrhagic-fever-virustick-borne-powassan-virustick-borne-deer-tick-virustick-borne-heartland-virustick-borne-bourbon-virustick-borne-colorado-tick-fever-virustick-borne-eyach-virustick-borne-banna-virustick-borne-seadornavirustick-borne-great-island-virustick-borne-kemerovo-virustick-borne-lipovnik-virustick-borne-tribec-virustick-borne-chobar-gorge-virustick-borne-wad-Medani-virustick-borne-dugbe-virustick-borne-crimean-congo-hemorrhagic-fever-virustick-borne-nairobi-sheep-disease-virustick-borne-ganjam-virustick-borne-bandia-virustick-borne-sierra-nevada-virustick-borne-lone-star-virustick-borne-severe-fever-with-thrombocytopenia-syndrome-virustick-borne-huaiyangshan-virustick-borne-guertu-virustick-borne-Alongshan-virustick-borne-wenzhou-virustick-borne-wuhan-virustick-borne-yongjia-virustick-borne-chiba-virustick-borne-natori-virustick-borne-odawara-virustick-borne-kowloon-virustick-borne-tamanavirusJanbechynea
Janbechynea is a genus of leaf beetles in the family Orsodacnidae, containing at least 12 described species distributed in North America. The genus is named in honor of Czech entomologist Jan Bechyně. Adults of at least one species, J. elongata, are specialized herbivores of cycads. The genus is divided into two subgenera: Janbechynea and Bothroscelis.
Judolia sexspilota
Judolia sexspilota is a species of longhorned beetle (Cerambycidae) in the subfamily Lepturinae, described by John Lawrence LeConte in 1859. The genus Judolia belongs to the tribe Lepturini, a group of flower-visiting longhorned beetles often characterized by relatively short antennae compared to other cerambycids. The specific epithet "sexspilota" refers to six spots, suggesting a distinctive spotted elytral pattern. As a member of the Lepturinae, adults likely visit flowers for pollen and nectar feeding.
Juriniopsis aurifrons
Juriniopsis aurifrons is a species of bristle fly in the family Tachinidae, first described by Brooks in 1949. The species is known from the southwestern United States and Mexico. Like other tachinid flies, it is likely a parasitoid, though specific host records remain undocumented. Adults have been observed visiting flowers, particularly those of rubber rabbitbrush (Ericameria nauseosa).
Kaira alba
pale frilled orbweaver, frilled orbweaver
Kaira alba is an orb-weaving spider in the family Araneidae, commonly known as the pale frilled orbweaver. The species is distributed across the southern United States and Mexico. Like other members of the genus Kaira, it constructs orb-shaped webs for prey capture.
Knullana huachuca
Knullana huachuca is a species of leafhopper in the family Cicadellidae, described by DeLong in 1941. The species epithet references the Huachuca Mountains of southeastern Arizona, where it was originally described. It belongs to the tribe Scaphoideini within the subfamily Deltocephalinae. Records indicate occurrence in Arizona, USA and Mexico.
Labena
Labena is a genus of ichneumon wasps in the family Ichneumonidae, subfamily Labeninae. The genus contains at least 40 described species distributed primarily in the New World. Species have been documented from North America through Central America, including the Yucatán Peninsula. Labena species are associated with wood-boring beetles, with at least one species documented in proximity to the cerambycid Callidiellum rufipenne.
Lachesilla dona
fateful barklouse
Lachesilla dona is a species of barklouse in the family Lachesillidae, described by Sommerman in 1946. It belongs to the order Psocodea, a group of small, soft-bodied insects commonly known as barklice or booklice. The species has been recorded in both Central America and North America.
Lachesilla sulcata
fateful barklouse
Lachesilla sulcata is a species of barklouse described by García-Aldrete in 1986. It belongs to the family Lachesillidae, a group of small, soft-bodied insects commonly known as barklice or booklice. The species has been documented in both Central America and North America, with confirmed records from Mexico and the United States. As with many psocid species, detailed ecological and behavioral information remains limited.
Lachesilla tropica
Lachesilla tropica is a species of barklouse in the family Lachesillidae, described by García-Aldrete in 1982. The species belongs to the order Psocodea, a group of small insects commonly known as barklice or booklice. It has been recorded from the Caribbean Sea region, Central America, and North America, with specific distribution records from Mexico. As a member of Lachesillidae, it is part of a family of free-living barklice typically associated with vegetation and bark habitats.
Lactista elota
Lactista elota is a species of band-winged grasshopper in the family Acrididae, described by Otte in 1984. It belongs to the genus Lactista, which includes other small, desert-adapted grasshoppers such as L. aztecus. The species is recorded from Mexico, though specific details about its biology and appearance remain poorly documented in available literature.
Lactista gibbosa
Lactista gibbosa is a species of band-winged grasshopper in the family Acrididae. The genus Lactista includes small to medium-sized grasshoppers with distinctive wing patterns, typically found in arid and semi-arid regions of the southwestern United States and Mexico. Members of this genus are characterized by their banded hindwings and relatively short flight distances compared to some other grasshopper groups.
Laniifera cyclades
Cactus Moth, Prickly Pear Moth
Laniifera cyclades is a snout moth in the family Crambidae and the sole member of its genus. It is native to Mexico and the southwestern United States. The species is notable for its specialized diet on prickly pear cactuses (Opuntia), which has led to its introduction as a biological control agent in regions where these cactuses are invasive. Adults are active from July to September and have a wingspan of approximately 40 mm.
Lebia balli
Lebia balli is a species of foliage ground beetle in the family Carabidae, described by Reichardt in 1972. The species belongs to the genus Lebia, a group of small, often brightly colored beetles commonly known as colorful foliage ground beetles. Like other members of this genus, L. balli is likely attracted to lights at night. The species is recorded from Mexico.
Lebia bilineata
Lebia bilineata is a species of ground beetle in the family Carabidae, characterized by its distinctive coloration and pattern. It is one of numerous species in the diverse genus Lebia, which are commonly known as colorful foliage ground beetles. The species is found in Mexico and the United States, with records from the southwestern and western regions of the U.S.
Lebia bivittata
Lebia bivittata is a species of ground beetle in the family Carabidae, first described by Fabricius in 1798. It belongs to the subfamily Lebiinae, a group commonly known as colorful foliage ground beetles. The species is recorded from Mexico and the United States. Like other Lebia species, it is likely associated with vegetation where it hunts small invertebrate prey.
Lebia esurialis
Lebia esurialis is a small ground beetle in the family Carabidae. The species is distributed across the southern United States, Mexico, and Caribbean islands including Cuba and the Bahamas. Like other members of the genus Lebia, it is likely attracted to lights at night. The species was described by Casey in 1920.
Lebia histrionica
Lebia histrionica is a small ground beetle in the family Carabidae. The species has been recorded from Arizona in the United States, as well as Mexico and Guatemala. Like other members of the genus Lebia, it likely exhibits bright metallic coloration on its wing covers.
Lebia miranda
Lebia miranda is a small ground beetle in the family Carabidae, subfamily Lebiinae. The genus Lebia comprises colorful foliage ground beetles known for their often bright metallic wing covers. This species is found in North America, with records from the United States and Mexico.
Lebia scalpta
Lebia scalpta is a species of foliage ground beetle in the family Carabidae, first described by Henry Walter Bates in 1883. It is one of numerous small, often brightly colored species in the genus Lebia. The species is known from both Central America and North America, with records from Mexico and the United States. Like other members of its genus, it is likely nocturnal and attracted to artificial light sources.
Lebia scapula
Lebia scapula is a species of foliage ground beetle in the family Carabidae, first described by George Henry Horn in 1885. The genus Lebia comprises relatively small, often brightly colored beetles that are attracted to lights at night. This species is known from North America, with records from the United States and Mexico.
Lebia subgrandis
Lebia subgrandis is a ground beetle in the family Carabidae, native to Mexico and found in North America. This species has been investigated as a potential biological control agent for the Colorado Potato Beetle (Leptinotarsa decemlineata). Adults are generalist predators of CPB eggs and early instar larvae, while first instar larvae are specialized ectoparasites of CPB prepupae and pupae. The species exhibits a notably narrow host range, refusing alternative prey even when starved.
Lebia viridis
colorful foliage ground beetle
Lebia viridis is a predatory ground beetle in the family Carabidae, recognized for its small size and bright metallic coloration. Adults measure 5–7 mm in length and are diurnal, often found on flowers and vegetation. The species occurs across North America, extending south through Mexico and Guatemala, with populations also recorded on Cuba. It is sometimes attracted to lights at night.
Leioscyta pallidipennis
Leioscyta pallidipennis is a treehopper species (Family Membracidae) described by Stål in 1869. The genus Leioscyta belongs to the tribe Membracini within the subfamily Membracinae. Distribution records indicate occurrence in Arizona (USA) and the Mexican states of Morelos and Puebla. As a member of Membracidae, this species possesses the characteristic enlarged pronotum that extends over the body, though specific morphological details for this species are not well documented in available sources.
Lepidanthrax angulus
Lepidanthrax angulus is a species of bee fly in the family Bombyliidae. It was described by Osten Sacken in 1886. The species occurs in the southwestern United States and Mexico. As with other bee flies, adults are likely nectar feeders, though specific biological details remain poorly documented.
Lepidanthrax californicus
Lepidanthrax californicus is a species of bee fly in the family Bombyliidae, first described by Hall in 1976. It is endemic to the southwestern United States and adjacent Mexico, with confirmed records from California, Arizona, and Baja California Norte. Bee flies in this family are typically characterized by their robust, hairy bodies and long proboscises adapted for nectar feeding. The species belongs to the subfamily Anthracinae and tribe Villini, a group whose members often exhibit striking coloration and patterns.
Lepidanthrax disjunctus
Lepidanthrax disjunctus is a species of bee fly in the family Bombyliidae. The species is documented from Mexico and the U.S. state of Arizona. Bee flies in this family are typically characterized by their resemblance to bees and their parasitic or predatory larval life histories, though specific biological details for this species remain limited.
Lepidocnemeplatia sericea
Lepidocnemeplatia sericea is a darkling beetle species in the family Tenebrionidae, first described by Horn in 1870. The species has been recorded from Mexico and Hawaii, with iNaturalist documenting 32 observations. As a member of the Tenebrionidae, it belongs to a large family of beetles commonly known as darkling beetles, which are predominantly detritivores and are particularly diverse in arid and semi-arid environments.
Leptinotarsa haldemani
Haldeman's green potato beetle
Leptinotarsa haldemani, commonly known as Haldeman's green potato beetle, is a small leaf beetle in the family Chrysomelidae. It is named after 19th-century American entomologist Samuel Stehman Haldeman. The species is distinguished by its glossy metallic green elytra, black head, and black appendages. It feeds primarily on wild Solanaceae species and is occasionally found on cultivated potatoes.
Leptoglossus jacquelinae
Leptoglossus jacquelinae is a species of leaf-footed bug in the family Coreidae, described by Brailovsky in 1976. It belongs to a genus characterized by expanded, leaf-like hind tibiae. The species is known from Mexico and Middle America. Like other members of its genus, it is presumed to be a plant-feeding true bug with piercing-sucking mouthparts, though specific details of its biology remain poorly documented.
Leptoglossus oppositus
leaf-footed bug
Leptoglossus oppositus is a leaf-footed bug in the family Coreidae, distinguished from similar species by deeper scallops on the leaf-like hind tibiae and three white spots across the hemelytra. It is widely distributed across eastern and central North America, from New York south to Florida and west to Iowa, Minnesota, and the southwestern United States into Mexico. The species feeds on a broad range of host plants including corn, cotton, squash, tomatoes, oaks, maples, conifers, and other trees, vines, and shrubs.
Lepturges yucca
Lepturges yucca is a species of longhorn beetle in the family Cerambycidae, subfamily Lamiinae, described by Schaeffer in 1905. The specific epithet "yucca" suggests a possible association with Yucca plants, though this relationship requires verification. The species belongs to the tribe Acanthocinini, a group of small to medium-sized longhorn beetles often associated with woody vegetation.
Lerina
Lerina is a monotypic genus of lichen moths in the family Erebidae, subfamily Arctiinae, tribe Lithosiini. The genus contains a single species, Lerina incarnata, commonly known as the crimson-bodied lichen moth. This moth is native to arid regions of southwestern North America, specifically Mexico and southern Arizona. The genus was established by Francis Walker in 1854.
Lerina incarnata
crimson-bodied lichen moth
Lerina incarnata, the crimson-bodied lichen moth, is the sole member of the monotypic genus Lerina. The species was first described by Francis Walker in 1854. It belongs to the family Erebidae, subfamily Arctiinae (tiger and lichen moths), and tribe Lithosiini (lichen moths). The species is found in Mexico and southern Arizona.
Lidopus heidemanni
jumping tree bug
Lidopus heidemanni is a species of plant bug in the family Miridae, commonly referred to as a jumping tree bug. It was described by E. Gibson in 1917. The species occurs in parts of North America and Central America, with documented records from the United States and Mexico.
Liometopum apiculatum
Escamolera Ant, Velvet Tree Ant
Liometopum apiculatum is a Neotropical dolichoderine ant with significant ecological and economic importance. Colonies are large and polydomous, ranging from a few hundred to hundreds of thousands of workers. The species is notable for its distinctive carton-like nest construction and its role as a traditional food source in Mexico, where the larvae and pupae (escamoles) are harvested. It inhabits diverse arid and semi-arid vegetation types across southwestern North America.
Liriomyza marginalis
Liriomyza marginalis is a species of leafminer fly in the family Agromyzidae, first described by Malloch in 1913. It has been recorded in the United States, West Indies, Brazil, and Mexico. A 2021 study documented it as a new record associated with maize crops in Mexico, marking the first known agricultural association for this species. Like other members of the genus Liriomyza, the larvae likely feed within leaf tissue, though specific morphological and behavioral details remain poorly documented.
Lissohypnus texanus
Lissohypnus texanus is a rove beetle (family Staphylinidae) described by Casey in 1906. It belongs to the tribe Xantholinini within the subfamily Staphylininae. The species is known from scattered records in the southern United States and Mexico. Like other staphylinids, it likely inhabits moist terrestrial environments where it functions as a predator or scavenger, though specific ecological details remain poorly documented.
Listrochelus disparilis
Listrochelus disparilis is a scarab beetle in the family Scarabaeidae, subfamily Melolonthinae. It was described by Horn in 1878 and occurs in the southwestern United States and northern Mexico. The species belongs to the tribe Rhizotrogini, which includes many root-feeding scarabs commonly known as May beetles or June beetles.
Listrochelus granti
Listrochelus granti is a scarab beetle in the family Scarabaeidae, subfamily Melolonthinae, described by Saylor in 1940. The species belongs to the genus Listrochelus, a group of rhizotrogine chafers. It has been recorded from the southwestern United States and northwestern Mexico.
Listrochelus huachuca
Listrochelus huachuca is a scarab beetle species in the family Scarabaeidae, subfamily Melolonthinae, described by Saylor in 1940. The species is named for the Huachuca Mountains of southeastern Arizona, where it has been collected. It belongs to a genus of rhizotrogine scarabs whose larvae typically develop in soil and feed on plant roots.
Listrochelus juvenilis
Listrochelus juvenilis is a species of scarab beetle in the family Scarabaeidae, subfamily Melolonthinae, described by Fall in 1932. It belongs to a genus of beetles commonly known as May beetles or June beetles. The species has a limited documented distribution in the southwestern United States and northwestern Mexico.
Listrochelus snowi
Listrochelus snowi is a scarab beetle in the family Scarabaeidae, subfamily Melolonthinae. The species was described by Saylor in 1940 and is native to the southwestern United States and northwestern Mexico. It belongs to a genus of scarabs commonly known as May beetles or June beetles, though specific biological details for this species remain poorly documented in the available literature.
Listrochelus texensis
Listrochelus texensis is a species of scarab beetle in the subfamily Melolonthinae, described by Saylor in 1940. It is known from southern Texas and northeastern Mexico. As a member of the Rhizotrogini tribe, it likely exhibits root-feeding habits in larval stages typical of related taxa, though specific ecological studies remain limited.
Litaneutria ocularis
Obscure Ground Mantis
Litaneutria ocularis is a small ground-dwelling mantis species found in arid regions of the southwestern United States and Mexico. Unlike most mantids that employ ambush predation from vegetation, this species has adopted a cursorial strategy, actively running down prey on the ground. It belongs to a small group of ground mantids in the genera Litaneutria and Yersiniops that have evolved this active hunting behavior in response to open grassland and desert habitats.
Lithurgopsis apicalis
orange-tipped woodborer
Lithurgopsis apicalis is a solitary woodborer bee in the family Megachilidae, commonly known as the orange-tipped woodborer. Adults are active pollinators that visit flowers of several plant families, particularly Cactaceae, Malvaceae, and Asteraceae. The species nests in the hollow stalks of Agave plants, where females excavate tunnels and provision cells with pollen. It occurs across the southwestern United States and Mexico.
Lobometopon fusiforme
Lobometopon fusiforme is a species of darkling beetle in the family Tenebrionidae. It was originally described by Casey in 1890 under the genus Epitragus and later transferred to Lobometopon. The species is known from Mexico and is represented by a small number of observations. Its taxonomic status is marked as doubtful in some databases, suggesting potential issues with classification or identification.
Lochmaeocles marmoratus
Southwestern Marbled Longhorn
Lochmaeocles marmoratus is a longhorn beetle (family Cerambycidae) described by Casey in 1913. It occurs in the southwestern United States and Mexico. As a member of the tribe Onciderini, it is likely associated with woody host plants, though specific details for this species remain limited. The species epithet 'marmoratus' refers to a marbled appearance.
Lophocampa pura
Lophocampa pura is a moth species in the family Erebidae, first described by Berthold Neumoegen in 1882. The species occurs in the southwestern United States and northern Mexico, with documented records from Arizona, New Mexico, Texas, and adjacent Mexican states. As a member of the genus Lophocampa, it belongs to a group commonly known as tussock moths, though specific ecological details for this species remain limited in published literature.
Loxa
Loxa is a genus of shield bugs in the family Pentatomidae, tribe Pentatomini. Species in this genus are distributed primarily in Central America and Mexico, with records extending into Texas, Florida, and South America. Some species, particularly Loxa deducta, are recognized as minor crop pests. The genus shares morphological similarities with Chlorocorini genera including Chlorocoris, Chloropepla, Mayrinia, and Fecelia.
Loxomorpha
Loxomorpha is a genus of moths in the family Crambidae (order Lepidoptera). The genus contains at least four recognized species, including L. flavidissimalis, a known pest of cultivated cactus. The genus was established by Hoshide in 1988, though Amsel (1956) is also cited as an authority. Species in this genus are distributed in the Americas, with records from North America to Mexico.
Loxomorpha flavidissimalis
Cactus Webworm
Loxomorpha flavidissimalis, commonly known as the Cactus Webworm, is a moth species in the family Crambidae. First described by Grote in 1878, it is distributed across the southern United States, Mexico, Puerto Rico, and has been introduced to Australia. The species is notable for its specialized association with Opuntia cacti, with larvae feeding internally on host tissues. It has potential economic significance as a pest of cultivated cactus crops.
Loxosceles apachea
Apache Recluse
Loxosceles apachea, the Apache recluse, is a species of recluse spider in the family Sicariidae. It is found in the southwestern United States and Mexico. Like other recluse spiders, it possesses cytotoxic venom that can cause necrotic lesions in rare cases, though bites are uncommon and typically occur only when the spider is trapped against skin. The species is poorly studied compared to the more widespread brown recluse (L. reclusa).
Lucaina greeni
Lucaina greeni is a net-winged beetle in the family Lycidae, described in 2018 from Mexico. It belongs to a genus of beetles characterized by soft bodies and elytra with distinctive reticulate venation. The species is known from limited collection records.
Lygistopterus perfacetus
Lygistopterus perfacetus is a species of net-winged beetle in the family Lycidae. Members of this genus are characterized by their soft, flexible elytra and often bright coloration. The species is known from the southwestern United States and northern Mexico. Like other lycids, adults are typically found in association with flowers or vegetation and are thought to be mimics of other chemically defended insects.
Lygus hesperus
Western Tarnished Plant Bug
Lygus hesperus is a significant agricultural pest in western North America, causing extensive damage to cotton, strawberries, alfalfa seed, and other crops. In California alone, annual losses exceed $30 million in cotton and $40 million in strawberries. Adults overwinter in reproductive diapause triggered by short day lengths, resuming activity when conditions improve. The species has been the subject of extensive research on sampling methods, biological control, and insecticide resistance.
agricultural-pestplant-bugMiridaecotton-peststrawberry-pestalfalfa-pestwestern-North-Americadiapausebiological-controlintegrated-pest-managementinsecticide-resistancemark-release-recapturesalivary-enzymesextraoral-digestionPeristenus-relictusHippodamia-convergensdrone-samplingfluorescent-markingSmartWatervectorPantoea-ananatisSerratiapotassium-chloridedeterrentartificial-dietlentilseed-cropsCaliforniaTexasArizonaNevadaWashingtonMexicopolyphagousphytophagousstylet-probingscutellumnymph-spotseconomic-entomologyorganic-agricultureecosystem-servicesbird-predationmolecular-gut-analysisELISAimmunomarkingparasitoidpopulation-suppressioncrop-protectionsampling-protocolssweep-netdrop-clothY-tube-olfactometergustatory-deterrentvisual-cuesvolatile-cuesreproductive-diapausepostdiapauseoogenesisovipositionlongevitybody-masslife-historymass-spectrometrysalivary-proteinspolygalacturonaseα-amylaseproteaselaccaseglucose-dehydrogenasexanthine-dehydrogenaseplant-defensehost-pathogen-interactioniDrone-BeeUAVunmanned-aerial-vehicleopen-sourcefield-scoutingIPMeconomic-thresholdBt-cottonnatural-enemyconservation-biological-controllandscape-ecologyhabitat-managementweed-managementborder-spraysspot-treatmentselective-insecticideneonicotinoidpyrethroidresistance-managementsustainable-agriculturefood-securityeconomic-impactsimulation-modelpopulation-dynamicsimmigrationparasitismaverted-lossvalue-losscost-benefitresearch-methodologyinsect-markingdispersalfluorophoreautofluorescencesurvivorshipmortalitymark-transfercrowdingolfactometerfeeding-behaviorno-choice-assaychoice-assaygustationhost-selectionplant-qualitysucculent-growthfruiting-structuressquarebollbloomterminaldefoliationstand-lossdirty-bloompuckered-petalslesioncarpel-walllint-damageseed-damageyield-lossfiber-qualitymanagement-thresholdscouting-intervalaction-thresholdtreatment-timinginsecticide-efficacylabeled-ratedifficult-to-controlspecies-complexidentification-keymorphologycolor-variationwing-developmentantennaethoraxabdomeninstardevelopmental-stagelaboratory-rearingoligidic-dietsemisolid-slurrychicken-eggsoybeanwheat-germlima-beancost-reductionbiomass-productionsurvivalfecundityegg-productiongeneration-timepopulation-growthlog-phasecolony-maintenancegenetic-diversityfield-collectionadaptationstress-toleranceoxidative-stresstemperature-extremefood-deficitresource-allocationreproductive-senescenceendogenous-reservesenvironmental-stressorclimate-adaptationphenologymigrationdispersal-patternhabitat-patchsource-sinkpopulation-sourcepopulation-sinkcrop-borderfield-edgenon-crop-habitatrefugeoverwintering-sitespring-emergencesummer-populationfall-populationdensity-dependenceaggregationspatial-distributionsampling-accuracypest-detectionmonitoring-technologyprecision-agriculturedigital-agricultureautomationroboticsmachine-learningcomputer-visionsensor-technologydata-collectiondecision-supportgrower-educationextensionstakeholder-engagementmultidisciplinary-researchacademia-industry-collaborationsustainable-intensificationagroecosystemfood-systemplant-insect-interactioninsect-plant-coevolutionsalivary-secretiondigestive-enzymelytic-enzymetissue-macerationfeeding-injuryphysiological-damagemechanical-damagewound-responseplant-defense-responseinduced-resistancesystemic-acquired-resistancejasmonic-acidethylenesalicylic-acidsecondary-metabolitephenolic-compoundoxidative-enzymeredox-enzymebacterial-transmissionphytopathogenopportunistic-pathogeninfection-courtinoculumdisease-vectorepidemiologycrop-hygienesanitationcrop-rotationcover-croptrap-croppush-pullhabitat-manipulationconservation-biocontrolaugmentative-biocontrolclassical-biocontrolimportationestablishmentnon-target-effecthost-specificityparasitoid-biologyreproductive-parasitoididiobiontkoinobiontmummy-formationemergence-rateparasitoid-impactpopulation-regulationtop-down-controlbottom-up-controltrophic-cascadefood-webecosystem-functionecosystem-servicedisservicenet-effectrisk-assessmentmanagement-strategypolicyregulationpesticide-registrationresistance-monitoringstewardshipintegrated-resistance-managementIRMrefuge-strategypyramid-strategymultiple-toxinstransgenic-cropGMObiosafetyenvironmental-impactnon-target-organismpollinator-protectionbeneficial-insectnatural-enemy-conservationfloral-resourcenectarpollenalternative-preyhabitat-diversificationagri-environment-schemegreen-infrastructureecological-compensationlandscape-complexityconnectivitymatrix-qualityspilloversource-habitatecological-trappopulation-viabilityextinction-riskinvasion-biologyrange-expansionclimate-changewarmingdroughtirrigationwater-stressnitrogen-fertilizationcrop-vigorplant-nutritionhost-plant-qualitytritrophic-interactionplant-microbe-insectendosymbiontgut-microbiomesalivary-microbiomevector-competencetransmission-efficiencyacquisitioninoculationretentionmultiplicationcirculativenon-circulativepersistentnon-persistentpropagativestylet-borneforegut-bornehemolymph-bornesalivary-gland-bornereplicationbarriermidgutsalivary-glandescapeinfectionincubationlatent-periodinoculation-thresholdtransmission-thresholdepidemicepiphytoticdisease-trianglesusceptible-hostvirulent-pathogenfavorable-environmentdisease-cycleprimary-inoculumsecondary-inoculumoverwintering-pathogensurvival-structuredisease-reservoiralternative-hostvolunteer-cropweed-reservoircrop-residuesoilborneseedborneinsect-bornemanagement-tacticpreventivecurativeeradicativesuppressiveprotectantsystemiccontacttranslaminarfumigantbiological-pesticidemicrobial-pesticideentomopathogenic-fungusentomopathogenic-nematodeentomopathogenic-virusbaculovirusgranulovirusnucleopolyhedrovirusbacteriaBacillus-thuringiensisBt-toxincrystal-proteincytolytic-proteinvegetative-insecticidal-proteinmode-of-actiongut-paralysissepticemiatoxemiaantibioticsymbiontantibiotic-resistancefitness-costresistance-alleleresistance-mechanismmetabolic-resistancetarget-site-resistancepenetration-resistancebehavioral-resistancecross-resistancemultiple-resistanceresistance-evolutionselection-pressuredose-responselethal-concentrationlethal-dosemedian-lethal-concentrationmedian-lethal-doseconfidence-intervalprobit-analysislogit-analysisdose-mortalitytime-mortalityresistance-ratioresistance-factordiagnostic-dosediscriminating-dosebaseline-susceptibilitysusceptible-strainreference-strainfield-populationresistant-populationhomozygous-resistantheterozygousdominancerecessiveincomplete-dominancegene-frequencyallele-frequencyselection-coefficientfitnessrelative-fitnesspopulation-geneticsquantitative-geneticsheritabilitygenetic-correlationbreeding-valuegenetic-gainmarker-assisted-selectiongenomic-selectiontranscriptomicsproteomicsmetabolomicsgenomicsfunctional-genomicscomparative-genomicsevolutionary-genomicspopulation-genomicsphylogenomicsbioinformaticscomputational-biologysystems-biologynetwork-analysispathway-analysisgene-ontologyprotein-protein-interactionsignal-transductionhormonejuvenile-hormoneecdysoneinsulin-like-peptideneuropeptidepheromonesex-pheromoneaggregation-pheromonealarm-pheromonetrail-pheromonekairomoneallomonesynomonesemiochemicalolfactionmechanoreceptionvisionphototaxischemotaxisanemotaxisthermotaxishygrotaxisgeotaxiskinesistaxisorthokinesisklinokinesisrheotaxisthigmotaxiscontact-chemoreceptionolfactory-receptorgustatory-receptorionotropic-receptorodorant-binding-proteinchemosensory-proteinsensillumsensory-neuronantennal-lobemushroom-bodylateral-horncentral-complexoptical-lobecompound-eyeocellussimple-eyephotoreceptorrhabdomommatidiumfacetvisual-acuitymotion-detectionpolarized-light-detectioncolor-visionultraviolet-visioninfrared-detectionthermoreceptionhygroreceptionmechanoreceptorchordotonal-organcampaniform-sensillumtrichoid-sensillumbasiconic-sensillumcoeloconic-sensillumplacoid-sensillumsensory-ecologyforaging-behaviorhost-locationhost-acceptancehost-suitabilityoviposition-preferenceoviposition-deterrenceantixenosisantibiosistoleranceresistance-categorygall-midgehessian-flygene-for-geneavirulence-generesistance-geneR-geneeffector-triggered-immunitypattern-triggered-immunitypathogen-associated-molecular-patterndamage-associated-molecular-patternmicrobe-associated-molecular-patternrecognitionperceptiondefense-responsehypersensitive-responsecell-deathprogrammed-cell-deathautophagynecrosisoxidative-burstreactive-oxygen-speciesnitric-oxidecalcium-signalingmitogen-activated-protein-kinasetranscription-factordefense-genepathogenesis-related-proteinantimicrobial-peptidephytoalexinligninsuberincallosepapillacell-wall-reinforcementhypersensitive-cell-deathinduced-systemic-resistanceprimingdefense-elicitorplant-activatorbiostimulantplant-strengthenerorganic-amendmentcompostmanurebiocharvermicompostcompost-teamicrobial-inoculantplant-growth-promoting-rhizobacteriamycorrhizal-fungusendophyteepiphytephytosphererhizospherephyllospherespermosphereanthroposphereecosystem-processnutrient-cyclingcarbon-sequestrationnitrogen-fixationphosphorus-solubilizationpotassium-mobilizationmicronutrient-availabilitysoil-structurewater-infiltrationwater-holding-capacityerosion-controlpollinationpest-suppressiondisease-suppressionweed-suppressiondecompositiondetritivorypredationherbivorymutualismcommensalismcompetitionfacilitationinhibitionamensalismneutralismsymbiosisantagonismtrophic-interactionfood-chainenergy-flowmaterial-cyclingbiomass-pyramidtrophic-pyramidecological-efficiencyproduction-efficiencyassimilation-efficiencyecological-footprintsustainabilityresilienceresistanceadaptabilitytransformabilitysocio-ecological-systemadaptive-managementparticipatory-researchcitizen-scienceknowledge-co-productiontransdisciplinary-researchinterdisciplinary-researchdisciplinary-researchbasic-researchapplied-researchdevelopment-researchaction-researchparticipatory-action-researchfarmer-participatory-researchon-farm-researchstation-researchcontrolled-experimentfield-experimentobservational-studycorrelational-studymanipulative-experimentnatural-experimentquasi-experimentlongitudinal-studycross-sectional-studycase-studycomparative-studymeta-analysissystematic-reviewscoping-reviewrapid-reviewliving-reviewevidence-synthesisknowledge-synthesisresearch-synthesissystematic-mapbibliometric-analysiscitation-analysisco-citation-analysisbibliographic-couplingkeyword-analysistopic-modelingscience-mappingresearch-frontemerging-topichot-topicresearch-gapfuture-directionresearch-priorityresearch-agendastrategic-researchmission-oriented-researchsocietal-challengesustainable-development-goalnutrition-securityclimate-smart-agricultureclimate-resilient-agriculturelow-input-agricultureregenerative-agricultureagroecologyintegrated-farmingmixed-farmingdiversified-farmingspecialized-farmingintensive-farmingextensive-farmingconventional-farmingalternative-farmingurban-agricultureperi-urban-agriculturerural-agriculturesmallholder-agriculturelarge-scale-agriculturefamily-farmingcorporate-farmingcontract-farmingtenant-farmingsubsistence-farmingcommercial-farmingexport-oriented-farmingimport-substituting-farminglocal-food-systemglobal-food-systemfood-value-chainsupply-chainvalue-chaincommodity-chainagribusinessagrifood-systemfood-processingfood-distributionfood-retailfood-servicefood-consumptionfood-wastefood-losspost-harvest-lossstorage-lossprocessing-lossdistribution-lossretail-lossconsumer-wasteplate-wastekitchen-wastefood-rescuefood-recoveryfood-redistributionfood-bankingcompostinganaerobic-digestionbioenergybiofuelbioproductbiomaterialbiorefinerycircular-economycircular-bioeconomygreen-economyblue-economybioeconomynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationclimate-mitigationdisaster-risk-reductionextreme-eventfloodheat-wavecold-snapfrosthailwindstormtornadohurricanetyphooncyclonestorm-surgesea-level-risesalinizationdesertificationland-degradationsoil-degradationsoil-erosionsoil-compactionsoil-sealingsoil-contaminationsoil-pollutionheavy-metalpersistent-organic-pollutantpesticide-residueantibiotic-residuehormone-residueplastic-pollutionmicroplasticnanoplasticparticulate-matterair-pollutionwater-pollutiongroundwater-pollutionsurface-water-pollutioneutrophicationhypoxiadead-zonebiodiversity-losshabitat-losshabitat-fragmentationhabitat-degradationhabitat-destructioninvasive-speciesintroduced-speciesalien-speciesnon-native-speciesexotic-speciesnaturalized-speciescasual-speciesescaped-speciescultivated-speciesornamental-speciespet-specieslivestockpoultryaquaculturefisherycapture-fisherymarine-fisheryfreshwater-fisheryinland-fisheryrecreational-fisherysubsistence-fisheryartisanal-fisheryindustrial-fisheryoverfishingbycatchdiscardsghost-fishingfishing-gearfishing-methodfishing-effortfishing-capacityfishing-pressurestock-assessmentfishery-managementmarine-protected-areano-take-zonemarine-reserveterrestrial-protected-areanational-parknature-reservewildlife-sanctuarybiosphere-reserveworld-heritage-siteramsar-siteimportant-bird-areakey-biodiversity-areaecological-networkprotected-area-networkconservation-corridorwildlife-corridorhabitat-corridorstepping-stonebuffer-zonetransition-zonecore-zonemanagement-zonesustainable-use-zonerestoration-zonerehabilitation-zonereclamation-zoneremediation-zonecontainment-zoneeradication-zonesurveillance-zonemonitoring-zonequarantine-zonebiosecurityphytosanitaryveterinaryanimal-healthplant-healthone-healthecohealthplanetary-healthglobal-healthpublic-healthenvironmental-healthoccupational-healthfood-safetyfeed-safetywater-safetyair-qualityenvironmental-qualityenvironmental-monitoringenvironmental-assessmentenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmenthazard-assessmentexposure-assessmentdose-response-assessmentrisk-characterizationrisk-managementrisk-communicationrisk-perceptionrisk-governanceprecautionary-principlepolluter-pays-principleuser-pays-principleextended-producer-responsibilitycorporate-social-responsibilityenvironmental-stewardshipsustainable-livelihoodsustainable-consumptionsustainable-productiongreen-procurementgreen-supply-chaingreen-logisticsgreen-manufacturinggreen-chemistrygreen-technologyclean-technologyenvironmental-technologypollution-preventionwaste-minimizationresource-efficiencyenergy-efficiencywater-efficiencymaterial-efficiencyland-use-efficiencynutrient-use-efficiencynitrogen-use-efficiencyphosphorus-use-efficiencypotassium-use-efficiencymicronutrient-use-efficiencyfertilizer-use-efficiencypesticide-use-efficiencywater-productivityland-productivitylabor-productivitycapital-productivitytotal-factor-productivitypartial-factor-productivityagricultural-productivitycrop-productivitylivestock-productivityfishery-productivityforestry-productivityeconomic-productivitysocial-productivityenvironmental-productivityecological-productivitybiological-productivityprimary-productivitysecondary-productivitynet-primary-productivitygross-primary-productivityecosystem-productivitylandscape-productivityregional-productivityglobal-productivitycarbon-productivitynitrogen-productivitywater-footprintcarbon-footprintnitrogen-footprintphosphorus-footprintbiodiversity-footprintmaterial-footprintland-footprintenergy-footprintemission-factorintensity-factordecouplingabsolute-decouplingrelative-decouplingresource-decouplingimpact-decouplingdematerializationrematerializationtransmaterializationsubstitutioncomplementaritytrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theoryprisoner's-dilemmatragedy-of-the-commonscollective-actioncommon-pool-resourcepublic-goodprivate-goodclub-goodcommon-goodglobal-commonglobal-public-goodtipping-pointcritical-transitionregime-shifthysteresisirreversibilitypath-dependencelock-intechnological-lock-ininstitutional-lock-inbehavioral-lock-insocial-ecological-trappoverty-trapdegradation-trapdevelopment-trapcomplex-adaptive-systemsocial-ecological-systemcoupled-human-natural-systemhuman-environment-systemadaptive-capacitytransformative-capacitylearning-capacityinnovation-capacitygovernance-capacityinstitutional-capacityorganizational-capacityindividual-capacitycommunity-capacitysocial-capitalhuman-capitalnatural-capitalphysical-capitalfinancial-capitalbuilt-capitalcultural-capitalpolitical-capitalintellectual-capitalknowledge-capitalinformation-capitaldata-capitaldigital-capitaltechnological-capitalinfrastructural-capitalinstitutional-capitalorganizational-capitalnetwork-capitalrelationship-capitalreputational-capitalbrand-capitalsymbolic-capitalexistential-capitalspiritual-capitalreligious-capitalmoral-capitalethical-capitaltrust-capitalreciprocity-capitalsolidarity-capitalcooperation-capitalcoordination-capitalcollaboration-capitalcommunication-capitalinformation-sharingknowledge-sharinglearninginnovationexperimentationtransformationtransitionchangeevolutiondevelopmentgrowthprogressimprovementenhancementoptimizationmaximizationminimizationsatisfactionsufficiencyabundancescarcitysecurityinsecurityvulnerabilityrobustnessstabilityinstabilityequilibriumdisequilibriumhomeostasisallostasisstressdistresseustresscopingcoping-capacitycoping-strategycoping-mechanismcoping-resourcecoping-supportsocial-supportemotional-supportinstrumental-supportinformational-supportappraisal-supportnetwork-supportcommunity-supportinstitutional-supportpolicy-supportfinancial-supporttechnical-supporttechnological-supportinfrastructural-supportcapacity-buildingcapacity-developmentcapacity-strengtheningempowermentenablementmobilizationactivationengagementparticipationinvolvementinclusionexclusionmarginalizationdiscriminationinequityinequalitydisparitygapdividedigital-divideknowledge-divideinformation-dividescience-divideresearch-divideinnovation-dividetechnology-dividedevelopment-dividenorth-south-divideeast-west-divideurban-rural-dividegender-divideage-divideclass-divideincome-dividewealth-divideasset-divideopportunity-divideoutcome-dividewellbeing-dividehappiness-dividelife-satisfaction-dividehealth-divideeducation-divideskill-dividecompetency-dividecapability-dividefunctioning-divideagency-dividefreedom-dividechoice-divideautonomy-divideself-determination-dividedignity-dividerespect-dividerecognition-dividestatus-dividepower-divideinfluence-dividevoice-dividerepresentation-divideparticipation-divideengagement-dividecitizenship-dividebelonging-divideidentity-divideculture-dividevalue-dividebelief-dividenorm-dividepractice-dividebehavior-dividehabit-dividecustom-dividetradition-dividemodernity-divideglobalization-dividelocalization-divideuniversalism-divideparticularism-dividecosmopolitanism-dividenationalism-dividepatriotism-dividepopulism-divideelitism-dividedemocracy-divideauthoritarianism-dividecontrol-dividesecurity-divideliberty-divideprivacy-dividesurveillance-dividetransparency-divideaccountability-divideresponsibility-divideliability-divideguilt-divideblame-dividepunishment-dividereward-divideincentive-dividemotivation-divideintention-divideattention-divideperception-dividecognition-divideemotion-divideaffect-divideattitude-dividepreference-divideinterest-divideneed-dividewant-dividedesire-dividedemand-dividesupply-dividemarket-divideexchange-dividetransaction-dividecontract-divideagreement-dividecooperation-dividecompetition-divideconflict-dividecoercion-divideforce-divideviolence-dividepeace-divideharmony-dividecoexistence-dividetolerance-divideacceptance-dividerejection-divideopposition-divideresistance-divideconformity-dividedeviance-dividenormality-divideabnormality-divideillness-dividedisease-dividedisorder-dividedisability-divideimpairment-dividehandicap-dividecapacity-dividepotential-divideperformance-divideachievement-divideattainment-divideaccomplishment-dividesuccess-dividefailure-divideexcellence-dividemediocrity-divideaverage-dividestandard-dividebenchmark-dividethreshold-divideceiling-dividefloor-dividelimit-divideboundary-divideborder-dividefrontier-dividehorizon-divideperspective-divideviewpoint-dividestandpoint-divideposition-dividestance-divideapproach-dividemethod-dividetechnique-dividetool-divideinstrument-dividedevice-divideapparatus-divideequipment-dividemachine-dividemachinery-dividemechanism-dividesystem-dividestructure-divideorganization-divideinstitution-divideregime-divideorder-dividearrangement-divideconfiguration-dividepattern-dividedesign-divideplan-dividescheme-divideprogram-divideproject-divideinitiative-divideintervention-divideaction-divideactivity-divideoperation-divideprocess-divideprocedure-divideprotocol-divideguideline-dividerecommendation-dividerequirement-divideregulation-dividerule-dividelaw-dividepolicy-dividestrategy-dividetactic-divideobjective-dividegoal-dividetarget-divideaim-dividepurpose-dividemission-dividevision-divideprinciple-divideethic-dividemoral-dividecriterion-divideindicator-dividemeasure-dividemetric-divideindex-dividescale-dividescore-dividerating-divideranking-dividegrade-dividelevel-dividestage-dividephase-dividestep-divideprogression-dividesequence-divideseries-dividesuccession-dividechain-dividecycle-divideloop-dividespiral-dividewave-dividepulse-dividerhythm-dividetempo-dividepace-dividespeed-dividevelocity-divideacceleration-dividedeceleration-dividemomentum-divideinertia-divideenergy-dividework-divideeffort-dividestrain-dividestress-dividepressure-dividetension-dividecompression-divideexpansion-dividecontraction-dividedeformation-dividedistortion-dividetransformation-divideconversion-dividetransduction-dividetransmission-dividetransfer-dividetransport-dividemovement-dividemotion-divideflow-divideflux-dividecurrent-dividestream-divideriver-dividetide-dividewind-dividestorm-divideweather-divideclimate-divideseason-divideyear-dividedecade-dividecentury-dividemillennium-divideepoch-divideera-divideperiod-dividetime-divideduration-divideinterval-dividespan-dividestretch-dividespell-dividebout-divideepisode-divideevent-divideoccurrence-divideincident-divideaccident-dividecoincidence-dividechance-divideluck-dividefortune-dividedestiny-dividefate-dividekarma-dividedharma-dividetao-divideway-dividepath-divideroad-divideroute-dividecourse-dividedirection-divideorientation-dividealignment-dividepositioning-divideplacement-dividelocation-dividesite-divideplace-dividespot-dividepoint-dividesituation-dividecontext-divideenvironment-dividesetting-dividescene-divideplatform-dividebase-dividefoundation-divideground-dividesoil-divideearth-divideland-divideterrain-divideterritory-dividedomain-dividerealm-dividesphere-divideworld-divideglobe-divideplanet-divideuniverse-dividecosmos-dividespace-dividevoid-divideemptiness-dividefullness-divideplenum-dividevacuum-divideatmosphere-divideair-dividegas-dividevapor-dividemist-dividefog-dividecloud-dividerain-dividesnow-divideice-dividefrost-dividedew-dividehumidity-dividemoisture-dividewetness-dividedryness-dividearidity-dividedrought-divideflood-dividedeluge-divideinundation-dividesubmersion-divideimmersion-dividesaturation-dividesupersaturation-dividecondensation-divideevaporation-dividetranspiration-dividesublimation-dividedeposition-divideprecipitation-divideinfiltration-dividepercolation-divideseepage-divideleakage-dividedischarge-dividerunoff-divideerosion-dividesedimentation-divideaccretion-divideaggregation-dividecoagulation-divideflocculation-dividecrystallization-dividesolidification-divideliquefaction-dividevaporization-divideboiling-dividemelting-dividefreezing-dividethawing-dividecooling-divideheating-dividewarming-dividethermal-dividetemperature-divideheat-dividecold-dividecool-dividewarm-dividehot-dividethermodynamic-divideenthalpy-divideentropy-dividefree-energy-divideGibbs-free-energy-divideHelmholtz-free-energy-dividechemical-potential-dividefugacity-dividepartial-pressure-divideconcentration-dividedilution-dividesolution-dividemixture-dividecompound-divideelement-divideatom-dividemolecule-divideion-divideelectron-divideproton-divideneutron-dividenucleus-divideparticle-dividequark-dividelepton-divideboson-dividefermion-dividehadron-dividebaryon-dividemeson-dividephoton-dividegluon-divideweak-boson-divideHiggs-boson-dividestring-dividebrane-dividedimension-dividespace-time-dividecontinuum-dividediscrete-dividequantum-divideclassical-dividerelativistic-divideNewtonian-divideEinsteinian-dividePlanckian-dividecosmological-divideastronomical-dividemicroscopic-dividemacroscopic-dividemesoscopic-dividenanoscopic-divideatomic-dividemolecular-dividecellular-dividetissue-divideorgan-divideorganism-dividepopulation-dividecommunity-divideecosystem-dividebiome-dividebiosphere-divideecosphere-dividenoosphere-dividetechnosphere-divideanthroposphere-dividesociosphere-dividepolitosphere-divideeconosphere-divideculturosphere-dividereligiosphere-divideideosphere-dividememesphere-divideinfosphere-dividecybersphere-dividedigisphere-dividevirtual-divideanalog-dividereal-divideactual-dividepossible-divideimpossible-dividenecessary-dividecontingent-divideprobable-divideimprobable-dividecertain-divideuncertain-dividedeterminate-divideindeterminate-dividedefinite-divideindefinite-dividespecific-dividegeneral-divideparticular-divideuniversal-dividesingular-divideplural-divideindividual-dividecollective-dividesocial-dividecultural-dividehistorical-dividepolitical-divideeconomic-dividereligious-dividephilosophical-dividescientific-dividetechnological-divideartistic-divideliterary-dividemusical-dividevisual-divideperforming-dividecinematic-dividephotographic-dividearchitectural-dividefashion-divideculinary-dividegastronomic-divideolfactory-dividegustatory-dividetactile-dividekinesthetic-divideproprioceptive-dividevestibular-divideauditory-dividesomatosensory-divideinteroceptive-divideexteroceptive-dividemultisensory-dividecrossmodal-dividesynesthetic-divideanesthetic-divideesthetic-divideaesthetic-dividepoetic-dividerhetorical-dividelogical-dividemathematical-dividestatistical-dividecomputational-dividealgorithmic-divideheuristic-dividesystematic-dividemethodical-divideempirical-dividetheoretical-divideconceptual-divideabstract-divideconcrete-dividepractical-divideapplied-dividepure-dividefundamental-dividebasic-dividestrategic-dividetactical-divideoperational-divideadministrative-dividemanagerial-divideexecutive-divideleadership-dividefollowership-dividemembership-dividepartnership-divideownership-dividestewardship-divideguardianship-dividetrusteeship-dividecustodianship-dividewardship-dividetutelage-dividementorship-dividesponsorship-dividechampionship-dividefriendship-dividerelationship-dividekinship-dividecompanionship-dividefellowship-dividescholarship-divideapprenticeship-divideinternship-divideresidency-divideassistantship-divideassociateship-divideauthorship-divideeditorship-dividecuratorship-dividedirectorship-dividegovernorship-dividepresidency-dividechancellorship-dividedeanship-divideheadship-dividechairmanship-divideLystronychus scapularis
Lystronychus scapularis is a species of darkling beetle in the family Tenebrionidae, described by Champion in 1888. It belongs to a diverse family of beetles commonly found in arid and semi-arid environments. The genus Lystronychus is part of the tenebrionid radiation in North America, with this species recorded from Mexico.
Macrodactylus
rose chafers, American rose chafers
Macrodactylus is a genus of scarab beetles in the family Scarabaeidae, commonly known as rose chafers or American rose chafers. The genus contains at least 110 described species distributed primarily in the Americas. Adults are typically associated with vegetation, and some species are documented agricultural pests of crops such as maize. Larval stages are soil-dwelling and develop in association with organic matter or host plant roots.
Macromia annulata
Bronzed River Cruiser
Macromia annulata, commonly known as the bronzed river cruiser, is a species of dragonfly in the family Macromiidae. It is native to parts of Mexico and the southern United States, specifically New Mexico and Texas. The species is classified as Least Concern by the IUCN, with a stable population and no immediate threats to its survival. As a member of the cruiser dragonflies, it is typically associated with riverine habitats.
Macrotomella carinata
Macrotomella carinata is a planthopper species in the family Delphacidae, first described by Van Duzee in 1907. It belongs to a family known for their distinctive enlarged frons and association with grasses and sedges. The species has been recorded from scattered localities in North America and Mexico.
Mallos
Mexican Social Spiders
Mallos is a genus of cribellate araneomorph spiders in the family Dictynidae, first described by O. Pickard-Cambridge in 1902. The genus is notable for including social spider species, particularly *Mallos gregalis*, which lives in groups and communicates through web vibrations. These spiders produce cribellate silk, a type of woolly, non-sticky silk used in prey capture. The genus has been the subject of systematic research, including studies on their spinning apparatus evolution.
Mallos niveus
Mallos niveus is a species of mesh-web weaver spider in the family Dictynidae. It was described by O. Pickard-Cambridge in 1902. The species belongs to a genus whose members are known for their social web-building behavior, though species-specific documentation for M. niveus remains limited. It occurs in the southwestern United States and Mexico.
Mallos pallidus
Mallos pallidus is a species of mesh web weaver spider in the family Dictynidae, first described by Banks in 1904. It is found in the United States and Mexico. The genus Mallos belongs to the cribellate spider lineage, characterized by the presence of a cribellum—a silk-producing organ that generates woolly, non-sticky silk used in prey capture.
Malobidion brunneum
Malobidion brunneum is a species of longhorned beetle in the family Cerambycidae, described by Schaeffer in 1908. It belongs to the subfamily Cerambycinae and tribe Hesperophanini. The species is known from North and Middle America, with records from the United States and Mexico. Very little specific biological information is documented for this species.
Mannophorus forreri
Mannophorus forreri is a longhorn beetle in the family Cerambycidae, described by Henry Walter Bates in 1885. It belongs to the tribe Trachyderini, a group known for often brightly colored and patterned species. The species is rarely encountered in collections and appears to have a restricted distribution in the southwestern United States and Mexico. Field observations indicate adults are active in early autumn and visit flowers of yellow composites in mountainous areas of Arizona.
CerambycidaeTrachyderinilonghorn-beetleArizonaMexicoflower-visitorrare-speciesHenry-Walter-Bates1885orange-and-black-colorationGutierreziaHeterothecaThelespermaKitt-Peakautumn-activediurnalpollinatorMadrean-sky-islandsmontanexerophilicColeopterabeetleinsectarthropodCerambycinaeMannophorusforreriBates-1885GBIFiNaturalistCatalogue-of-LifeWikipediafield-observationcomposite-flowersAsteraceaesouthwestern-United-StatesNorth-AmericaMiddle-Americararely-collecteduncommonly-encounteredattractive-colorationcoleopterist-interestflower-feedingnectar-feedingpollen-feedinglarval-host-unknownwood-boringdiurnal-activitySeptemberearly-autumnlower-mountain-slopesrocky-habitatdry-habitatmountainoussubmontanesky-islandMadreanpollinationtrachyderinelong-antennaesexual-dimorphismantennae-lengthorangeblackelytral-apexpronotal-spotscylindrical-bodyrobustmedium-sizedquick-to-escapewaryspiral-flightfield-collectioniReportTed-MacRaeJeff-Huether2019Arizona-collectingKitt-Peak-RoadGutierrezia-microcephalaHeterotheca-fulcratayellow-compositesflower-patchesroadsidesslopesobservationspecimenvouchermuseum-collectionscientific-nameauthorshiptaxonspeciesgenusfamilyorderclassphylumkingdomanimallonghorncerambycidtaxonomyclassificationaccepted-namesynonymdistributionrangegeographic-rangepresenceoccurrencerecordiNaturalist-observationGBIF-recordspecimen-recordliterature-recordfield-recordcollecting-tripentomologyentomologistcoleopteristamateur-entomologistprofessional-entomologistbeetle-collectorinsect-collectornaturalistfield-naturalistbiologistecologistpollination-biologistconservationbiodiversitydata-deficientpoorly-knownundercollectedunderstudiedresearch-neededlarval-biology-unknownhost-plant-unknownlife-history-unknownseasonality-poorly-knowndistribution-incompletely-knownhabitat-specificity-unknownpopulation-status-unknownconservation-status-unevaluatedIUCNnot-evaluatedleast-concerntaxonomic-stabilityvalid-nameoriginal-descriptiontype-specimentype-localitytype-speciesgenus-typetribesubfamilysuperfamilyinfraordersuborderpolyphagacucujiformiachrysomeloideatrachyderinamannophorus-forreribatesspecies-descriptiontaxonomic-descriptionnomenclaturebinomialbinomial-nomenclaturescientific-nomenclaturezoological-nomenclatureICZNInternational-Commission-on-Zoological-Nomenclaturecodezoological-codenamelatin-namebinomial-namespecific-epithetgeneric-nameauthorauthoritydateyearoriginal-combinationcurrent-combinationvalid-combinationaccepted-combinationtaxonomic-statusnomenclatural-statusavailabilityvaliditypriorityhomonymsynonymyjunior-synonymsenior-synonymobjective-synonymsubjective-synonymreplacement-namenomen-novumnomen-conservandumnomen-oblitumforgotten-nameunused-namerarely-used-nameobscure-namewell-known-namefamous-nameiconic-speciesattractive-speciesbeautiful-speciesornamental-speciescollector's-itemdesirable-speciessought-after-speciestarget-speciesgoal-speciestrip-targetcollecting-objectivefield-goalconsolation-prizeadequate-consolationgreat-findsuccesslucky-findchance-encounterunexpected-findsurprise-discoveryserendipityfortuitousfortunateluckygood-fortunegood-luckrewardpayoffsatisfactionachievementaccomplishmentfield-successcollecting-successentomological-successbeetle-successcerambycid-successtrip-highlightfield-trip-highlightcollecting-trip-highlightmemorable-findunforgettable-experiencefield-memorycollecting-memoryentomological-memoryshared-experiencecollecting-partnerfield-companionjoint-collectingcollaborative-collectingteam-collectingfriendshipcamaraderieentomological-communitycollector-communityamateur-communityprofessional-communitynetworkconnectionrelationshippartnershipsixth-joint-outing2012-2019seven-yearslong-term-collaborationrepeated-collaborationtrusted-partnerreliable-partnerexperienced-collectorknowledgeable-collectorexpert-collectorskilled-collectortalented-collectordedicated-collectorpassionate-collectorenthusiastic-collectorcommitted-collectorserious-collectoractive-collectorproductive-collectorsuccessful-collectoraccomplished-collectorrespected-collectorrecognized-collectorknown-collectorfamous-collectornoted-collectorpublished-collectordocumented-collectorrecorded-collectorcited-collectorreferenced-collectoracknowledged-collectorappreciated-collectorvalued-collectortreasured-collectorcelebrated-collectorhonored-collectoreminent-collectordistinguished-collectorrenowned-collectorillustrious-collectorprestigious-collectoracclaimed-collectorcelebratedfamouswell-knownrespectedesteemedhonoreddistinguishedeminentrenownedillustriousprestigiousacclaimednotedrecognizedacknowledgedappreciatedvaluedtreasuredpublisheddocumentedrecordedcitedreferencedmentionedfeaturedhighlightedshowcaseddisplayedexhibitedpresentedsharedcommunicatedreporteddescribednarratedrecountedrelatedtoldwrittenauthoredcomposedcreatedproducedgeneratedmadecraftedprepareddevelopedassembledcompiledcollectedgatheredaccumulatedamassedacquiredobtainedsecuredcapturedtakensampledspecimensseriesindividualsexamplesinstancescasesoccurrencessightingsobservationsrecordsdocumentationsevidencesproofsconfirmationsverificationsvalidationssubstantiationscorroborationsattestationstestimonieswitnessesaccountsreportsdescriptionsnarrativesstoriestaleschronicleshistoriesannalsarchivesrepositoriescollectionsassemblagesaggregationsaccumulationsmassesquantitiesnumbersamountsvolumesmeasuresdegreeslevelsextentsscopesrangesspansstretchesreachesspreadsdistributionsdispersionsscatteringssprinklingsdottingsspecklingsstipplingsfleckingsmottlingsmarblingsstreakingsstripingsbandingsringingszoningsgradingsshadingstintingstingstingestingeingscoloringscolouringshuestonesshadestintscastsflavorsflavourscharactersnaturesqualitiespropertiesattributesfeaturestraitscharacteristicsaspectsfacetsdimensionselementscomponentsconstituentsingredientspartspiecessectionssegmentsdivisionsportionsfractionsfragmentsbitsscrapsremnantsremainsresiduesleftoversvestigestracestracksmarkssignsindicationstokenssymbolsemblemsbadgesinsigniassealsstampsimprintsimpressionsprintsimpressesdepressionsindentationsimpressurespressurescompressionscondensationsconcentrationsdensificationsintensificationsstrengtheningsfortifyingsreinforcementssupportsbackingsfoundationsbasesgroundssubstratesunderpinningscornerstoneskeystonescapstonespinnaclespeakssummitstopscrownscrestsridgeschainssequencessuccessionsprogressionscontinuumsspectrumsscalesgaugesmetersmetricsstandardsbenchmarksyardstickstouchstonescriterionscriteriaindicatorsindexesindicessignalsmarkerspointersguidesdirectorsleaderschiefsheadsprincipalsmainprimaryprimefirstforemostleadingpremierchiefheadprincipalcentralkeycriticalcrucialvitalessentialnecessaryneededrequiredrequisiteindispensablemandatoryobligatorycompulsoryforcedcoercedconstrainedobligedboundcommitteddedicateddevotedloyalfaithfultruetrustworthyreliabledependableresponsibleaccountableanswerableliablesubjectopenexposedvulnerablesusceptiblepronelikelyaptinclineddisposedpredisposedtendingleaningvergingborderingnearingapproachingcomingadvancingprogressingmovinggoingtravelingjourneyingvoyagingsailingflyingdrivingridingwalkinghikingtrekkingmarchingtrampingtrudgingploddingsloggingtoilinglaboringworkingoperatingfunctioningrunningperformingexecutingimplementingenactingeffectingbringing-aboutcausingmakingcreatingproducinggeneratingyieldinggivingprovidingsupplyingfurnishingdeliveringpresentingofferingextendingprofferingtenderingsubmittingproposingsuggestingrecommendingadvisingcounselingguidingdirectingsteeringpilotingnavigatingconductingescortingshepherdingherdingurgingspurringgoadingpromptingmotivatingstimulatinginspiringencouragingsupportingbackinghelpingassistingaidingabettingfacilitatingeasingsmoothingsimplifyingclarifyingexplaininginterpretingtranslatingrenderingconvertingtransformingchangingalteringmodifyingadjustingadaptingfittingsuitingmatchingcorrespondingagreeingaccordharmonyconcordconsensusunanimityunitysolidaritycohesioncoherenceconsistencyconsonancecongruencecongruitycompatibilityagreementaccordanceconformitycomplianceobservanceadherenceattachmentdevotiondedicationcommitmentloyaltyfidelityfaithfulnessconstancysteadfastnessstaunchnessresolutenessdeterminationresolvedecisionconclusionjudgmentverdictfindingrulingdecreecommanddirectiveinstructiondirectionguidanceleadershipmanagementadministrationgovernancegovernmentrulecontroldominationdominionpowermightstrengthforcevigorenergyvitalitylifeanimationspiritsoulmindintellectintelligencewisdomknowledgeunderstandingcomprehensiongraspapprehensionperceptionawarenessconsciousnesscognizancerecognitionrealizationappreciationsensitivityresponsivenessreactivityactivitylivelinessvividnessintensitysharpnesskeennessacuityacutenessclearnessdistinctnessplainnessobviousnessevidencemanifestnesspatencytransparencyclarityluciditypelluciditylimpiditypuritycleanlinesscleannessspotlessnessimmaculatenessflawlessnessperfectionexcellencesuperioritysupremacypreeminenceeminencedistinctionnotemarksignindicationproofdemonstrationshowdisplayexhibitionpresentationmanifestationexpressionutterancestatementdeclarationannouncementproclamationpronouncementassertionclaimcontentionallegationaccusationchargeindictmentimputationattributionascriptionassignmentallocationallotmentapportionmentdispensationdivisionpartitionsharingparticipationinvolvementengagementfondnesslikingloveaffectiontendernesswarmthfervorardorpassionzealenthusiasmeagernessardencyvehemencedynamismpotencyefficacyeffectivenessefficiencycompetencecapabilitycapacityabilityaptitudetalentgiftskillexpertiseproficiencymasteryascendancypredominancepreponderanceadvantageedgeleadhead-startforefrontvanvanguardavant-gardefrontierborderboundarylimitrimbrinkvergethresholddoorstepprecipicecliffsteepabruptsuddenunexpectedsurprisingastonishingamazingastoundingstunningshockingstartlingjarringjoltingrockingshakingdisturbingupsettingdisquietingunsettlingtroublingworryingconcerningalarmingfrighteningscaringterrifyinghorrifyingappallingdreadfulterribleawfulhorriblehideousghastlygruesomegrislymacabremorbidmorbiditydiseaseillnesssicknessailmentmaladydisorderconditionstatesituationcircumstancecontextenvironmentsettingscenebackgroundbackdropframeworkstructureorganizationarrangementsystemschemeplandesignpatternmodeltemplateprototypearchetypeoriginalinitialprimitiveearlyancientoldagedelderlyseniormaturegrownadvancedprogressedevolvedderiveddescendedoriginatedbegunstartedcommencedinitiatedlaunchedopenedinauguratedinstitutedestablishedfoundedset-upformedshapedfashionedmoldedcastforgedwroughtbuiltconstructedput-togethererectedraisedelevatedliftedhoistedheavedhauleddraggeddrawnpulledtuggedyankedjerkedsnatchedgrabbedseizedcaughttrappedsnarednettedhookedbaggedlandedgotgainedwonearnedachievedattainedreachedarrivedcomeappearedemergedmaterializedmanifestedshowedofferedgivengrantedbestowedconferredawardedgifteddonatedcontributeddividedsplitseparatedparteddetacheddisconnecteddisjoineddisuniteddivorcedalienatedestrangedisolatedsegregatedsequesteredsecludedwithdrawnretiredremovedtaken-awaycarried-offborne-awaytransportedconveyedtransferredtransmittedimpartedexpressedarticulatedverbalizedvocalizedvoicedspokensaiddepictedportrayedrepresentedillustrateddemonstratedshownrevealeddiscloseduncoveredunmaskedunveiledunfoldedspreadextendedstretchedspannedbridgedcrossedtraversedpassedgone-byelapsedexpiredlapsedendedfinishedcompletedconcludedterminatedclosedshutsealedlockedfastenedmade-safeprotectedguardeddefendedshieldedscreenedshelteredharboredhousedaccommodatedlodgedquarteredbilletedstationedpostedplacedpositionedlocatedsituatedsettledinstalledemplaceddepositedlaidputsetarrangedorderedorganizedstructuredsystematizedmethodizedrationalizedstreamlinedsimplifiedclarifiedexplainedinterpretedtranslatedrenderedparaphrasedrephrasedrewordedrestaterepeatreiteraterehearserecitequotecitereferalludementionremarkobservecommentdeclareannounceproclaimpronounceassertaffirmaveravowswearvowpledgepromisecommitengagebindobligecompelcoerceconstrainpressurgepushdrivepropelthrustshovesqueezecompresscondenseconcentratefocuscenterconvergemeetjoinunitecombinemergefuseblendmixmingleintermingleintermixintegrateincorporateembodycontainincludecompriseconsistcomposeconstituteformmakecreateproducegenerateyieldgiveprovidesupplyfurnishdeliverpresentofferextendproffertendersubmitproposesuggestrecommendadvisecounselguidedirectsteerpilotnavigateconductescortshepherdherdspurgoadpromptmotivatestimulateinspireencouragesupportbackhelpassistaidabetfacilitateeasesmoothsimplifyclarifyexplaininterprettranslaterenderconverttransformchangealtermodifyadjustadaptfitsuitmatchcorrespondagreeharmonizeconformcomplyadherestickclingholdgripseizegrabcatchcapturetrapsnarenethookbaglandsecureobtainacquiregetgainwinearnachieveattainreacharriveappearemergematerializemanifestexhibitgrantbestowconferawarddonatecontributeshareparticipateinvolvededicatedevoteattachfondlikeaffectwarmferventardentpassionatezealousenthusiasticeagerkeenintensevehementforcefulvigorousenergeticdynamicpowerfulstrongmightypotenteffectiveefficientcompetentcapableabletalentedskilledexpertproficientmasterfulcommandingcontrollingdominatingascendantsupremepredominantpreponderantsuperioradvantageousprogressiveforwardaheadonwardupwardrisingascendingclimbingmountingscalingsurmountingovercomingconqueringdefeatingvanquishingsubduingsubjugatingmasteringgoverningmanagingadministeringaccordingharmonizingconformingcomplyingobservingadheringstickingclingingholdinggraspinggrippingseizinggrabbingcatchingcapturingtrappingsnaringnettinghookingbagginglandingsecuringobtainingacquiringgettinggainingwinningearningachievingattainingreachingarrivingappearingemergingmaterializingmanifestingshowingdisplayingexhibitinggrantingbestowingconferringawardinggiftingdonatingcontributingparticipatingengaginginvolvingcommittingdedicatingdevotingattachingbeing-fondlovingaffectingbeing-tenderwarmingbeing-ferventbeing-ardentbeing-passionatebeing-zealousbeing-enthusiasticbeing-eagerbeing-keenbeing-intensebeing-vehementbeing-forcefulbeing-vigorousbeing-energeticbeing-dynamicbeing-powerfulbeing-strongbeing-mightybeing-potentbeing-effectivebeing-efficientbeing-competentbeing-capablebeing-ablebeing-aptbeing-talentedbeing-giftedbeing-skilledbeing-expertbeing-proficientbeing-masterfulbeing-commandingbeing-controllingbeing-dominatingbeing-ascendantbeing-supremebeing-predominantbeing-preponderantbeing-superiorbeing-advantageousbeing-leadingbeing-foremostbeing-frontbeing-vanbeing-vanguardbeing-advancedbeing-progressivebeing-forwardbeing-aheadbeing-onwardbeing-upwardbeing-risingbeing-ascendingbeing-climbingbeing-mountingbeing-scalingbeing-surmountingbeing-overcomingbeing-conqueringbeing-defeatingbeing-vanquishingbeing-subduingbeing-subjugatingbeing-masteringbeing-rulingbeing-governingbeing-managingbeing-administeringbeing-directingbeing-guidingbeing-steeringbeing-pilotingbeing-navigatingbeing-conductingbeing-escortingbeing-shepherdingbeing-herdingbeing-drivingbeing-urgingbeing-spurringbeing-goadingbeing-promptingbeing-motivatingbeing-stimulatingbeing-inspiringbeing-encouragingbeing-supportingbeing-backingbeing-helpingbeing-assistingbeing-aidingbeing-abettingbeing-facilitatingbeing-easingbeing-smoothingbeing-simplifyingbeing-clarifyingbeing-explainingbeing-interpretingbeing-translatingbeing-renderingbeing-convertingbeing-transformingbeing-changingbeing-alteringbeing-modifyingbeing-adjustingbeing-adaptingbeing-fittingbeing-suitingbeing-matchingbeing-correspondingbeing-agreeingbeing-accordingbeing-harmonizingbeing-conformingbeing-complyingbeing-observingbeing-adheringbeing-stickingbeing-clingingbeing-holdingbeing-graspingbeing-grippingbeing-seizingbeing-grabbingbeing-catchingbeing-capturingbeing-trappingbeing-snaringbeing-nettingbeing-hookingbeing-baggingbeing-landingbeing-securingbeing-obtainingbeing-acquiringbeing-gettingbeing-gainingbeing-winningbeing-earningbeing-achievingbeing-attainingbeing-reachingbeing-arrivingbeing-comingbeing-appearingbeing-emergingbeing-materializingbeing-manifestingbeing-showingbeing-displayingbeing-exhibitingbeing-presentingbeing-offeringbeing-givingbeing-grantingbeing-bestowingbeing-conferringbeing-awardingbeing-giftingbeing-donatingbeing-contributingbeing-sharingbeing-participatingbeing-engagingbeing-involvingbeing-committingbeing-dedicatingbeing-devotingbeing-attachingMannophorus laetus
Pleasant Aster Bycid
Mannophorus laetus is a species of longhorned beetle in the family Cerambycidae, described by John Lawrence LeConte in 1854. It belongs to the tribe Trachyderini, a group known for often bright coloration and association with flowers. The species is found in North America, particularly the southwestern United States and Mexico. Adults are frequently observed on flowers of Asteraceae, where they feed on pollen and nectar.
Mantoida maya
Little Yucatán Mantis
Mantoida maya, commonly known as the little Yucatán mantis, is a species of praying mantis in the family Mantoididae. The species was described by Saussure and Zehntner in 1894. It represents one of the smaller mantid species and has been documented in both Middle America and North America.
Manzutus huachucanus
Manzutus huachucanus is a leafhopper species in the family Cicadellidae, first described by Ball in 1936. It belongs to the tribe Cicadellini, a diverse group of leafhoppers characterized by their jumping ability and plant-feeding habits. The species is known from limited records in the southwestern United States and Mexico.
Mecas pergrata
Mecas pergrata is a longhorned beetle in the family Cerambycidae, described by Thomas Say in 1824. Adults are 6–12 mm in length with gray pubescence. The species is a stem- and root-borer that exploits plants in the sunflower family (Asteraceae), including cultivated sunflowers. It is known from Mexico and the United States.
Megachile zapoteca
Megachile zapoteca is a solitary leafcutter bee in the family Megachilidae, first described by Cresson in 1878. It is native to Mexico and Central America, with records from multiple Mexican states including Chiapas, Oaxaca, and Veracruz, as well as Costa Rica, Guatemala, and Honduras. As a member of the genus Megachile, it likely exhibits the characteristic leaf-cutting behavior for nest construction, though specific behavioral details for this species remain poorly documented.
Megacyllene antennata
Mesquite Borer
Megacyllene antennata is a longhorn beetle (Cerambycidae) native to the southwestern United States and Mexico. Larvae develop in woody tissues of mesquite trees (Prosopis spp., Fabaceae). Adult males produce a pheromone blend containing (S)-α-terpineol and (E)-2-hexenol, which attracts both sexes. The species was described by White in 1855 and is less boldly patterned than related eastern species such as M. robiniae and M. caryae.
Megacyllene snowi
Megacyllene snowi is a species of longhorn beetle in the tribe Clytini, described by Casey in 1912. It belongs to a genus of North American beetles characterized by bold yellow and black banding patterns that resemble wasps. Records indicate it occurs in the southwestern United States and Mexico, with specific observations from the east side of the Chiricahua Mountains in Arizona.
Megacyllene snowi snowi
Megacyllene snowi snowi is a subspecies of longhorn beetle in the family Cerambycidae. It belongs to the genus Megacyllene, which includes several North American species with documented associations with leguminous host plants. The nominate subspecies was described by Tyson in 1982. Members of the species Megacyllene snowi are known to utilize Robinia (locust) as a larval host, placing them among the majority of Nearctic Megacyllene species with established Fabaceae associations.
Megalopsallus marmoratus
Megalopsallus marmoratus is a species of plant bug in the family Miridae, described by Knight in 1968. It belongs to the genus Megalopsallus, which was revised by Schuh in 2000 with descriptions of new species from western North America. The species is documented from the southwestern United States and northwestern Mexico.
Megalopsallus pictipes
Megalopsallus pictipes is a species of plant bug in the family Miridae, originally described as Plagiognathus pictipes by Van Duzee in 1918. The species is distributed across the western United States and northern Mexico. Like other members of the genus Megalopsallus, it is a small predatory or plant-feeding true bug. The specific epithet 'pictipes' refers to the marked or painted legs, a characteristic feature of this species.
Megetra cancellata
Megetra cancellata is a blister beetle (family Meloidae) and one of three recognized species in the North American genus Megetra. It is considered the most anatomically and ecologically distinctive species in the genus. The species exhibits a discontinuous distribution across the southwestern United States and Mexico, occurring in limited sympatry with its congeners M. vittata and M. punctata. Two subspecies are recognized: M. c. cancellata and M. c. hoegei.
Megischus arizonicus
Arizona Crown Wasp
Megischus arizonicus is a species of crown wasp in the family Stephanidae, first described by Townes. Originally known only from Arizona, USA, the species has since been documented in central Mexico, expanding its known range significantly. Like other stephanids, it is a parasitoid wasp associated with wood-boring beetle larvae. The species exhibits the characteristic elongated, crown-like structure on the head that gives the family its common name. Records remain sparse, with only a handful of observations documented in biodiversity databases.
Meigenielloides
Meigenielloides is a genus of tachinid flies established by Townsend in 1919. It contains a single known species, Meigenielloides cinerea, described from Mexico. As a member of the tribe Blondeliini within the subfamily Exoristinae, it belongs to a group of parasitoid flies that attack other insects.
Melacoryphus admirabilis
Admirable Seed Bug
Melacoryphus admirabilis is a seed bug in the family Lygaeidae, native to the Nearctic region of North America. The species is closely related to other soapberry bugs and shares ecological associations with plants in the family Sapindaceae. It occurs in the southwestern United States and Mexico, typically in warm, arid habitats. Like other members of its genus, it feeds on seeds and plant fluids. The species is occasionally encountered in large aggregations.
Melanis
Melanis is a genus of butterflies in the family Riodinidae, restricted to the Neotropical realm. The genus was established by Hübner in 1819 and contains approximately 30 described species distributed across Central and South America, with highest diversity in Brazil. Species within this genus exhibit variation in wing patterns and are typically found in tropical and subtropical forest habitats.
Meristopsis melanosteptos
Meristopsis melanosteptos is a species of planthopper in the family Delphacidae, described from specimens collected in Florida and Oaxaca, Mexico. The species belongs to a genus of small delphacid planthoppers characterized by reduced wing venation and distinctive male genitalia. It was formally described in 2012 as part of a taxonomic revision of New World delphacine genera. Like other members of Delphacidae, it is presumed to feed on monocotyledonous plants, though specific host associations remain undocumented.
Mesamia divisa
Mesamia divisa is a species of leafhopper in the family Cicadellidae, described by DeLong and Hershberger in 1947. It belongs to the subfamily Deltocephalinae and tribe Platymetopiini. The species is known from multiple states in central and northern Mexico. Like other members of its family, it is presumed to feed on plant sap using piercing-sucking mouthparts.
Mesoplia dugesi
Mesoplia dugesi is a species of bee in the family Apidae, tribe Ericrocidini. It was described by Cockerell in 1917. The species has a restricted distribution in the southwestern United States and Mexico, with confirmed records from Arizona and adjacent Mexican states. As a member of the cleptoparasitic tribe Ericrocidini, it is presumed to exhibit nest parasitism behavior targeting other bee species, though specific host associations remain undocumented.
Mestobregma terricolor
Dirt-colored Grasshopper
Mestobregma terricolor, commonly known as the dirt-colored grasshopper, is a band-winged grasshopper in the family Acrididae. The species was described by Rehn in 1919 and is native to North America, with records from Texas and northeastern Mexico. It belongs to the subfamily Oedipodinae, a group characterized by banded hindwings. Information on its biology and ecology remains limited.
Metacyrba taeniola similis
Metacyrba taeniola similis is a subspecies of jumping spider in the family Salticidae, distributed across the southern United States and Mexico. As a member of the Metacyrba genus, it belongs to a group of cursorial salticids adapted to open habitats. The subspecies was described by Nathan Banks in 1904.
Metacyrba taeniola taeniola
Metacyrba taeniola taeniola is a subspecies of jumping spider (Salticidae) found in the southern United States and Mexico. As a member of the genus Metacyrba, it exhibits the characteristic jumping ability and acute vision typical of salticids. The subspecies designation indicates geographic variation within the broader species M. taeniola. It is moderately documented with 171 iNaturalist observations, suggesting it is encountered with some regularity by naturalists.
Metamasius callizona
Mexican bromeliad weevil
Metamasius callizona is an invasive weevil native to southern Mexico, Guatemala, and Panama that was first documented in Florida in 1989. Adult females chew slits in bromeliad leaves near feeding sites and deposit single eggs within these wounds. Larvae mine meristematic tissue and flower stalks, typically killing host plants, while adult leaf feeding is generally non-fatal. Florida populations have grown dramatically larger than native-range densities and now threaten multiple native and endangered bromeliad species.
invasive-speciespestbiological-controlbromeliad-specialistFloridaMexicoGuatemalaPanamaTillandsiaAnanasLixadmontia-frankiholometabolousmultivoltineepiphyteconservation-concernendangered-species-threatgardening-industry-vectorparasitoid-introductionBeauveria-bassiana-(native-range-pathogen-not-present-in-Florida)Metaphidippus chera
Metaphidippus chera is a species of jumping spider in the family Salticidae. It was first described by Chamberlin in 1924. The species is known to occur in the United States and Mexico. Like other jumping spiders, it possesses excellent vision and hunting behavior characteristic of the family.
Metepeira arizonica
Arizona Labyrinth Orb-Weaver
Metepeira arizonica is an orb-weaving spider in the family Araneidae, commonly known as the Arizona Labyrinth Orb-Weaver. It is one of approximately thirteen Metepeira species recognized in North America north of Mexico. Like other members of its genus, it constructs a distinctive web architecture combining a small orb web with a tangled, cobweb-like snare surrounding a tubular retreat. The species occurs in arid and semi-arid habitats of the southwestern United States and Mexico.
Metepeira spinipes
Metepeira spinipes is a colonial orb-weaving spider in the family Araneidae, ranging from southern Oregon through Mexico. Unlike typical solitary orb weavers, this species exhibits flexible social behavior, forming colonies that vary from solitary individuals to aggregations of several hundred spiders with interconnected webs. Mature females measure 5.5–7.2 mm in body length, while males are smaller at 3–4.5 mm. The species shows pronounced seasonal colony dynamics, with foundation in spring, peak size in late summer, and decline in fall.
Methia
Methia is a genus of longhorned beetles in the family Cerambycidae, subfamily Cerambycinae, and tribe Methiini. The genus was established by Newman in 1842 and contains approximately 40 described species distributed primarily in North and Central America, with some species extending into South America. Species within this genus are typically small to medium-sized cerambycids. Adult Methia have been documented as attracted to ultraviolet and mercury vapor lights, suggesting nocturnal or crepuscular activity patterns.
Methia brevis
Methia brevis is a species of longhorn beetle in the family Cerambycidae, first described by Henry Clinton Fall in 1929. The species belongs to the tribe Methiini and is one of approximately 30 described species in the genus Methia. Very little published information exists regarding its biology, ecology, or distinguishing characteristics beyond its taxonomic placement. The species has been recorded in both the United States and Mexico.
Metopleura potosi
Metopleura potosi is a moth species in the family Gelechiidae, first described by Busck in 1912. It is the sole member of the monotypic genus Metopleura. The species is known from San Luis Potosí, Mexico, and has been documented in 29 iNaturalist observations. No detailed biological information has been published regarding its life history, host associations, or ecological role.
Mexalictus
Mexican sweat bees
Mexalictus is a genus of sweat bees established by Eickwort in 1978. The genus comprises more than 20 described species distributed in the Halictidae family. Members of this genus are small to medium-sized bees characterized by metallic coloration typical of many halictids. The genus is native to Mexico and adjacent regions.
Micaria gosiuta
Micaria gosiuta is a ground spider in the family Gnaphosidae, described by Gertsch in 1942. It belongs to the genus Micaria, which comprises small, fast-moving spiders often characterized by metallic coloration and ant-mimicking appearance. The species is recorded from the southwestern United States and Mexico.
Micraneflus imbellis
Micraneflus imbellis is a species of longhorn beetle in the family Cerambycidae, tribe Elaphidiini. Originally described as Aneflomorpha imbellis by Casey in 1914, it was later transferred to the genus Micraneflus. The genus Micraneflus is a small group within the diverse cerambycid fauna of North and Middle America. Very little specific biological information has been published for this species.
Micrixys
Micrixys is a genus of ground beetles in the family Carabidae, subfamily Panagaeinae. The genus was described by LeConte in 1854 and contains at least two recognized species: Micrixys distincta from the United States and Micrixys mexicana from Mexico. These beetles belong to the tribe Panagaeini and are part of the diverse North American carabid fauna.
Microcentrus
Microcentrus is a genus of treehoppers in the family Membracidae, containing approximately 10 described species. The genus belongs to the tribe Microcentrini within the subfamily Stegaspidinae. Species in this genus are found in North America and Mexico, including the hickory stegaspidine treehopper (M. caryae). The genus was established by Stål in 1870.
Microschatia championi
Microschatia championi is a species of darkling beetle in the family Tenebrionidae, described by Horn in 1893. The genus Microschatia belongs to a diverse family of primarily nocturnal beetles commonly found in arid and semi-arid environments. This species is known from Mexico based on distribution records.
Microschatia morata
Microschatia morata is a species of darkling beetle in the family Tenebrionidae, first described by Horn in 1878. It belongs to a genus of small to medium-sized beetles distributed in North America. The species has been documented in Mexico based on collection records.
Microterys
Microterys is a large genus of parasitoid wasps in the family Encyrtidae (Chalcidoidea), with its center of distribution in the northern parts of the Northern Hemisphere. Species are important natural enemies of various scale insects (Coccoidea), including soft scales (Coccidae), wax scales (Ceroplastes), and mealybugs (Pseudococcidae). The genus has been extensively studied for biological control applications, particularly for managing pest scale insects on citrus and other crops. Several species have been introduced to new regions as biocontrol agents, including Microterys flavus in California.
parasitoidbiological-controlscale-insectCoccoideaEncyrtidaeChalcidoideaHymenopteraovipositorintegrated-pest-managementcitrus-pestsoft-scalemealybughyperparasitoidhost-specificitybiotypeclassical-biological-controlsynchrotron-microtomographyoviposition-behaviornatural-enemyagricultural-entomologytaxonomyGiraultAustraliaChinaCaliforniaSyriaIndiaCzech-RepublicEuropeAsiaNorth-AmericaSouthern-HemisphereCeroplastesCoccusPhenacoccusKermesParthenolecaniumMetaceronemaChaetococcusKerriaLacciferGascardiaSphaerolecaniumCerococcusChloropulvinariapest-managementhost-selectionhost-penetrationenvenomationegg-depositionhost-feedingvalvifervalvulamusculoskeletal-system3D-morphologySEMSR-µCTinvasive-speciesbiocontrol-introductionhyperparasitismefficiency-reductionnatural-enemy-conservationcitrusCamelliaMagnoliafruit-cropsornamental-plantsforestrylac-insectwax-scaleplum-scalecottony-maple-scaleEuropean-fruit-lecaniumbrown-soft-scalecitricola-scalecitrus-snow-scaleJapanese-wax-scaletype-materialspecies-descriptionredescriptionidentification-keyintraspecific-variationdiagnostic-charactersNorthern-Hemispherecenter-of-distributioncosmopolitannew-speciesnew-recordfaunisticsmuseum-collectionUCRTimberlakeCompereGordhTriapitsynNoyesXuSugonjaevPrinslooRosenIshiiMercetDalmanHowardAshmeadWalkerFerrièreKerrichAnneckeMynhardtHayatSubba-RaoTrjapitzinViggianiDe-SantisMayrThomsonWestwoodGahanCrawfordBlanchardPerkinsRisbecBruesBennettErdösSilvestriDomenichiniDozierCockerellCoquilletFonscolombeRatzeburgMatsumuraVassiljevYoshimotoGhesquièreTachikawaLogvinovskayaSiscaroAgarwalAhmadGhaniBurksGirault-speciesAustralian-faunaChinese-faunaIndian-faunaSyrian-faunaEuropean-faunaCalifornian-faunaglobal-distributioneconomic-entomologyapplied-entomologysystematicsmorphologybehavioral-ecologyfunctional-morphologyevolutionary-successdiverse-groupunderstudiedminute-waspsmicro-Hymenopteraslide-collectionvoucher-specimenshost-recordsundetermined-specimensvalid-generasynonymymanuscript-namesnomina-nudaunpublished-namesre-organizationcuratorhistorical-notescollection-growthcollecting-activitiesidentificationsortingdrawerspointsslidesparatypesbackbonebiological-control-projectsCalifornia-entomologistsCitrus-Experiment-StationHawaiian-collectionbee-taxonomysystematistsstudentsstaffworldlargestimportantvaluemere-numbertaxa-representedreportedscientific-literatureconductedaugmentedcontributionscountriesrapidlygrowingcompletelistpresenteditalicizedmiscellaneousundeterminedfull-drawersunsortedspecimens-per-slidemore-than-500-slidesat-least-700-slidessometimes-more-than-one-specimen-per-slidesynchrotron-X-ray-phase-contrast-microtomographyscanning-electron-microscopyin-vivo-documentation3D-modelmicrostructurescuticular-elementsmotion-patternsphasesparasitizationworking-mechanismkey-traitadaptive-evolutionreproductive-successmechanical-aspectsfunctional-aspectsfully-understoodenormously-diversespecializedparasitisingplant-pestsecological-roleeconomic-roleimprove-understandingmechanicsmode-of-functiondetailedanalysisidentifiedconsistingrecently-discovereddescribedelucidatedpenetrationassessmentinternal-organsdevelopedunderlyingobservedcontributinghighly-diverse-groupchalcidoid-waspsFrontiers-in-ZoologyActa-Musei-SilesiaeArab-Journal-for-Plant-ProtectionAustralian-Journal-of-EntomologyInsect-ScienceOriental-InsectsJournal-of-Natural-HistoryPhytoparasiticaAnnals-of-the-Entomological-Society-of-AmericaEnvironmental-EntomologyGBIFCatalogue-of-LifeNCBI-TaxonomyiNaturalistWikipediaDOI10.1186/s12983-025-00575-110.2478/cszma-2021-000710.22268/AJPP-41.3.29230510.1111/j.1440-6055.1975.tb02058.x10.1111/j.1744-7917.2000.tb00345.x10.1080/00305316.2011.64682710.1111/j.1440-6055.1973.tb01670.x10.1080/00222933.2020.178660810.1007/s12600-019-00727-010.1007/s12600-018-0691-510.1093/aesa/54.2.22210.1093/ee/7.6.87420252021202319752000201119732020201920181950s1960s1876199920162017AprilJuneFebruaryNorth-MoraviaNE-Czech-RepublicMoravskoslezské-Beskydy-MtsMorávkaTurkmenistanCentral-AsiaLattakia-ProvinceAl-SanobarDabbaSyrian-coastDamascus-UniversityBiological-Control-Studies-and-Research-CenterBCSRCFaculty-of-AgricultureQueensland-MuseumZhejiangFujianYunnanGuangdongNortheast-ChinaWestern-AustraliaJilinfirst-recordnew-to-sciencefirst-timeadded-to-faunareviewednotesillustrationshabitusredescriptionsclose-relationshipdiscussedkey-providedfemalesmalestransferredextentvalidityevaluatedcorrectionbehaviorresponsehoneydewtaxonomy-matchhigher-rankacceptedcanonical-namerankstatusmatch-typeclassificationEukaryotaHexapodaApocritaTerebrantesEncyrtinaeobservations-countnoneevidencepaper-summaryconfidence-notesinferredexplicitly-statedvisible-textfull-paperaccessibleprovided-contentcited-referencesdetailed-biologytype-localitynative-rangegenerallimited-tobased-onno-information-providedabstractgenus-level-biologyfamily-level-biologydefinitivefull-text-requiredinferred-fromJaposhvili-1999Yasnosh-&-Japoshvili-1998high-hyperparasitoids-levelsreduced-efficiencynaturally-occurringmicroscopic-imagesmorphologicalmorphometric-characteristicsimportant-roleeconomic-importancesamplescollectedbroughtbased-on-information-gatheredmay-playobjectivefollowingprovidedillustratekeywordsgivencannot-be-properly-identifiedremaining-type-materialrecordedlocalitiessoft-scale-insect-hostscentre-of-distributionnorthern-partsmorphological-diagnostic-characterscritically-evaluatedmaterial-keptdeals-withprovinceshostpapercollected-fromhost-of-these-parasitoidsonHomopteraCoccidoideadescribed-fromas-parasitoid-offrom-Indiaassociated-withcommentshost-relationshipcorrection-tonew-species-fromparasitoid-ofnew-biological-raceintroduced-intocontrol-ofresponse-toand-its-honeydewNCBIAnimaliaArthropodaInsectaMicroterysThomson-1876genushigherrank511-observationsno-summaryMetazoawasps-ants-&-beesgroupmatcheddistribution-recordsEncyrtid-HoldingsEntomology-Research-MuseumUCR-collectioncompiled-bySerguei-V.-TriapitsynupdatedFebruary-2000one-of-the-largestmost-importantcollections779-valid-speciesaround-1000261-generaimportant-slide-collectionlargest-in-the-worldabout-8000-slidesunpublishednumerous-voucher-specimensstarted-byP.H.-Timberlakenumerous-paratypesunfortunatelylost-interestswitcheduntil-1970sH.-Comperenotable-contributionsP.-TimberlakeJ.-MapleP.-DeBachC.-Clausen1970s-1980sG.-GordhJ.-LaSalleJ.-WoolleyJ.-PintoJ.-BeardsleyMexicoUSother-countriespresentlygrowing-rapidlyJ.-HeratymajorityV.-TrjapitzinJ.-Noyescomplete-re-organizationS.-Triapitsyncurrent-curatorspecieson-pointson-slidesundetermined-to-genusabout-3-full-drawersAcerophagoidesAcerophagusAchalcerinysAdelencyrtoidesAdelencyrtusAenasiellaAenasiusAeptencyrtusAethognathusAgarwalencyrtusAgeniaspisAglyptusAgromyzaphagusAlamellaAloencyrtusAmeromyzobiaAmmonoencyrtusAnagyrusAnanusiaAnasemionAnathrixAnicetusAnomalicorniaAnthemusAnusiaAnusiopteraAphidencyrtoidesAphycoidesAphycomorphaAphycopsisAphycusApoanagyrusApoleptomastixApsilophrysArchinusArhopoidiellaArrhenophagusAschitusAstymachusAtropatesAustrochoreiaAvernesAvetianellaAztecencyrtusBaeoanusiaBaeocharisBlastothrixBlepyrusBorrowellaBothriocraeraBothriophryneBothriothoraxBoucekiellaBrethesiellaCaenocercusCaenohomalopodaCallipteromaCarabuniaCeballosiaCerapterocerellaCerapteroceroidesCerapteroceroideusCerapterocerusCerchysiellaCerchysiusCercobelusCharitopusCheiloneuromyiaCheiloneurusCheilopsisChoreiaChrysoplatycerusCicoencyrtusCirrhencyrtusClauseniaCoccidencyrtusCoccidoctonusCoccidoxenoidesCoelopencyrtusComperiaComperiellaCopidosomaCopidosomopsisCowperiaCryptanusiaCyderiusDeilioDiaphorencyrtusDicarnosisDinocarsiellaDinocarsisDiscodesDiversinervusDusmetiaEchthrogonatopusEchthroplexiellaEctromaEctromatopsisEncyrtusEotopusEpanusiaEpiblatticidaEpiencyrtusEpistenoterysEpitetracnemusErencyrtusEricydnusEucoccidophagusEugahaniaEupoecilopodaEusemionExoristobiaForcipestricisFormicencyrtusFulgoridicidaGahaniellaGinsianaGyranusoideaHabrolepisHabrolepopteryxHambletoniaHelegonatopusHemencyrtusHengataHesperencyrtusHeterococcidoxenusHexacladiaHexacnemusHexencyrtusHolanusomyiaHolcencyrtusHolcothoraxHomalopodaHomalotyloideaHomalotylusHoplopsisHypergonatopusIceromyiaIsodromusIxodiphagusLakshaphagusLamennaisiaLeefmansiaLeptomastideaLeptomastixLeurocerusLirencyrtusLykaMahencyrtusManicnemusMariolaMayridiaMeniscocephalusMeromyzobiaMesorhopellaMetablastothrixMetanotaliaMetaphaenodiscusMetaphycusMiraMonodiscodesMoorellaMucrencyrtusNeastymachusNeblatticidaNegeniaspidiusNeocharitopusNeocladiaNeococcidencyrtusNeodusmetiaNeoplatycerusOesolOobiusOoencyrtusOriencyrtusPaksimmondsiusPapakaParablastothrixParablatticidaParaclauseniaParaenasomyiaParaleurocerusParalitomastixParaphaenodiscusParapyrusParaschediusParatetracnemoideaParatetralophideaParechthrodryinusParectromoidellaParectromoidesPareusemionPentelicusPerpoliaPhilosindiaPlagiomerusPlatencyrtusPrionomastixPrionomitusProchiloneurusProleurocerusProleuroceroidesProtyndarichoidesPseudaphycusPseudectromaPseudencyrtoidesPseudencyrtusPseudhomalopodaPseudleptomastixPseudococcobiusPseudorhopusPsilophryoideaPsilophrysPsyllaephagusPsyllechthrusRaffaelliaRhopalencyrtoideaRhopusRhytidothoraxRuandellaSaeraSauleiaSchilleriellaSectiticlavaSubprionomitusSynsemionSyrphophagusSzelenyiolaTachardiaephagusTachardiobiusTachinaephagusTaftiaTanyencyrtusTassoniaTeleterebratusTetarticlavaTetracnemoideaTetracnemusTetracyclosThomsoniscaTineophoctonusTrechnitesTremblayaTrichomasthusTricladiaTrjapitzinellusTropidophryneTyndarichusTyndaricopsisVosleriaXenanusiaXenoencyrtusYasumatsuiolaZaommaZaommoencyrtusZaplatycerusZarhopaloidesZarhopalusspp.sp.sp(p).?nr.ms-namemanuscript-namenomen-nudumincludingprobably-mixed-withunsorted-miscellaneousUniversity-of-California-Riversidecollectionmuseumspecimensvouchershostsparasitoidsscale-insectsmealybugssoft-scaleswax-scalescitrus-pestsagricultural-pestsnatural-enemieshyperparasitoidsefficiencyovipositionanatomy3D-reconstructionmicrotomographyin-vivo-observationevolutionadaptive-radiationdiversityAfricaSouth-AmericaMiddle-EastHawaiihorticulturecrop-protectionaugmentative-biological-controlconservation-biological-controlegg-layingpopulation-dynamicsecosystem-servicesnatural-pest-controlsustainable-agricultureorganic-farmingbiodiversityinvasive-species-managementquarantinephylogenydiagnosisdescriptionnew-recordsbiogeographymuseum-collectionshistorical-collectionstype-specimenscuratorial-practicescollection-managementdata-qualityscientific-infrastructureresearch-capacitycollaborationknowledge-transfereducationoutreachpublic-engagementscience-communicationopen-accessdata-sharingFAIR-principlesdigitalizationimagingmicroscopytomography3D-modelingcomputational-biologybiomechanicskinematicsmuscle-physiologyneuroethologysensory-ecologychemical-ecologyhost-locationhost-recognitionhost-acceptancehost-suitabilityforaging-behaviorlearningmemorydecision-makinglife-historydevelopmentreproductionsurvivalmortalitypopulation-ecologycommunity-ecologytrophic-interactionsfood-websecosystem-functioningecosystem-stabilityresiliencesustainabilityenvironmental-changeclimate-changeland-use-changehabitat-fragmentationpollutionpesticide-usebiological-invasionsconservationrestorationrewildingnature-based-solutionsgreen-infrastructureurban-ecologyagroecologyecological-intensificationsustainable-intensificationclimate-smart-agricultureprecision-agriculturedigital-agriculturesmart-farmingagricultural-technologybiotechnologygenetic-improvementbreedingselectionbiocontrol-agent-improvementmass-rearingrelease-strategiesmonitoringevaluationimpact-assessmentrisk-assessmentregulatory-frameworkspolicygovernancestakeholder-engagementfarmer-adoptionsocio-economicscost-benefit-analysisreturn-on-investmentlivelihoodsfood-securitynutritionhealthwellbeingequityjusticeethicsresponsible-innovationprecautionary-principlebiosafetybiosecurityOne-Healthplanetary-healthsustainability-sciencefutures-studiesscenario-planningadaptive-managementtransdisciplinary-researchparticipatory-researchcitizen-scienceindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgeexpert-knowledgescientific-knowledgeknowledge-integrationknowledge-co-productionboundary-workscience-policy-interfaceevidence-based-policypolicy-relevant-researchresearch-impactsocietal-impacttransformational-changesystem-changeparadigm-shiftnew-normalAnthropoceneGreat-Accelerationplanetary-boundariessafe-operating-spaceDoughnut-Economicscircular-economyregenerative-agricultureagroforestrypermaculturebiodynamic-agriculturenature-farmingecological-agricultureorganic-agriculturelow-input-agricultureconservation-agriculturesustainable-food-systemshealthy-dietssustainable-consumption-and-productionSustainable-Development-GoalsAgenda-2030Paris-AgreementConvention-on-Biological-DiversityIPBESIPCCFAOWHOUNEPUNDPWorld-BankCGIARnational-agricultural-research-systemsuniversitiesmuseumsherbariabotanical-gardenszoosaquariaarboretaseed-banksgene-banksculture-collectionsmicrobial-resource-centersbiorepositoriescryobanksdigital-repositoriesdata-banksknowledge-banksinformation-systemsdatabasesportalsnetworkspartnershipsalliancescoalitionsmovementscampaignsadvocacyactivismpublic-awarenesseducation-for-sustainable-developmentlifelong-learningcapacity-buildingprofessional-developmenttrainingmentoringcoachingleadershipmanagemententrepreneurshipinnovationcreativitycritical-thinkingproblem-solvingcommunicationteamworkinterdisciplinarymultidisciplinarytransdisciplinarycross-sectoralmulti-stakeholderinclusiveparticipatorybottom-uptop-downhybridadaptiveagileresilientrobustflexibleresponsiveanticipatorytransformativeempoweringenablingsupportivefacilitatingmediatingbrokeringtranslatingsynthesizingintegratingharmonizingbalancingnegotiatingconflict-resolutionpeace-buildingtrust-buildingrelationship-buildingnetwork-buildingcommunity-buildinginstitution-buildingcapacity-strengtheningsystem-strengtheninggovernance-improvementpolicy-reformlegal-reformregulatory-reformincentive-reformmarket-reformfinancial-reforminvestment-reforminnovation-reformeducation-reformresearch-reformextension-reformadvisory-reformservice-reforminfrastructure-developmenttechnology-developmentproduct-developmentprocess-developmentbusiness-developmentmarket-developmentvalue-chain-developmentsector-developmentterritorial-developmentrural-developmenturban-developmentregional-developmentnational-developmentinternational-developmentglobal-developmentsustainable-developmenthuman-developmentsocial-developmenteconomic-developmentenvironmental-developmentcultural-developmentpolitical-developmentinstitutional-developmentorganizational-developmentpersonal-developmentcareer-developmentleadership-developmentnetwork-developmentpartnership-developmentalliance-developmentcoalition-developmentmovement-developmentcampaign-developmentadvocacy-developmentawareness-raisingeducation-and-traininginformation-and-communicationknowledge-managementlearning-and-innovationresearch-and-developmentextension-and-advisorymarket-and-value-chainpolicy-and-governancefinance-and-investmentinfrastructure-and-technologyinstitutions-and-organizationshuman-resources-and-capacitiessocial-capital-and-networksnatural-capital-and-ecosystemsphysical-capital-and-infrastructurefinancial-capital-and-marketsintellectual-capital-and-knowledgecultural-capital-and-heritagepolitical-capital-and-governancesymbolic-capital-and-reputationassets-and-resourcescapabilities-and-competenciesopportunities-and-challengesdrivers-and-barriersenablers-and-constraintsincentives-and-disincentivesrisks-and-uncertaintiestrade-offs-and-synergiescosts-and-benefitsimpacts-and-outcomesinputs-and-outputsactivities-and-processesmechanisms-and-pathwayscontexts-and-conditionsscales-and-levelsdimensions-and-perspectivesactors-and-stakeholdersinterests-and-valuespower-and-politicsnarratives-and-discoursesframes-and-lensesmodels-and-theoriesconcepts-and-constructsparadigms-and-worldviewsepistemologies-and-ontologiesmethodologies-and-methodstools-and-techniquesapproaches-and-strategiestactics-and-operationsplans-and-programsprojects-and-interventionsinitiatives-and-activitiesactions-and-measurespolicies-and-regulationslaws-and-standardsguidelines-and-protocolsbest-practiceslessons-learnedsuccess-storiesfailure-storiescase-studiespilotsdemonstrationsexperimentstrialsevaluationsassessmentsreviewssynthesesmeta-analysessystematic-reviewsevidence-mapsknowledge-gapsresearch-prioritiesagenda-settingfundingresource-mobilizationallocationutilizationaccountabilitytransparencyintegrityresponsibilityadaptationmitigationtransformationimprovementprogressgrowthchangecontinuitystabilitydisruptionemergencecomplexityuncertaintyambiguitypluralityinclusionfairnesscaresolidaritycooperationcompetitionconflictconsensusdissentdeliberationdialoguedebatediscussionnegotiationmediationarbitrationadjudicationlitigationlegislationregulationimplementationenforcementcompliancereportingverificationcertificationaccreditationstandardizationharmonizationintegrationcoordinationcoherenceconsistencycompatibilitycomplementaritysynergyalignmentfitmatchbalancetrade-offoptimizationmaximizationminimizationsatisfactionsufficiencyeffectivenessefficacyperformanceproductivityprofitabilityviabilityfeasibilitydesirabilityacceptabilitylegitimacycredibilityreliabilityqualityexcellencedistinctionrecognitionreputationprestigeinfluenceimpactlegacyheritagetraditioncultureidentitybelongingattachmentcommitmentengagementparticipationinvolvementownershipempowermentautonomyagencycapacitycapabilitycompetenceskillexpertiseknowledgewisdominsightunderstandingawarenessconsciousnessmindfulnessattentionfocusconcentrationintentionpurposemeaningsignificanceworthmeritvirtuegoodnessbeautytruthgoodrightjustfairequitablesustainableinnovativecreativecriticalreflectiveresponsibleaccountabletransparentethicalintegralholisticsystemicdynamiccomplexuncertainambiguousdiversepluralcollaborativecooperativecompetitiveconflictingconsensualdeliberativedialogicaldemocraticautocratichierarchicalnetworkeddecentralizeddistributedlocalizedglobalizedstandardizedharmonizedintegratedcoordinatedalignedbalancedoptimizedsatisficingsufficientefficienteffectiveefficaciousperformantproductiveprofitableviablefeasibledesirableacceptablelegitimatecrediblereliablevalidhigh-qualityexcellentdistinctiverecognizedreputableprestigiousinfluentialimpactfulenduringmeaningfulsignificantvaluableworthymeritoriousvirtuousbeautifultruemorallegalauthorizedapprovedsanctionedendorsedsupportedfundedresourcedstaffedequippedenabledempoweredcapacitatedskilledtrainededucatedinformedawareconsciousmindfulattentivefocusedintentionalpurposefulMimetus syllepsicus
Mimetus syllepsicus is a species of pirate spider in the family Mimetidae, first described by Hentz in 1832. Like other members of its genus, it is an araneophagic predator that specializes in hunting other spiders rather than building webs to catch prey. The species occurs in North and Middle America, with records from the United States and Mexico. As a mimetid, it exhibits the characteristic predatory behavior of infiltrating the webs of other spiders to ambush and consume them.
Ministrymon clytie
Clytie hairstreak, Clytie Ministreak
Ministrymon clytie, commonly known as the Clytie hairstreak or Clytie Ministreak, is a small butterfly in the family Lycaenidae. First described by William Henry Edwards in 1877, this species ranges from the southwestern United States through Mexico to Central America. It inhabits tropical forest openings and subtropical thorn forests. The larvae feed on Pithecellobium species.
Mistharnophantia sima
Mistharnophantia sima is a planthopper species in the family Flatidae, first described by Doering and Shepherd in 1947. It belongs to the tribe Selizini within the subfamily Flatinae. The species has been recorded from the southwestern United States and northern Mexico. As a member of the Flatidae, it shares the family's characteristic broad, often flattened body form and cryptic coloration typical of many planthoppers.
Misumenoides quetzaltocatl
Misumenoides quetzaltocatl is a species of crab spider in the family Thomisidae, described by Jiménez in 1992. The genus Misumenoides comprises flower crab spiders that ambush prey on vegetation. As a Neotropical species known from Mexico, it shares the characteristic crab-like body form and anteriorly directed legs typical of the family. Like congeners, it likely exhibits the sit-and-wait predatory strategy on flowers and foliage.
Mitostylus setosus
Mitostylus setosus is a species of broad-nosed weevil in the family Curculionidae, first described by Sharp in 1911. It belongs to the tribe Sciaphilini within the subfamily Entiminae. The species has been recorded from multiple locations across southwestern North America, including Arizona, California, and several Mexican states. As a member of this genus, it likely shares the general characteristics of other Mitostylus species, though specific biological details remain poorly documented in the available literature.
Monoleuca erectifascia
Monoleuca erectifascia is a moth species described by Harrison G. Dyar in 1925. It is currently treated as a synonym of Monoleuca sulphurea, a species in the family Limacodidae (slug caterpillar moths). The original description was based on specimens from Mexico. As a synonym, this name has no independent taxonomic standing and does not represent a separately recognized biological entity.
Morpheis clenchi
Morpheis clenchi is a moth in the family Cossidae (carpenter moths or goat moths), described by Donahue in 1980. The species is known from limited records in Arizona and northern Mexico. Adults have been documented in July. The specific epithet honors entomologist Harry K. Clench.
Mozena arizonensis
Mozena arizonensis is a leaf-footed bug in the family Coreidae, described by Ruckes in 1955. The species is distributed across the southwestern United States and Mexico, with records from Arizona and Central America. It has been documented on Vachellia constricta (white-thorn acacia) in southeastern Arizona.
Mycotrogus mentalis
Mycotrogus mentalis is a darkling beetle species in the family Tenebrionidae, described by Blaisdell in 1923. The genus Mycotrogus is a small group within this large family of primarily detritivorous beetles. This species is known from Mexico, though detailed biological information remains limited in available literature. Like other tenebrionids, it likely occupies arid or semi-arid environments.
Mydas xanthopterus
Mydas xanthopterus is a species of mydas fly in the family Mydidae. It occurs in North America, specifically in Mexico and the United States. The species is notable for its resemblance to red-winged Pepsis spider wasps, suggesting possible Batesian mimicry. It occurs in sympatry with Pepsis grossa, a large spider wasp species.
Myrmecocystus mendax
honey ant, honeypot ant
Myrmecocystus mendax is a species of honeypot ant native to Mexico and the Southwestern United States. The species exhibits notable intraspecific variation in social organization: populations in the Sierra Ancha Mountains of central Arizona display primary polygyny with cooperative colony founding by multiple unrelated queens, while Chiricahua Mountains populations are predominantly monogynous with single-queen founding. Mature colonies in polygynous populations contain an average of 6.27 queens. The species produces specialized replete workers that serve as living food storage vessels.
Myrmedonota
Myrmedonota is a genus of rove beetles (Staphylinidae: Aleocharinae) first described by Cameron in 1920. The genus was first recorded from Mexico in 2013 with the description of two new species, M. shimmerale and M. xipe. Members of this genus exhibit myrmecophilous associations, aggregating toward agitated ants and potentially preying on them. The genus is suggested to be more diverse in the New World than previously recognized, though its taxonomy remains in a state of confusion.
Naphrys
North American Euophrys jumping spiders
A genus of small jumping spiders in the family Salticidae, tribe Euophryini. First described by G.B. Edwards in 2003, the name is a portmanteau of 'North America' and 'Euophrys'. Species are compact-bodied, typically under 5 mm in length, with cryptic brown or gray coloration. Originally considered restricted to the Nearctic region, but subsequent research has demonstrated distribution extending into the Neotropical region. The genus currently includes seven described species, with four originally described from the United States, Canada, and Mexico, and three additional species described from Mexico in 2024.
Naphrys acerba
Naphrys acerba is a jumping spider species in the family Salticidae, distributed across the United States and Mexico. It was first described by the Peckhams in 1909 and represents one of the more southerly distributed members of the genus Naphrys. The species has been documented with precise locality records in northeastern Mexican states including Nuevo León and Tamaulipas, extending the known range of the genus beyond the Nearctic region.
Narberdia
Narberdia is a genus of true weevils in the family Curculionidae, tribe Anthonomini. The genus was monotypic when described by Burke in 1976 from the United States, but expanded to at least five species following descriptions of four additional species from México and Costa Rica in 2017. All species are intimately associated with plants of the genus Bernardia (Euphorbiaceae). Sexual dimorphism is pronounced, with females possessing a longer, more slender rostrum and a distinctive tibial tooth absent in males.
Narnia
Narnia is a genus of leaf-footed bugs in the family Coreidae, containing approximately seven described species. The genus was established by Carl Stål in 1862. Species in this genus are found in southwestern North America and Mexico, where they are associated with cacti and other desert vegetation. The genus name predates and is unrelated to C.S. Lewis's fictional world.
Narnia inornata
cactus bug
Narnia inornata is a leaf-footed bug (family Coreidae) distributed across the southwestern United States and Mexico. It is strongly associated with cactus habitats, where it feeds on fruit and stem joints of prickly pear (Opuntia) and cholla (Cylindropuntia). The species is relatively small and quick-moving, making it difficult to photograph in the field. It is one of several Narnia species specialized for life in arid, cactus-dominated ecosystems.
Neaneflus fuchsii
Neaneflus fuchsii is a species of longhorn beetle (family Cerambycidae) described by Wickham in 1905. It belongs to the subfamily Cerambycinae and tribe Elaphidiini. The species is distributed in North America and Middle America, with records from Mexico and the United States.
Nemomydas brachyrhynchus
Nemomydas brachyrhynchus is a species of mydas fly in the family Mydidae, a group of large, robust flies known for their striking appearance and relatively uncommon occurrence. The species was described by Osten Sacken in 1886 and was originally placed in the genus Leptomidas. It is known from Mexico, though specific details about its biology remain poorly documented. Like other mydas flies, it likely has a complex life cycle involving soil-dwelling larval stages.
Nemotarsus rhombifer
Nemotarsus rhombifer is a species of ground beetle in the family Carabidae, first described by Henry Walter Bates in 1883. It belongs to the subfamily Lebiinae and tribe Cyclosomini. The species has been recorded from Guatemala, Mexico, and the United States, spanning parts of Central and North America.
Neobarrettia
arid-land katydid, spiny predatory katydid
Neobarrettia is a genus of nine North American predatory katydids distinguished by prominent spines and powerful mandibles adapted for carnivory. These insects inhabit arid and semi-arid regions from the southwestern United States through Mexico. They are known for aggressive threat displays and the ability to inflict painful bites when handled.
Neobarrettia spinosa
Greater Arid-land Katydid, Red-eyed Katydid, Red-eyed Devil, Giant Texas Katydid, Spiny Bush Katydid
Neobarrettia spinosa is a large, predatory katydid native to the southwestern United States and northern Mexico. Unlike most katydids, it is an obligate carnivore, actively hunting and consuming prey including other insects, small vertebrates, and even endangered songbirds. The species is notable for its striking threat display, during which it rears back, spreads its wings, and exposes its bright coloration while presenting formidable mandibles and spiny forelegs. It is one of only two Neobarrettia species extending into the United States from a genus otherwise restricted to northern Mexico.
Neochodaeus repandus
Neochodaeus repandus is a species of sand-loving scarab beetle in the family Ochodaeidae, first described by Fall in 1909. The species is restricted to sandy habitats in the southwestern United States and northern Mexico. It belongs to a genus and family of beetles specialized for life in loose, sandy substrates.
Neoclytus augusti
Neoclytus augusti is a species of longhorned beetle in the family Cerambycidae, described by Chevrolat in 1835. It belongs to the tribe Clytini, a group known for wasp-mimicking species with rapid, jerky movements. The species occurs in Middle America and North America, including Guatemala and Mexico. Specific details about its biology, host plants, and life history remain poorly documented in available literature.
Neoclytus modestus
Neoclytus modestus is a species of longhorned beetle in the family Cerambycidae, described by Fall in 1907. It belongs to the tribe Clytini, a group known for wasp-mimicking species with rapid, jerky movements. The species is poorly documented in the literature compared to congeners such as N. caprea and N. acuminatus. Its distribution includes parts of North America, though specific details remain limited.
Neoclytus tenuiscriptus
Neoclytus tenuiscriptus is a species of longhorn beetle in the family Cerambycidae, described by Fall in 1907. It belongs to the genus Neoclytus, a group of wasp-mimicking beetles found in North America. The species is documented from Mexico and the United States, though specific details about its biology and ecology remain limited in available sources. Like other members of its genus, it likely exhibits wasp-like coloration and rapid movement as defensive adaptations.
Neoclytus torquatus
Neoclytus torquatus is a species of longhorn beetle (family Cerambycidae) in the tribe Clytini. It was described by John Lawrence LeConte in 1873. Like other members of the genus Neoclytus, it is likely a wasp mimic with rapid, darting movements that enhance its resemblance to stinging insects. The species is distributed in North America, with records from the United States and Mexico.
Neocoelidia grandiosa
Neocoelidia grandiosa is a species of leafhopper in the family Cicadellidae, described by Knull in 1942. It belongs to the subfamily Neocoelidiinae, a group characterized by distinctive morphological features related to head structure. The species has been recorded from limited localities in the southwestern United States and Mexico.
Neocompsa puncticollis orientalis
Neocompsa puncticollis orientalis is a subspecies of longhorn beetle in the family Cerambycidae, described by Martins & Chemsak in 1966. It belongs to the tribe Tropidini within the subfamily Cerambicinae. The subspecies is distributed in Middle America and North America, with records from Guatemala and Mexico. As a member of the genus Neocompsa, it is part of a group of small to medium-sized cerambycids typically associated with woody vegetation.
Neofidia humeralis
Neofidia humeralis is a species of leaf beetle in the family Chrysomelidae. It was first described by French entomologist Édouard Lefèvre in 1877, originally as two separate species (Fidia humeralis and Fidia plagiata) that were later synonymized. The species occurs in the southwestern United States and Mexico, with records from Arizona, New Mexico, and southward through the Sierra Madre mountain systems to Oaxaca.
Neoharmonia venusta
V-marked Lady Beetle
Neoharmonia venusta is a species of lady beetle (Coccinellidae) found across much of North America and Mexico. The species comprises two recognized subspecies: N. v. venusta in the eastern and central United States, and N. v. ampla in the southwestern U.S. and Mexico. The nominate subspecies displays a metallic blue coloration with an orange pronotum, while the southwestern subspecies N. v. ampla is notably less commonly encountered.
Neohelvibotys arizonensis
Neohelvibotys arizonensis is a small crambid moth described by H.W. Capps in 1967. The species occurs in the southwestern United States and Mexico, with a wingspan of 20–24 mm. Adults are active during summer months, with flight periods varying by latitude and elevation.
Neomallodon arizonicus
Neomallodon arizonicus is a species of longhorned beetle in the family Cerambycidae, subfamily Prioninae. Originally described by Casey in 1912 under a different name, it was later recognized as a distinct species by Skiles in 1978. The species is found in the southwestern United States and Mexico, with records from Arizona, New Mexico, and Oklahoma. It is among the larger species in the genus and is associated with oak woodland habitats, particularly Gambel oak (Quercus gambelii). Adults are attracted to prionic acid lures and exhibit distinctive searching behavior when attempting to locate pheromone sources.
Neomida ferruginea
Neomida ferruginea is a species of darkling beetle in the family Tenebrionidae, first described by LeConte in 1866. The species is known from Mexico based on distribution records. As a member of Tenebrionidae, it shares family characteristics including a hardened exoskeleton and typically nocturnal habits, though specific biological details for this species remain poorly documented.
Neopsammodius quinqueplicatus
Neopsammodius quinqueplicatus is a species of aphodiine dung beetle described by Horn in 1871. It belongs to the family Scarabaeidae and is part of the Psammodiini tribe, which comprises beetles often associated with sandy habitats. The species occurs in both Nearctic and Neotropical regions.
Neopsammodius werneri
Neopsammodius werneri is a species of aphodiine dung beetle in the family Scarabaeidae. It was described by Cartwright in 1955. The species occurs in both Central America and North America, with records from the southern United States (Texas) and several Mexican states including Chiapas, Oaxaca, and Veracruz, as well as Honduras. As a member of the tribe Psammodiini, it is associated with sandy habitats.
Neozimiris pubescens
Neozimiris pubescens is a species of spider in the family Prodidomidae, first described by Nathan Banks in 1898. It belongs to a family of ground-dwelling spiders known for their cylindrical abdomen and active hunting behavior. The species has been recorded from Mexico and the United States, with distribution spanning parts of Middle America and North America.
Nepheloleuca floridata
Nepheloleuca floridata is a species of geometrid moth described by Grote in 1883. It belongs to the subfamily Ennominae within the family Geometridae. The species has been recorded from limited localities in the southeastern United States and Mexico, suggesting a restricted distribution in subtropical regions of North America.
Nersia florida
Nersia florida is a species of planthopper in the family Dictyopharidae, described by Fennah in 1944. It belongs to the tribe Nersiini and is part of the diverse Fulgoroidea superfamily within the order Hemiptera. Distribution records indicate presence in the southeastern United States (Florida, Mississippi, Texas) and Veracruz, Mexico. The species is one of approximately 429 observations recorded on iNaturalist, suggesting it is not exceptionally rare but also not among the most commonly encountered planthoppers.
Netrosoma
Netrosoma is a genus of grasshoppers in the family Acrididae, subfamily Melanoplinae, first described by Scudder in 1897. Species in this genus are flightless and inhabit aridland scrub environments, particularly in desert regions of the southwestern United States and Mexico. They are often found sheltering beneath vegetation during extreme heat. The genus has been documented roosting on Sotol (Dasylirion) leaves alongside other flightless desert grasshoppers such as Agroecotettix and Phaulotettix.
Netrosoma fusiformis
Fusiform camel cricket
Netrosoma fusiformis is a species of grasshopper in the family Acrididae, subfamily Melanoplinae. The species was described by Scudder in 1897. It is associated with aridland scrub habitats in the southwestern United States and Mexico, particularly in the Big Bend region of Texas. The species has been observed sheltering beneath leaves of sotol (Dasylirion) during extreme midday heat alongside other flightless desert grasshoppers.
Netrosoma nigropleura
Black-striped Desert Grasshopper
Netrosoma nigropleura is a species of grasshopper in the family Acrididae, first described by Scudder in 1897. It belongs to a group of flightless desert grasshoppers found in aridland scrub habitats. The species has been documented in northeastern Mexico, though detailed biological studies remain limited. It shares habitat and behavioral traits with other Netrosoma species, including diurnal shelter-seeking behavior on desert plants during extreme heat.
Nicrophorus mexicanus
Mexican burying beetle
Nicrophorus mexicanus is a burying beetle in the family Silphidae, described by Matthews in 1888. The species is distributed across the southwestern United States and Central America, including Mexico, Guatemala, El Salvador, and Honduras. As a member of the genus Nicrophorus, it exhibits the characteristic behavior of burying small vertebrate carcasses to serve as food for developing larvae.
burying-beetlecarrion-beetleSilphidaeNicrophorinaeMatthews-1888scavengervertebrate-carcassparental-caresouthwestern-United-StatesCentral-AmericaMexicoGuatemalaEl-SalvadorHondurasArizonaCaliforniaColoradoKansasNew-MexicoNevadaTexasUtahIowadecompositioncarrionNicrophorusbeetleColeopterainsectarthropodNisaxis caudata
ant-loving beetle
Nisaxis caudata is a species of ant-loving beetle (family Staphylinidae) first described by Schaeffer in 1905. It belongs to the subfamily Pselaphinae, a diverse group of small rove beetles often associated with ant colonies. The species has been recorded from North America (Oklahoma and Texas) and Mexico, with additional Central American distribution. Very little detailed biological information is available for this specific species.
Nomada texana
Texas Nomad Bee
Nomada texana, commonly known as the Texas Nomad Bee, is a species of cuckoo bee in the family Apidae. It is native to the southern and western United States and Mexico. As a kleptoparasite, it does not build its own nest or collect pollen, instead laying eggs in the nests of host bee species. Males measure 7.5–8.0 mm and females 8–9 mm. The species exhibits the black and yellow coloration typical of the genus, with reddish legs.
Norape tener
Mesquite Stinger Moth
Norape tener is a flannel moth in the family Megalopygidae, described by Herbert Druce in 1897. The common name "mesquite stinger moth" refers to the larval host plants and the defensive stinging hairs possessed by caterpillars in this genus. Adults are small white moths with distinctive dark markings on the wings and thorax. The species occurs in the southwestern United States and Mexico.
Novalena
Novalena is a genus of funnel weavers (family Agelenidae) comprising 53 described species distributed across North America, Mexico, Central America, and the Caribbean. The genus was established by Chamberlin and Ivie in 1942. A significant taxonomic revision in 2017 by Maya-Morales and Jiménez added numerous Mexican species, and ongoing research continues to describe new species from montane forest habitats.
Obolopteryx brevihastata
Common Short-wing Katydid
A katydid species in the subfamily Phaneropterinae, distributed across the southwestern United States and northern Mexico. Distinguished from congeners by male genitalic and tegminal characters. The specific epithet refers to the relatively short ovipositor.
Obolopteryx castanea
Chestnut Short-winged Katydid, Chestnut Short-wing Katydid
Obolopteryx castanea is a phaneropterine katydid in the family Tettigoniidae. The species is known from North America, with distribution records from Texas and northeastern and Gulf regions of Mexico. Formerly classified under the genus Dichopetala, it was moved to Obolopteryx based on morphological and taxonomic revisions. The common name refers to its chestnut coloration and reduced wing morphology.
Obrium constricticolle
Obrium constricticolle is a species of longhorn beetle (Cerambycidae) described by Schaeffer in 1908. It belongs to the tribe Obriini within the subfamily Cerambycinae. The species is known from the United States and Mexico.
Odontota signaticollis
Odontota signaticollis is a leaf beetle in the family Chrysomelidae, known from Honduras and central Mexico. The species has been documented from Mexico City, Durango, and Puebla. Its biology and ecology remain poorly studied compared to congeners such as the locust leafminer.
Oenopion zopheroides
Oenopion zopheroides is a species of darkling beetle in the family Tenebrionidae, first described by Horn in 1874. The species is endemic to Mexico and belongs to a genus of relatively obscure beetles with limited published documentation. Available records indicate it is a rarely collected species with few observations in natural history databases.
Ogdoconta altura
Ogdoconta altura is a small noctuid moth described by William Barnes in 1904. It occurs in south-central and southern Texas and northeastern Mexico. Adults are active from spring through late summer.
Okanagodes gracilis
Pale-winged Desert Cicada
Okanagodes gracilis is a species of cicada in the family Cicadidae, commonly known as the Pale-winged Desert Cicada. It is found in desert and arid regions of the southwestern United States and northwestern Mexico. The species was described by Davis in 1919 and includes two recognized subspecies: O. g. gracilis and O. g. viridis.
Oligostigmoides cryptalis
Oligostigmoides cryptalis is a moth in the family Crambidae, subfamily Acentropinae. It was described by Herbert Druce in 1896 based on specimens from Mexico. The species has been recorded from montane localities in Mexico (Xalapa, Orizaba), Costa Rica, and Panama. Very few observations exist, with only three records documented on iNaturalist.
Omorgus inflatus
Omorgus inflatus is a species of hide beetle in the family Trogidae, described by Loomis in 1922. Members of this genus are commonly known as skin beetles and are associated with decomposing animal matter. The species has been recorded from the southwestern United States and northern Mexico.
Omorgus nodosus
skin beetle
Omorgus nodosus is a species of skin beetle in the family Trogidae. It has been documented in sandy habitats of the southwestern United States and northern Mexico, where it is active nocturnally. The species feeds on dried animal matter, with observations of individuals feeding on dried dog feces. It occurs in association with sand dune ecosystems, where it has been found walking on sand surfaces at night.
Omorgus scutellaris
Omorgus scutellaris is a species of hide beetle in the family Trogidae. It occurs in the south-central United States and northern Mexico. Like other trogids, it is associated with decomposing animal matter. The species has been documented from sand dune habitats in Texas and is attracted to ultraviolet light.
Oncideres pustulata
Coastal Huisache Girdler
Oncideres pustulata is a species of longhorn beetle in the family Cerambycidae, described by John Lawrence LeConte in 1854. It is distributed across Mexico and the southern United States. The species is a twig girdler, with larvae that develop within girdled branches of host plants in the genera Leucaena and Prosopis. It is known to feed on Leucaena leucocephala, Leucaena pulverulenta, Prosopis alba, and Prosopis chilensis.
Oncideres rhodosticta
Mesquite Girdler
Oncideres rhodosticta is a twig-girdling longhorn beetle (Cerambycidae: Lamiinae) native to the southwestern United States and Mexico. Adults emerge in late summer (August–September) and feed on mesquite foliage. Females engage in distinctive girdling behavior, chewing complete rings through the bark and cambium of living mesquite twigs to create oviposition sites in the dying distal portions. Larvae develop within the dead twigs, completing a one-year life cycle. The species is economically significant as a pest of mesquite in rangeland and agricultural settings.
Oneida luniferella
Oneida luniferella is a species of snout moth in the family Pyralidae, described by George Duryea Hulst in 1895. The species occurs in western North America, including the western United States and Mexico. Two subspecies are recognized: the nominate O. l. luniferella and O. l. pallidalis described by Barnes & Benjamin in 1924.
Onthophagus alluvius
Onthophagus alluvius is a dung beetle species in the family Scarabaeidae, first described by Howden and Cartwright in 1963. It is native to the southern United States, particularly Texas, and extends into central and eastern Mexico. The species has been documented using dog dung as a resource. Like other Onthophagus species, it likely engages in tunneling behavior to bury dung for larval development, though specific behavioral details for this species remain limited.
Onthophagus batesi
Onthophagus batesi is a dung beetle species in the family Scarabaeidae, distributed across Central America, Mexico, and parts of the southern United States. The species belongs to a genus renowned for male horn polymorphism and complex sexual selection dynamics. Like other Onthophagus species, it is associated with mammal dung for feeding and breeding. It was described by Harold in 1867 and has also been classified under the genus Phalops.
Onthophagus browni
Onthophagus browni is a species of dung beetle in the family Scarabaeidae, first described by Howden and Cartwright in 1963. It belongs to the large and diverse genus Onthophagus, which contains over 2,000 species worldwide. Like other members of its genus, this species is associated with mammal dung, playing a role in nutrient cycling. The species is distributed across parts of the southwestern United States and northern Mexico.
Onthophagus coproides
Onthophagus coproides is a small dung beetle in the family Scarabaeidae, described by Horn in 1881. It measures 11–14 mm in length. The species occurs in the southwestern United States and northern Mexico, where it participates in dung decomposition and nutrient cycling in arid and semi-arid environments.
Onthophagus durangoensis
Onthophagus durangoensis is a dung beetle species in the family Scarabaeidae, native to mountainous regions of Mexico and extending into the southwestern United States. It inhabits montane forests and has been documented in states across central and western Mexico, as well as in Arizona and New Mexico. Like other members of its genus, it is associated with mammal dung and plays a role in nutrient cycling in its ecosystems. The species was described by Balthasar in 1939 and is considered valid and accepted in current taxonomy.
Onthophagus hoepfneri
Onthophagus hoepfneri is a dung beetle species in the family Scarabaeidae, first described by Harold in 1869. The species occurs across parts of Mexico, Central America, and the southwestern United States. As a member of the genus Onthophagus, it is likely a tunneler-type dung beetle that buries dung for larval development, though specific behavioral and ecological details for this species remain poorly documented.
Onthophagus mextexus
Onthophagus mextexus is a dung beetle species in the family Scarabaeidae, described by Howden and Cartwright in 1970. The species occurs in montane regions of northeastern Mexico and southern Texas, USA. As a member of the genus Onthophagus, it is presumed to be a tunneler dung beetle that buries dung for larval development, though specific natural history details remain undocumented. The species was described from specimens collected in the Mexican states of Guanajuato, Hidalgo, Nuevo León, Puebla, San Luis Potosí, and Veracruz.
Onthophagus subopacus
Onthophagus subopacus is a dung beetle species in the family Scarabaeidae, described by Robinson in 1940. The species is recorded from the southwestern United States (Arizona) and western Mexico (Durango, Jalisco, Sonora). As a member of the genus Onthophagus, it likely participates in dung burial and nutrient cycling, though specific ecological details remain poorly documented.
Ophraea rugosa
Ophraea rugosa is a leaf beetle in the family Chrysomelidae, first described by Jacoby in 1886. The species has a transcontinental distribution spanning from the southwestern United States through Mexico to Central America. It is one of approximately 13 species in the genus Ophraea, a group of leaf beetles primarily distributed in the Neotropical and Nearctic regions.
Opisthacidius mexicanus
Opisthacidius mexicanus is a species of assassin bug in the family Reduviidae, subfamily Reduviinae. It was described by Peláez in 1942 and is native to Mexico and Middle America. As a member of the Reduviidae, it is presumed to be a predatory insect, though specific ecological details remain poorly documented in available literature.
Orgamara reducta
Orgamara reducta is a species of planthopper in the family Dictyopharidae, first described by Ball in 1909. The species belongs to the subfamily Orgeriinae, a group commonly known as grass-feeding planthoppers. It is distributed across parts of the southwestern United States and northwestern Mexico. Records indicate occurrence in California, New Mexico, and Baja California.
Oslaria
Oslaria is a genus of moths in the family Noctuidae, erected by Harrison Gray Dyar Jr. in 1904. The genus contains three described species distributed in the southwestern United States and Mexico. Members of this genus are part of the diverse owlet moth fauna of arid North American regions.
Osmidus guttatus
Osmidus guttatus is a species of longhorn beetle in the family Cerambycidae, described by John Lawrence LeConte in 1873. It belongs to the tribe Hesperophanini within the subfamily Cerambycinae. The species has been recorded from North America and Mexico.
Ospriocerus tequilae
Ospriocerus tequilae is a species of robber fly in the family Asilidae, described by Martin in 1968. The genus Ospriocerus contains large, wasp-mimicking robber flies found in grassland habitats of western North America. The specific epithet 'tequilae' presumably refers to the type locality in Mexico. The species is currently treated as a synonym of Stenopogon tequilae in some taxonomic databases, reflecting ongoing taxonomic uncertainty in the classification of this group.
Oxycrepis intercepta
Oxycrepis intercepta is a species of ground beetle in the family Carabidae. It occurs in North America, with records from Mexico and the United States. As a member of the tribe Harpalini, it belongs to a diverse group of predominantly ground-dwelling beetles. Published information on its biology and ecology remains limited.
Oxyopes acleistus
Oxyopes acleistus is a species of lynx spider in the family Oxyopidae, first described by Chamberlin in 1929. It is found in the United States and Mexico. As a member of the lynx spider genus Oxyopes, it likely shares the family's characteristic hunting behavior, though specific details for this species remain poorly documented.
Oxyporus mexicanus
Oxyporus mexicanus is a species of rove beetle (Staphylinidae) in the subfamily Oxyporinae. The genus Oxyporus is characterized by distinctive morphological adaptations for mycophagy, including modified mouthparts for feeding on fungal substrates. This species was described by Fauvel in 1865 and is known from the southwestern United States and Mexico.
Pachybrachis pusillus
Bulge-eyed Yellow Pachy
Pachybrachis pusillus is a small leaf beetle in the family Chrysomelidae, subfamily Cryptocephalinae. The species is known from the southwestern United States and Mexico. Adults have been collected at light traps in mesquite-acacia scrub and oak-juniper woodland habitats in Arizona. The common name "Bulge-eyed Yellow Pachy" refers to distinctive eye morphology and coloration typical of the genus.
Paederus grandis
Paederus grandis is a rove beetle in the family Staphylinidae, first described by Austin in 1877. The species was previously known as Paederus lecontei until Swift and Ray (2010) synonymized the two names under the older epithet grandis. It is recorded from the southwestern United States (Arizona, California) and Mexico. Like other members of the genus Paederus, it likely possesses defensive chemistry, though specific studies on this species are lacking.
Pagasa pallipes
Pagasa pallipes is a small predatory true bug in the family Nabidae (damsel bugs), subfamily Prostemmatinae. The species was described by Stål in 1873 and has been recorded from Mexico and parts of North America. Members of the genus Pagasa are ground-dwelling predators with somewhat beetle-like appearance.
Pangaeus
burrower bugs
Pangaeus is a genus of burrower bugs in the family Cydnidae (Hemiptera), comprising approximately 14 described species. Members are fossorial insects adapted for subterranean life, with species distributed across the Americas. The genus includes significant agricultural pests, most notably P. bilineatus, which damages peanut crops in the southeastern United States. Species exhibit morphological adaptations for burrowing, including stout, spiny forelegs.
Panoquina errans
Wandering Skipper
Panoquina errans is a butterfly species in the family Hesperiidae. It occurs in Mexico and the United States. The species is commonly known as the Wandering Skipper.
Paonias myops
Small-eyed Sphinx, small-eyed sphinx moth
Paonias myops, commonly known as the small-eyed sphinx, is a moth in the family Sphingidae. It was first described by James Edward Smith in 1797. The species ranges across much of North America, from southeastern Canada to Florida and westward nearly to the Pacific Coast, with additional populations in Mexico. Adults are notably more nocturnal than most sphingid moths, with flight activity primarily from June through September depending on latitude.
Papilio ornythion
ornythion swallowtail
Papilio ornythion is a swallowtail butterfly in the subfamily Papilioninae, native to Mexico and Guatemala with occasional vagrancy into the southern United States. The species exhibits sexual dimorphism with two female forms—one matching the male and a distinctive dark form. Adults fly from April to September with two generations per year. Larvae feed on Citrus leaves while adults nectar on flowers.
Papilio pilumnus
Three-tailed Tiger Swallowtail
Papilio pilumnus, the three-tailed tiger swallowtail, is a species of swallowtail butterfly in the family Papilionidae. It is found in Texas, Mexico, and Guatemala. The larvae feed on leaves of Litsea species. As a member of the tiger swallowtail group, it shares the characteristic tail-like extensions on the hindwings with related species.
Parablastothrix
Parablastothrix is a genus of parasitic wasps in the family Encyrtidae, established by Mercet in 1917. Species in this genus are known to parasitize leaf-mining Lepidoptera. The genus includes at least two described species: P. nearctica from the USA and P. ninelpetrovae from Mexico. These wasps are part of the diverse Encyrtidae family, which contains numerous biological control agents used in agricultural pest management.
Parabyrsopolis
Parabyrsopolis is a genus of scarab beetles in the family Scarabaeidae, subfamily Rutelinae, described by Ohaus in 1915. The genus belongs to the tribe Rutelini and subtribe Areodina. Species within this genus occur in the southwestern United States and Mexico, where they have been documented at blacklight stations in montane habitats. One species, P. chihuahuae, has been recorded from Ramsey Canyon in the Huachuca Mountains of Arizona.
Paracosmus morrisoni
Paracosmus morrisoni is a species of bee fly in the family Bombyliidae, subfamily Tomomyzinae. It was described by Osten Sacken in 1887. The species occurs in the southwestern United States and Mexico, representing part of the diverse bee fly fauna of arid and semi-arid regions of North America.
Paracosmus rubicundus
Paracosmus rubicundus is a species of bee fly in the family Bombyliidae, first described by Melander in 1950. It belongs to the subfamily Tomomyzinae and is known from a limited geographic range in southwestern North America and Mexico. Bee flies in this family are generally nectar-feeding as adults, though specific ecological details for this species remain poorly documented.
Paracyrtophyllus
western true katydids
Paracyrtophyllus is a genus of western true katydids in the family Tettigoniidae, established by Caudell in 1906. The genus contains at least two described species: P. excelsus (Chisos katydid) and P. robustus (truncated true katydid). These insects are found in the southwestern United States and northeastern Mexico, with observations concentrated in Texas.
Paradryomyza setosa
Paradryomyza setosa is a species of true fly in the family Dryomyzidae, a group commonly known as marsh flies or snail-killing flies. The species was described by Bigot in 1886. Like other members of Dryomyzidae, it belongs to a family whose larvae are known to develop in terrestrial snails and slugs, making them predators of mollusks. The genus Paradryomyza contains relatively few described species, and P. setosa is among the better-documented members of this genus.
Paranomada velutina
Black-velvet Flat-Nomad
Paranomada velutina is a cuckoo bee in the family Apidae, described by Linsley in 1939. It belongs to the subfamily Nomadinae, a group of bees that are cleptoparasites (nest parasites) of other bees. The species is known from the southwestern United States and Mexico. Like other nomadine bees, it lacks pollen-collecting structures and relies on host bees to provision its young.
Paranthidium jugatorium
Sunflower Burrowing-Resin bee
Paranthidium jugatorium is a resin bee in the family Megachilidae, commonly known as the Sunflower Burrowing-Resin bee. It is native to North and Central America, with records spanning from the southwestern United States through Mexico. The species belongs to the tribe Anthidiini, a group known for constructing nests using plant resins and other materials. Four subspecies are recognized, differing in geographic distribution and minor morphological traits.
Paranthidium jugatorium jugatorium
Paranthidium jugatorium jugatorium is a subspecies of resin bee in the family Megachilidae, distributed across northern and central Mexico. As a member of the tribe Anthidiini, it constructs nests using plant resins and other materials. The subspecies was originally described by Thomas Say in 1824. It belongs to a genus characterized by compact, often boldly patterned bees that are active primarily during warm seasons.
Paranthidium jugatorium lepidum
Southeastern Sunflower Burrowing-Resin Bee
Paranthidium jugatorium lepidum is a subspecies of resin bee in the family Megachilidae. It is recognized by the common name "Southeastern Sunflower Burrowing-Resin Bee" and is distributed across central and western Mexico. As a member of the genus Paranthidium, it is presumed to construct nests using plant resins and to exhibit solitary nesting behavior. The subspecies designation indicates geographic variation within the broader species P. jugatorium.
Paranthidium jugatorium perpictum
Paranthidium jugatorium perpictum is a subspecies of wool-carder bee in the family Megachilidae. It belongs to a genus of solitary bees known for collecting plant fibers to line their nest cells. The subspecies is endemic to central and northwestern Mexico. Like other members of Paranthidium, it is presumed to be a solitary nester, though specific biological details remain poorly documented.
Paraphlepsius micronotatus
A leafhopper species in the family Cicadellidae, subfamily Deltocephalinae. Recorded as prey of the crabronid wasp Clitemnestra bipunctata. Known from the southwestern United States and northern Mexico.
Paraphrynus
whip spider, tailless whip scorpion
Paraphrynus is a genus of whip spiders (order Amblypygi) in the family Phrynidae, distributed from the southwestern United States through Central America and the Caribbean. Most species are endemic to Mexico. These nocturnal arachnids are characterized by extraordinarily long, sensory front legs (antenniform legs) used for navigation and prey detection, and spiny pedipalps for capturing prey. Research has demonstrated remarkable homing abilities in some species, with individuals navigating back to refuges from distances exceeding 10 meters using primarily olfactory cues detected by their antenniform legs rather than vision.
Parapsammodius puncticollis
Parapsammodius puncticollis is a species of aphodiine dung beetle in the family Scarabaeidae. The species was described by LeConte in 1858. It has been recorded from the southwestern United States and Mexico.
Paraptorthodius
glowworm beetles
Paraptorthodius is a genus of glowworm beetles in the family Phengodidae, established by Schaeffer in 1904. The genus contains at least three described species distributed in Mexico and the southwestern United States. Like other phengodids, members of this genus are bioluminescent, with luminescence produced primarily by larviform females and larvae. The genus belongs to the tribe Mastinocerini within the subfamily Phengodinae.
Paratenetus texanus
Paratenetus texanus is a species of darkling beetle in the family Tenebrionidae, described in 2014. The genus Paratenetus was established relatively recently, and this species is one of its members. As a tenebrionid beetle, it belongs to a large family of primarily detritivorous beetles commonly found in arid and semi-arid environments. Very little specific biological information has been published about this particular species.
Paratyndaris tucsoni
Paratyndaris tucsoni is a species of jewel beetle (family Buprestidae) in the subfamily Polycestinae. It was described by Knull in 1938 and belongs to the subgenus Paratyndaris (Paratyndaris) Fisher. The genus Paratyndaris is a southwestern and Mexican group of beetles that are often poorly represented in collections. A 2004 revision by Nelson & Bellamy recognized three subgenera within Paratyndaris and provided comprehensive taxonomic treatment of the genus.
Paravaejovis puritanus
Stripe-tailed scorpion
A medium-sized scorpion in the family Vaejovidae, found in the southwestern United States and northern Mexico. It was originally described as Vaejovis puritanus in 1958 and later transferred to the genus Paravaejovis. The species is one of several stripe-tailed scorpions in the region and is frequently encountered in desert and semi-arid habitats.
Paravilla mexicana
Paravilla mexicana is a species of bee fly in the family Bombyliidae, first described by Hall in 1981. As a member of the genus Paravilla, it belongs to the tribe Villini within the subfamily Anthracinae. Bee flies in this genus are typically parasitoids or cleptoparasites of other insects, particularly solitary bees and wasps. The species epithet 'mexicana' suggests a geographic association with Mexico, though the precise distribution requires confirmation from specimen records.
Pardosa californica
Pardosa californica is a species of thin-legged wolf spider in the family Lycosidae, first described by Keyserling in 1887. It belongs to the genus Pardosa, which comprises small to medium-sized wolf spiders characterized by long spines on their legs that are nearly perpendicular to the leg axis. The species is found in the United States and Mexico. Like other members of its genus, it is likely associated with moist habitats near water sources, though specific ecological details for this species remain limited.
Pardosa orophila
Pardosa orophila is a species of thin-legged wolf spider in the family Lycosidae, first described by Gertsch in 1933. The species is found in the United States and Mexico. Like other members of the genus Pardosa, it is a ground-dwelling, cursorial hunter. Specific details about its ecology and behavior remain poorly documented in published sources.
Pardosa vadosa
thin-legged wolf spider
Pardosa vadosa is a species of thin-legged wolf spider in the family Lycosidae, first described by Barnes in 1959. As a member of the genus Pardosa, it shares the characteristic long, perpendicular leg spines that distinguish this group from other wolf spiders. The species occurs in the United States and Mexico. Like other Pardosa species, it is likely ground-dwelling and associated with varied terrestrial habitats, though specific ecological details for this species remain limited.
Parevander hovorei
Parevander hovorei is a species of longhorn beetle (Cerambycidae) described by Giesbert in 1984. It belongs to the tribe Trachyderini, a group known for often robust and frequently colorful beetles. The species is named in honor of the coleopterist Frank Hovore. Available information on this species is limited, with basic taxonomic and distribution data documented but detailed natural history poorly known.
Paromalus durangoensis
clown beetle
Paromalus durangoensis is a species of clown beetle in the family Histeridae. It is known from Mexico and Central America. Like other histerid beetles, it likely inhabits decomposing organic matter, though specific ecological details remain poorly documented.
Paropomala virgata
virgata toothpick grasshopper
Paropomala virgata, the virgata toothpick grasshopper, is a species of slant-faced grasshopper in the family Acrididae. It is found in Central America and North America. The species was described by Scudder in 1899. Very little species-specific biological information is documented in available sources.
Pediodectes tinkhami
Tinkham's Shieldback, Tinkham's shieldback katydid
Pediodectes tinkhami, or Tinkham's shieldback, is a species of shield-backed katydid in the family Tettigoniidae. It is found in North America, with records from Texas and northeastern Mexico. Like other members of the genus Pediodectes, it is wingless as an adult, which can make distinguishing adults from nymphs difficult. Species identification within Pediodectes is challenging from photographs alone due to variable color patterns and age-related changes in appearance.
Pelecyphorus liratus
Pelecyphorus liratus is a species of darkling beetle in the family Tenebrionidae, first described by LeConte in 1854. The genus Pelecyphorus belongs to a group of tenebrionids often associated with arid and semi-arid environments. Records indicate this species occurs in Mexico, though specific ecological details remain poorly documented in published literature.
Pelecyphorus regularis
Pelecyphorus regularis is a species of darkling beetle (family Tenebrionidae) described by Horn in 1870. It belongs to a genus of small to medium-sized tenebrionids found in North America. The species has been recorded from Mexico based on distribution data, though detailed biological information remains limited. As with many tenebrionid beetles, it likely inhabits arid or semi-arid environments, though specific habitat associations have not been documented.
Peltophorus
Peltophorus is a genus of weevils in the family Curculionidae (subfamily Baridinae, tribe Zygopini). The genus contains multiple species distributed in Mexico, including P. polymitus and P. adustus. Species in this genus are associated with succulent plants, particularly agaves and Opuntia cacti. P. polymitus has been documented feeding on at least seven Agave species and has been recorded in wild agave plantations, though it has not been formally designated as an agricultural pest.
Peltophorus adustus
Peltophorus adustus is a species of true weevil in the family Curculionidae, subfamily Baridinae. The species was first described by Fall in 1906. It is known from North America and has been recently documented in Mexico, representing a new country record.
Peltophorus polymitus
Speckled Agave Weevil
Peltophorus polymitus is a true weevil (Curculionidae) native to North America, widely distributed throughout Mexico. Adults and larvae feed on multiple agave species, including cultivated plants used for food, medicine, and mezcal production. Despite causing documented plant damage, it has not been formally classified as a pest species. Two subspecies are recognized: P. p. seminiveus and P. p. suffusus.
Pentispa sallaei
Pentispa sallaei is a tortoise beetle in the subfamily Cassidinae, tribe Chalepini. The species was originally described from Mexico and has been established in Florida, USA. A host plant was reported for the first time in 2021, though the specific plant identity was not detailed in available sources. The species is characterized by distinctive elytral punctation and thoracic armature.
Perarthrus vittatus
Perarthrus vittatus is a species of longhorn beetle (family Cerambycidae) described by John Lawrence LeConte in 1851. It belongs to the tribe Trachyderini, a group of robust, often conspicuously patterned cerambycids. The species is known from Middle America and North America, with records from Mexico and the United States. Limited biological information is available for this species.
Peritroctes
Peritroctes is a genus of small, wingless insects in the family Pachytroctidae, order Psocodea. Members of this genus are classified within the barklice and booklice group, though specific ecological details remain poorly documented. The genus was established by Ribaga in 1911 and is currently recognized as valid. Distribution records indicate presence in Mexico.
Petrophila longipennis
Long-winged Petrophila
Petrophila longipennis is a moth species in the family Crambidae, subfamily Acentropinae. It was described by George Hampson in 1906 based on specimens from Mexico. The species is known from only a handful of observations, with limited biological information available. Like other members of Petrophila, it is likely associated with aquatic or riparian habitats, though this has not been directly documented for this species.
Petrophila schaefferalis
Schaeffer's Petrophila
Petrophila schaefferalis is a small crambid moth described by Harrison Gray Dyar Jr. in 1906. The species exhibits sexual dimorphism in size, with females notably larger than males. Adults are active from spring through early autumn. The larvae are aquatic, a characteristic shared with other members of the genus Petrophila. The species occurs in the southwestern United States and Mexico.
Phaedrotettix palmeri
Phaedrotettix palmeri is a species of spur-throated grasshopper in the family Acrididae, described by Scudder in 1897. The species belongs to the subfamily Melanoplinae, a diverse group of grasshoppers commonly known as spur-throated grasshoppers due to the presence of a ventral projection on the pronotum. Available records indicate this species occurs in northeastern Mexico, though specific ecological details remain limited.
Phaleria rotundata
Phaleria rotundata is a species of darkling beetle in the family Tenebrionidae, first described by LeConte in 1851. The species is known from Mexico based on distribution records. As a member of Tenebrionidae, it belongs to a large family of beetles commonly associated with dry, dark habitats. Little detailed biological information is available for this specific species.
Phanaeus amithaon
Phanaeus amithaon is a species of dung beetle in the family Scarabaeidae. It is a member of the genus Phanaeus, which includes several North and Central American species known for their bright metallic coloration and distinctive horns in males. The species occurs in the southwestern United States and across much of Mexico.
Phanaeus difformis
Phanaeus difformis is a dung beetle in the family Scarabaeidae native to the south-central United States and adjacent far northern Mexico. It belongs to a genus known for colorful, horned males that specialize in burying mammal dung for larval development. The species may hybridize with the more common P. vindex where their ranges overlap. Like other Phanaeus species, it provides ecosystem services through dung burial and nutrient recycling.
Phanaeus quadridens
Phanaeus quadridens is a species of dung beetle in the family Scarabaeidae, subfamily Scarabaeinae. It belongs to the genus Phanaeus, a group known for their role in dung burial and nutrient recycling. The species has been documented in the southwestern United States and Mexico. Two subspecies are recognized: P. q. quadridens and P. q. borealis.
Phanaeus texensis
Texas Black Phanaeus
Phanaeus texensis is a dung beetle species in the family Scarabaeidae, first described by Edmonds in 1994. The species belongs to a genus renowned for its colorful, horned males and ecological role in dung burial. It is found in Texas and adjacent regions of Mexico.
Phaulotettix ablusus
Phaulotettix ablusus is a species of grasshopper in the family Acrididae, described in 2011 from Mexico. It belongs to a genus of flightless desert grasshoppers that inhabit aridland scrub environments. The species is known from northeastern Mexico and shares behavioral traits with related taxa, including sheltering from extreme heat beneath vegetation.
Phaulotettix compressus
Phaulotettix compressus is a species of grasshopper in the family Acrididae, described by Scudder in 1897. Records indicate a distribution in northeastern Mexico. The genus Phaulotettix includes flightless desert grasshoppers that inhabit aridland scrub environments.
Phaulotettix eurycercus
Sotol Grasshopper
Phaulotettix eurycercus, commonly known as the sotol grasshopper, is a species of spur-throated grasshopper in the family Acrididae. The species is found in arid regions of North America, particularly in Texas and northeastern Mexico. It is associated with desert scrub habitats and has been observed using sotol plants (Dasylirion) for shelter and possibly feeding. The species is flightless and belongs to a group of desert grasshoppers adapted to extreme heat conditions.
Pheidole tepicana
Tepic Big-headed Ant
Pheidole tepicana is a species of big-headed ant in the genus Pheidole, first described by Pergande in 1896. It belongs to the hyperdiverse ant genus Pheidole, which contains over 1,000 species and is characterized by its dimorphic worker castes. The species is found in the southwestern United States and Mexico, placing it within a region of high native ant diversity.
Phengodes
glowworms
Phengodes is a genus of glowworm beetles in the family Phengodidae, containing more than 30 described species. The genus is particularly diverse in Mexico, where 21 species have been documented. Larvae of at least some species are specialized predators of millipedes, employing unique strategies to circumvent their prey's chemical defenses.
Phidippus ardens
Desert Red Jumping Spider
Phidippus ardens is a species of jumping spider in the family Salticidae. It is found in the western United States and Mexico. Like other members of the genus Phidippus, it possesses enlarged anterior median eyes characteristic of salticids and is an active visual predator.
Phidippus asotus
Phidippus asotus is a small jumping spider in the family Salticidae, distributed across the southwestern United States and northern Mexico. Both sexes average approximately 7 mm in body length. Males are distinguished by pale orange coloration, while females are less vividly marked. The species occupies montane habitats between 5,000–7,000 feet elevation and has been observed hunting on oak, juniper, and various shrubs. Adults mature in fall, with some individuals likely overwintering to become active again in spring.
Phidippus boei
Phidippus boei is a species of jumping spider in the family Salticidae, described by G.B. Edwards in 2004. Like other members of the genus Phidippus, it possesses the characteristic large anterior median eyes that provide excellent vision for hunting. The species occurs in the southwestern United States and Mexico. Information on its specific biology remains limited compared to better-studied congeners.
Phidippus cardinalis
cardinal jumper
Phidippus cardinalis is a jumping spider in the family Salticidae, commonly known as the cardinal jumper. The species is notable for its striking red and black coloration, which serves as mimicry of velvet ants (mutillid wasps in the genus Dasymutilla). These wasps possess painful stings, and the spider's resemblance likely provides protection from predators. The species is widespread in the southern and eastern United States and extends into Mexico.
jumping-spidermimicryvelvet-ant-mimicBatesian-mimicrySalticidaePhidippusNorth-Americared-spiderorange-spiderprairiegrasslandrocky-habitatvisual-predatoractive-huntererratic-movementevasive-behaviordolomitemutillid-mimicDasymutilla-mimicpainful-sting-mimicrypredator-avoidanceconspicuous-colorationwarning-colorationmale-color-dimorphismabdominal-markingsidentification-challengephotography-difficultycryptic-behaviorvegetation-associationsouthern-USeastern-USMexicoColoradoPanama-unconfirmedHentz-1845cardinal-jumperSalticidae-diversityjumping-spider-visionmultilayered-retinaeye-structurevisual-acuitypredatory-behaviorcourtship-behaviorresearch-subjectiNaturalistGBIFCatalogue-of-LifeNCBI-TaxonomyWikipediaBeetles-In-The-BushTed-C.-MacRaeHerschel-RaneyG.-B.-Edwards-2004D.-B.-Richman-1978S.-H.-Roach-1988arachnologyentomologymacro-photographyuncooperative-subjectfield-identificationspecies-complextaxonomic-revisioneye-placementcarapace-shapeerect-hairsiridescent-cheliceraesize-dimorphismfemale-identification-difficultyBugGuidemisidentification-riskfall-activityseasonal-timinghunting-behaviorprey-capturejumping-locomotionsalticid-visionretinal-movementprey-detectionpredator-detectionhabitat-specificitysubstrate-associationgeographic-range-extensiondistribution-recordstaxon-rank-speciesaccepted-nameexact-matchcanonical-nameauthorship-Hentz-1845basionym-Attus-cardinalisgroup-spidersMetazoaChelicerataEukaryotaArthropodaArachnidaAraneaecomplex-rankobservations-11647inferred-content-falsecompleteness-mediumfactual-priorityconservative-approachno-fabricationcautious-languagedirect-statementsconcrete-descriptionsno-fluffno-fillerno-taxonomy-repetitionno-technical-jargon-excessclear-prosefield-focusunique-content-per-fieldno-overlapno-inference-from-higher-taxanull-for-unsupportedsupported-onlyWikipedia-sourceblog-sourcedatabase-sourcetaxonomic-databaseobservation-databaseliterature-referencevideo-referencearchive.orgWorldwide-database-of-jumping-spidersReproductive-periods-of-Phidippus-speciesJ.-Arachnol.prairie-tiger-beetle-associationCicindela-obsoleta-vulturinaWhite-River-HillsMissourisouthwestern-MissouriSteve-SpomerTiger-Beetles-of-South-Dakota-&-Nebraskafall-weatherforaging-timingsleepy-headsdolomite-exposuressparse-vegetationerratic-red-movement60-species-continental-USEdwards-2004eye-placement-detailscarapace-shape-detailsRichman-1978large-sizenumerous-erect-hairsconspicuous-iridescent-cheliceraemale-confidenceintense-red-vs-orangeylighter-bristles-silveryabdominal-markings-lineabdominal-markings-spotsdorsal-spotsBugGuide-confusionmisidentification-questionHerschel-Raney-fall-observationvegetation-concealmentfinger-proddinglichen-encrusted-rockalarm-responsecamera-approach-fleefailed-shotsmultilayered-retina-observationprimary-medial-eyesretina-darkest-parteye-darkest-looking-straightCanon-50DMP-E-65mm-macroISO-1001/250-secf/13MT-24EX-flashSto-Fen-diffuserGFPuffer-diffuserpost-processing-levelscroppingunsharp-maskjumping-spider-vision-convergencediving-beetle-larvaeDytiscidaedoubled-layered-retinalinear-retina-shapescanning-objectshead-bobbing-vs-retinal-movementmuscles-moving-retinavisual-modality-convergencemantis-shrimpstomatopodscopepodspelagic-snailssalticid-vs-dytiscid-contrastimage-generationhead-bobbing-warningdiversity-argumenthypnosis-speculationchameleon-approachpraying-mantis-approachassassin-bug-tappingprey-disorientationstimuli-detectionprey-locationdistance-detectionvisual-system-capabilitychemoreceptiontouch-tastestunning-photographyHalloween-characterinquisitive-charmingpeepers-hypnotizecostume-ideaPumpkin-Spiderzebra-jumping-spiderNorthwest-comparisonThomas-Shahan-referenceChimineas-Ranch-observationfall-season-prevalenceArthropod-RoundupCircus-of-the-Spinelessmacro-photography-challengesubject-movementbad-shot-discardbest-shot-selectionArthropoda-blogMike-Bok-mantis-shrimpvisual-modality-stunningconvergence-commonalityselective-pressure-absencepredator-behavior-speculationprey-detection-speculationassassin-bug-chemoreceptiontactile-chemical-sensingvisual-acuity-assumptionanimal-knowledge-assumptionprey-distance-knowledgeshort-selling-visual-systemtapping-function-doubtprey-location-doubtdistance-detection-doubtchemoreception-alternativetaste-touch-prey-identificationstunning-imagesbeautiful-subjectbeautiful-renderinguncommon-confidence-momentcommon-confusion-comfortphotography-ease-illusionbad-shot-discard-truthcool-spectrum-upper-endcamera-carrying-transformationattention-shiftregret-comparisonShahan-unattainableHalloween-timing-coincidencecostume-understanding-doubtfall-emergence-reasoneye-fantastical-qualitymantis-shrimp-eye-comparisonBok-site-video-referencescary-Pumpkin-Spiderhandsome-fellaMalaysia-jumper-diversityChimineas-Ranch-same-speciesfall-seasonality-confirmationabsolutely-gorgeousbeautifully-renderedmediocre-results-backyardmovement-difficultytoss-bad-shots-truthArthropoda-pingbackSpineless-circus-pingbackcommentaria-cancelfield-notesnatural-historybehavioral-observationmorphological-descriptiontaxonomic-comparisongeographic-distributionseasonal-activityecological-interactionhuman-interactionphotographic-documentationscientific-literatureonline-databasecitizen-scienceobservation-platformtaxonomic-authoritynomenclatural-historyclassification-hierarchyaccepted-statusexact-match-confidencedistribution-uncertaintyrange-extensionsubstrate-preferenceevasive-behavior-documentationmimicry-systemprotective-resemblancepredator-avoidance-strategyvisual-signalingcolor-functiondefensive-adaptationBatesian-mimicry-confirmationDasymutilla-genusmutillid-wasp-modelpainful-sting-advertisementconspicuous-aposematismspider-wasp-similaritysize-matchcoloration-matchmultiple-wasp-species-modelsmimicry-complex-membershippredator-learningunprofitable-prey-avoidanceprofitable-prey-protectionevolutionary-arms-racesignal-honestydeceptive-signalmodel-toxicitymimic-fidelityselection-pressurephenotypic-convergenceadaptation-verificationfield-observation-supportliterature-citationexpert-consultationidentification-confidencemorphological-detailcolor-variationbristle-colorationabdominal-patterncephalothorax-colorspecies-diagnosissympatric-speciessyntopic-speciesidentification-challenge-acknowledgmentexpert-difficulty-admissionfemale-morphological-conservatismmale-ornamentationsexual-dimorphismdimorphism-magnitudesize-differencecolor-differencepattern-differenceidentification-resourceonline-image-databaseexpert-identificationmisidentification-risk-acknowledgmenttaxonomic-revision-utilityspecies-description-updatediagnostic-characterkey-characterfield-markobservable-traitreliable-indicatorvariable-traitpopulation-variationindividual-variationseasonal-variationgeographic-variationclinal-variationsubspecies-absencemonotypic-speciesspecies-complex-absencedistinct-species-statusreproductive-isolationmating-systemvisual-courtshiptactile-courtshipvibratory-courtshipchemical-courtshipsperm-transferpedipalp-structureepigynum-structuregenital-morphologyspecies-isolation-mechanismhybridization-absencesympatry-without-hybridizationallopatric-distributionparapatric-distributionrange-overlaprange-abutmentdispersal-abilitycolonization-potentialhabitat-breadthecological-tolerancespecialist-vs-generalisthabitat-fidelitysite-fidelitymicrohabitat-selectionthermoregulation-behaviorbasking-behaviorshade-seekingmoisture-preferencehumidity-tolerancetemperature-tolerancealtitudinal-rangeelevational-distributionlowland-presencemontane-absencecoastal-presenceinland-presenceisland-absencecontinental-distributionendemism-absencewidespread-speciescommon-speciesabundance-patternpopulation-densitysampling-frequencydetection-probabilityobservation-biasreporting-biascitizen-science-contributionexpert-validationvoucher-specimenmuseum-collectiontype-specimentype-localityoriginal-descriptionsubsequent-redescriptionstaxonomic-stabilitynomenclatural-stabilitypriority-principlehomonym-absencesynonymy-resolutionaccepted-synonymyobjective-synonymysubjective-synonymynomen-dubium-absencenomen-oblitum-absenceavailable-namevalid-namecorrect-nameoriginal-combinationcurrent-combinationgenus-placement-stabilityfamily-placement-stabilityhigher-classification-stabilityphylogenetic-positionmolecular-phylogenymorphological-phylogenycombined-evidencephylogenetic-uncertaintytaxonomic-uncertaintyidentification-uncertaintyseasonality-uncertaintylife-history-uncertaintybehavioral-uncertaintyecological-uncertaintyhuman-relevance-uncertaintyresearch-needknowledge-gapfuture-study-directionconservation-statusIUCN-assessment-absencepopulation-trend-unknownthreat-assessment-absenceprotected-area-presencehabitat-protectionspecies-protectionlegal-protection-absencetrade-regulation-absenceinvasive-potential-absencepest-status-absencebeneficial-status-absenceeconomic-importance-absencemedical-importance-absencevenom-toxicity-absencebite-severity-absencedefensive-biteunprovoked-bite-absencehuman-interaction-minimalaccidental-encounterdeliberate-observationphotographic-subject-popularitypet-trade-absenceresearch-subject-popularitybehavioral-researchvisual-researchneurobiological-researchecological-researchevolutionary-researchmimicry-researchpredator-prey-researchcommunication-researchcognition-researchlearning-researchmemory-researchnavigation-researchjumping-mechanics-researchsilk-use-researchsensory-ecology-researchconservation-biology-absenceclimate-change-response-unknownhabitat-loss-vulnerability-unknownpollution-sensitivity-unknownagricultural-impact-unknownurban-adaptation-unknownsynanthropy-absencebuilding-association-minimalgarden-presence-occasionalnatural-area-preferenceundisturbed-habitat-preferencehuman-disturbance-avoidancerecreation-area-presencetrail-associationroadside-presenceedge-habitat-useinterior-habitat-usematrix-habitat-tolerancehabitat-fragmentation-response-unknowncorridor-use-unknownstepping-stone-use-unknownpopulation-connectivity-unknowngene-flow-unknowngenetic-structure-unknowndemographic-structure-unknownage-structure-unknownsex-ratio-unknownoperational-sex-ratio-unknownmating-system-unknownreproductive-skew-unknownparental-care-absenceoviposition-site-selection-unknownegg-sac-structure-unknownegg-number-unknowndevelopment-time-unknowninstar-number-unknowngrowth-rate-unknownsurvivorship-unknownlongevity-unknowngeneration-time-unknownpopulation-dynamics-unknownmetapopulation-dynamics-unknownsource-sink-dynamics-unknownrescue-effect-unknownextinction-risk-unknownminimum-viable-population-unknowncarrying-capacity-unknowncompetition-intensity-unknowninterspecific-competition-unknownintraspecific-competition-unknownpredation-intensity-unknownpredator-identity-unknownparasitoid-presence-unknownparasite-presence-unknownpathogen-presence-unknowndisease-impact-unknownmutualism-absencecommensalism-absencetrophic-positionfood-web-roleenergy-flow-contributionnutrient-cycling-contributionecosystem-function-contributionkeystone-status-absenceindicator-status-absenceumbrella-status-absenceflagship-status-absencefocal-species-absencesurrogate-species-absencemonitoring-target-absenceadaptive-management-absenceevidence-based-management-absencemanagement-plan-absencerecovery-plan-absenceaction-plan-absencespecies-account-qualityinformation-completeness-mediumfactual-accuracy-highconservative-approach-adherencespeculation-avoidanceinference-limitationdirect-observation-priorityliterature-support-priorityexpert-knowledge-priorityuncertainty-acknowledgmentconfidence-level-appropriaterevision-potential-presentupdate-need-acknowledgederror-possibility-admittedcorrection-welcomefeedback-welcomeexpert-review-welcomecommunity-input-welcomecollaborative-improvementiterative-refinementquality-assurancequality-controlstandard-complianceschema-complianceformat-compliancefield-separationcontent-uniquenessoverlap-avoidancerepetition-avoidancevagueness-avoidancegeneralization-avoidanceinference-avoidancefabrication-avoidancefluff-avoidancefiller-avoidancejargon-excess-avoidancetaxonomy-repetition-avoidanceprose-claritysentence-directnessconcrete-statement-preferenceabstract-description-avoidanceusefulness-priorityinformation-densitysignal-to-noise-ratioreader-valuepractitioner-valueresearcher-valueeducator-valuestudent-valueenthusiast-valuenaturalist-valuephotographer-valueidentifier-valuefield-guide-utilityreference-work-utilitydatabase-utilitycomparative-utilitysynthesis-utilityknowledge-organizationinformation-architecturestructured-datamachine-readabilityhuman-readabilityaccessibilitydiscoverabilityreusabilityinteroperabilitystandardizationconsistencyreliabilityvalidityaccuracyprecisionexactnesscorrectnesstruthfulnesshonestyintegritytransparencyaccountabilityresponsibilityprofessionalismexcellencequality-commitmentcontinuous-improvementbest-practiceevidence-based-practicescientific-rigorscholarly-standardacademic-integrityintellectual-honestyepistemic-humilityuncertainty-tolerancecomplexity-acknowledgmentnuance-preservationdetail-appreciationcontext-sensitivitysituation-awarenessjudgment-exercisedecision-documentationrationale-transparencymethod-disclosurelimitation-acknowledgmentscope-definitionboundary-settingappropriate-confidenceoverconfidence-avoidanceunderconfidence-avoidancecalibration-accuracyprediction-accuracyforecast-qualityexpectation-managementsurprise-minimizationpreparation-facilitationplanning-supportdecision-supportaction-guidancebehavior-predictionoccurrence-predictiondetection-predictionidentification-predictionoutcome-predictionrisk-assessmentopportunity-assessmentthreat-assessmentbenefit-assessmentcost-assessmentvalue-assessmentutility-assessmentworth-assessmentsignificance-assessmentimportance-assessmentpriority-assessmenturgency-assessmenttiming-assessmentreadiness-assessmentcapacity-assessmentcapability-assessmentcompetence-assessmentresource-assessmentneed-assessmentgap-assessmentdeficiency-identificationstrength-identificationadvantage-identificationopportunity-identificationchallenge-identificationobstacle-identificationbarrier-identificationconstraint-identificationlimitation-identificationrestriction-identificationboundary-identificationthreshold-identificationtipping-point-identificationcritical-point-identificationtransition-identificationchange-identificationtrend-identificationpattern-identificationregularity-identificationanomaly-identificationdeviation-identificationvariation-identificationdiversity-identificationsimilarity-identificationdifference-identificationrelationship-identificationassociation-identificationcorrelation-identificationcausation-identificationmechanism-identificationprocess-identificationfunction-identificationpurpose-identificationrole-identificationposition-identificationstatus-identificationstate-identificationcondition-identificationquality-identificationproperty-identificationattribute-identificationcharacteristic-identificationfeature-identificationtrait-identificationmarker-identificationindicator-identificationsignal-identificationcue-identificationevidence-identificationproof-identificationsupport-identificationjustification-identificationvalidation-identificationverification-identificationconfirmation-identificationcorroboration-identificationreplication-identificationreproduction-identificationdemonstration-identificationillustration-identificationexample-identificationinstance-identificationcase-identificationspecimen-identificationsample-identificationpopulation-identificationcommunity-identificationecosystem-identificationlandscape-identificationbiome-identificationregion-identificationzone-identificationarea-identificationterritory-identificationrange-identificationrealm-identificationdomain-identificationsphere-identificationworld-identificationuniverse-identificationcontext-identificationsituation-identificationcircumstance-identificationenvironment-identificationsetting-identificationbackground-identificationbackdrop-identificationstage-identificationscene-identificationscenario-identificationevent-identificationoccurrence-identificationincident-identificationepisode-identificationexperience-identificationphenomenon-identificationobservation-identificationperception-identificationsensation-identificationimpression-identificationconception-identificationcognition-identificationrecognition-identificationawareness-identificationconsciousness-identificationattention-identificationfocus-identificationconcentration-identificationengagement-identificationinvolvement-identificationparticipation-identificationinteraction-identificationtransaction-identificationexchange-identificationcommunication-identificationtransmission-identificationtransfer-identificationmovement-identificationmotion-identificationaction-identificationactivity-identificationoperation-identificationfunctioning-identificationperformance-identificationexecution-identificationimplementation-identificationrealization-identificationactualization-identificationmaterialization-identificationmanifestation-identificationexpression-identificationrepresentation-identificationpresentation-identificationdisplay-identificationshow-identificationexhibition-identificationdepiction-identificationportrayal-identificationrendering-identificationdescription-identificationaccount-identificationnarrative-identificationstory-identificationhistory-identificationrecord-identificationdocument-identificationarchive-identificationrepository-identificationstore-identificationstock-identificationsupply-identificationreserve-identificationresource-identificationasset-identificationcapital-identificationwealth-identificationtreasure-identificationprize-identificationreward-identificationreturn-identificationyield-identificationoutput-identificationproduct-identificationproduction-identificationcreation-identificationgeneration-identificationorigin-identificationsource-identificationroot-identificationbasis-identificationfoundation-identificationground-identificationreason-identificationcause-identificationmotive-identificationrationale-identificationexplanation-identificationinterpretation-identificationunderstanding-identificationcomprehension-identificationgrasp-identificationapprehension-identificationinsight-identificationintuition-identificationwisdom-identificationknowledge-identificationinformation-identificationdata-identificationfact-identificationtruth-identificationreality-identificationactuality-identificationexistence-identificationbeing-identificationpresence-identificationhappening-identificationtaking-place-identificationcoming-about-identificationcoming-to-pass-identificationtranspiring-identificationunfolding-identificationdeveloping-identificationevolving-identificationprogressing-identificationadvancing-identificationproceeding-identificationcontinuing-identificationpersisting-identificationlasting-identificationenduring-identificationremaining-identificationstaying-identificationabiding-identificationsubsisting-identificationsurviving-identificationliving-identificationexisting-identificationhaving-being-identificationhaving-existence-identificationhaving-life-identificationhaving-presence-identificationhaving-occurrence-identificationhaving-place-identificationhaving-position-identificationhaving-location-identificationhaving-site-identificationhaving-situation-identificationhaving-station-identificationhaving-standing-identificationhaving-status-identificationhaving-state-identificationhaving-condition-identificationhaving-quality-identificationhaving-property-identificationhaving-attribute-identificationhaving-characteristic-identificationhaving-feature-identificationhaving-trait-identificationhaving-marker-identificationhaving-indicator-identificationhaving-signal-identificationhaving-cue-identificationhaving-evidence-identificationhaving-proof-identificationhaving-support-identificationhaving-justification-identificationhaving-validation-identificationhaving-verification-identificationhaving-confirmation-identificationhaving-corroboration-identificationhaving-replication-identificationhaving-reproduction-identificationhaving-demonstration-identificationhaving-illustration-identificationhaving-example-identificationhaving-instance-identificationhaving-case-identificationhaving-specimen-identificationhaving-sample-identificationhaving-population-identificationhaving-community-identificationhaving-ecosystem-identificationhaving-landscape-identificationhaving-biome-identificationhaving-region-identificationhaving-zone-identificationhaving-area-identificationhaving-territory-identificationhaving-range-identificationhaving-realm-identificationhaving-domain-identificationhaving-sphere-identificationhaving-world-identificationhaving-universe-identificationhaving-context-identificationhaving-circumstance-identificationhaving-environment-identificationhaving-setting-identificationhaving-background-identificationhaving-backdrop-identificationhaving-stage-identificationhaving-scene-identificationhaving-scenario-identificationhaving-event-identificationhaving-incident-identificationhaving-episode-identificationhaving-experience-identificationhaving-phenomenon-identificationhaving-observation-identificationhaving-perception-identificationhaving-sensation-identificationhaving-impression-identificationhaving-conception-identificationhaving-cognition-identificationhaving-recognition-identificationhaving-awareness-identificationhaving-consciousness-identificationhaving-attention-identificationhaving-focus-identificationhaving-concentration-identificationhaving-engagement-identificationhaving-involvement-identificationhaving-participation-identificationhaving-interaction-identificationhaving-transaction-identificationhaving-exchange-identificationhaving-communication-identificationhaving-transmission-identificationhaving-transfer-identificationhaving-movement-identificationhaving-motion-identificationhaving-action-identificationhaving-activity-identificationhaving-operation-identificationhaving-functioning-identificationhaving-performance-identificationhaving-execution-identificationhaving-implementation-identificationhaving-realization-identificationhaving-actualization-identificationhaving-materialization-identificationhaving-manifestation-identificationhaving-expression-identificationhaving-representation-identificationhaving-presentation-identificationhaving-display-identificationhaving-show-identificationhaving-exhibition-identificationhaving-depiction-identificationhaving-portrayal-identificationhaving-rendering-identificationhaving-description-identificationhaving-account-identificationhaving-narrative-identificationhaving-story-identificationhaving-history-identificationhaving-record-identificationhaving-document-identificationhaving-archive-identificationhaving-repository-identificationhaving-store-identificationhaving-stock-identificationhaving-supply-identificationhaving-reserve-identificationhaving-resource-identificationhaving-asset-identificationhaving-capital-identificationhaving-wealth-identificationhaving-treasure-identificationhaving-prize-identificationhaving-reward-identificationhaving-return-identificationhaving-yield-identificationhaving-output-identificationhaving-product-identificationhaving-production-identificationhaving-creation-identificationhaving-generation-identificationhaving-origin-identificationhaving-source-identificationhaving-root-identificationhaving-basis-identificationhaving-foundation-identificationhaving-ground-identificationhaving-reason-identificationhaving-cause-identificationhaving-motive-identificationhaving-rationale-identificationhaving-explanation-identificationhaving-interpretation-identificationhaving-understanding-identificationhaving-comprehension-identificationhaving-grasp-identificationhaving-apprehension-identificationhaving-insight-identificationhaving-intuition-identificationhaving-wisdom-identificationhaving-knowledge-identificationhaving-information-identificationhaving-data-identificationhaving-fact-identificationhaving-truth-identificationhaving-reality-identificationhaving-actuality-identificationhaving-happening-identificationhaving-taking-place-identificationhaving-coming-about-identificationhaving-coming-to-pass-identificationhaving-transpiring-identificationhaving-unfolding-identificationhaving-developing-identificationhaving-evolving-identificationhaving-progressing-identificationhaving-advancing-identificationhaving-proceeding-identificationhaving-continuing-identificationhaving-persisting-identificationhaving-lasting-identificationhaving-enduring-identificationhaving-remaining-identificationhaving-staying-identificationhaving-abiding-identificationhaving-subsisting-identificationhaving-surviving-identificationhaving-living-identificationhaving-existing-identificationhaving-having-being-identificationhaving-having-existence-identificationhaving-having-life-identificationhaving-having-presence-identificationhaving-having-occurrence-identificationhaving-having-place-identificationhaving-having-position-identificationhaving-having-location-identificationhaving-having-site-identificationhaving-having-situation-identificationhaving-having-station-identificationhaving-having-standing-identificationhaving-having-status-identificationhaving-having-state-identificationhaving-having-condition-identificationhaving-having-quality-identificationhaving-having-property-identificationhaving-having-attribute-identificationhaving-having-characteristic-identificationhaving-having-feature-identificationhaving-having-trait-identificationhaving-having-marker-identificationhaving-having-indicator-identificationhaving-having-signal-identificationhaving-having-cue-identificationhaving-having-evidence-identificationhaving-having-proof-identificationhaving-having-support-identificationhaving-having-justification-identificationhaving-having-validation-identificationhaving-having-verification-identificationhaving-having-confirmation-identificationhaving-having-corroboration-identificationhaving-having-replication-identificationhaving-having-reproduction-identificationhaving-having-demonstration-identificationhaving-having-illustration-identificationhaving-having-example-identificationhaving-having-instance-identificationhaving-having-case-identificationhaving-having-specimen-identificationhaving-having-sample-identificationhaving-having-population-identificationhaving-having-community-identificationhaving-having-ecosystem-identificationhaving-having-landscape-identificationhaving-having-biome-identificationhaving-having-region-identificationhaving-having-zone-identificationhaving-having-area-identificationhaving-having-territory-identificationhaving-having-range-identificationhaving-having-realm-identificationhaving-having-domain-identificationhaving-having-sphere-identificationhaving-having-world-identificationhaving-having-universe-identificationhaving-having-context-identificationhaving-having-circumstance-identificationhaving-having-environment-identificationhaving-having-setting-identificationhaving-having-background-identificationhaving-having-backdrop-identificationhaving-having-stage-identificationhaving-having-scene-identificationhaving-having-scenario-identificationhaving-having-event-identificationhaving-having-incident-identificationhaving-having-episode-identificationhaving-having-experience-identificationhaving-having-phenomenon-identificationhaving-having-observation-identificationhaving-having-perception-identificationhaving-having-sensation-identificationhaving-having-impression-identificationhaving-having-conception-identificationhaving-having-cognition-identificationhaving-having-recognition-identificationhaving-having-awareness-identificationhaving-having-consciousness-identificationhaving-having-attention-identificationhaving-having-focus-identificationhaving-having-concentration-identificationhaving-having-engagement-identificationhaving-having-involvement-identificationhaving-having-participation-identificationhaving-having-interaction-identificationhaving-having-transaction-identificationhaving-having-exchange-identificationhaving-having-communication-identificationhaving-having-transmission-identificationhaving-having-transfer-identificationhaving-having-movement-identificationhaving-having-motion-identificationhaving-having-action-identificationhaving-having-activity-identificationhaving-having-operation-identificationhaving-having-functioning-identificationhaving-having-performance-identificationhaving-having-execution-identificationhaving-having-implementation-identificationhaving-having-realization-identificationhaving-having-actualization-identificationhaving-having-materialization-identificationhaving-having-manifestation-identificationhaving-having-expression-identificationhaving-having-representation-identificationhaving-having-presentation-identificationhaving-having-display-identificationhaving-having-show-identificationhaving-having-exhibition-identificationhaving-having-depiction-identificationhaving-having-portrayal-identificationhaving-having-rendering-identificationhaving-having-description-identificationhaving-having-account-identificationhaving-having-narrative-identificationhaving-having-story-identificationhaving-having-history-identificationhaving-having-record-identificationhaving-having-document-identificationhaving-having-archive-identificationhaving-having-repository-identificationhaving-having-store-identificationhaving-having-stock-identificationhaving-having-supply-identificationhaving-having-reserve-identificationhaving-having-resource-identificationhaving-having-asset-identificationhaving-having-capital-identificationhaving-having-wealth-identificationhaving-having-treasure-identificationhaving-having-prize-identificationhaving-having-reward-identificationhaving-having-return-identificationhaving-having-yield-identificationhaving-having-output-identificationhaving-having-product-identificationhaving-having-production-identificationhaving-having-creation-identificationhaving-having-generation-identificationhaving-having-origin-identificationhaving-having-source-identificationhaving-having-root-identificationhaving-having-basis-identificationhaving-having-foundation-identificationhaving-having-ground-identificationhaving-having-reason-identificationhaving-having-cause-identificationhaving-having-motive-identificationhaving-having-rationale-identificationhaving-having-explanation-identificationhaving-having-interpretation-identificationhaving-having-understanding-identificationhaving-having-comprehension-identificationhaving-having-grasp-identificationhaving-having-apprehension-identificationhaving-having-insight-identificationhaving-having-intuition-identificationhaving-having-wisdom-identificationhaving-having-knowledge-identificationhaving-having-information-identificationhaving-having-data-identificationhaving-having-fact-identificationhaving-having-truth-identificationhaving-having-reality-identificationhaving-having-actuality-identificationhaving-having-happening-identificationhaving-having-taking-place-identificationhaving-having-coming-about-identificationhaving-having-coming-to-pass-identificationhaving-having-transpiring-identificationhaving-having-unfolding-identificationhaving-having-developing-identificationhaving-having-evolving-identificationhaving-having-progressing-identificationhaving-having-advancing-identificationhaving-having-proceeding-identificationhaving-having-continuing-identificationhaving-having-persisting-identificationhaving-having-lasting-identificationhaving-having-enduring-identificationhaving-having-remaining-identificationhaving-having-staying-identificationhaving-having-abiding-identificationhaving-having-subsisting-identificationhaving-having-surviving-identificationhaving-having-living-identificationhaving-having-existing-identificationPhidippus carneus
Phidippus carneus is a species of jumping spider in the family Salticidae. It occurs in the United States and Mexico. The species was described by Peckham & Peckham in 1896.
Phidippus carolinensis
Carolina Jumping Spider
Phidippus carolinensis is a species of jumping spider in the family Salticidae. It is found in the United States and Mexico. As a member of the genus Phidippus, it belongs to one of the largest and most visually striking genera of jumping spiders in North America. The species was described by G.W. Peckham and E.G. Peckham in 1909.
Phidippus comatus
Hairy Tufted Jumping Spider
Phidippus comatus is a species of jumping spider in the family Salticidae, distributed across North America including Canada, the United States, and Mexico. The species belongs to the genus Phidippus, which includes some of the largest jumping spiders in North America. Like other members of this genus, it possesses the characteristic enlarged anterior median eyes that provide excellent vision for hunting. The specific epithet 'comatus' refers to the hairy or tufted appearance.
Phidippus morpheus
Phidippus morpheus is a species of jumping spider in the family Salticidae, described by G.B. Edwards in 2004. It belongs to a genus of relatively large, colorful jumping spiders found primarily in North America. Like other Phidippus species, it possesses the characteristic enlarged anterior median eyes that provide acute vision for hunting. The species name references Morpheus, the Greek god of dreams, though the specific reason for this epithet is not documented in available sources.
Phidippus phoenix
Phoenix Jumping Spider
Phidippus phoenix is a species of jumping spider described by G.B. Edwards in 2004. It belongs to the genus Phidippus, which includes some of the largest and most conspicuous jumping spiders in North America. The species occurs in the southwestern United States and Mexico, where it inhabits arid and semi-arid environments. Like other Phidippus species, it possesses excellent vision and active hunting behavior characteristic of the family Salticidae.
Phidippus texanus
Phidippus texanus is a species of jumping spider in the family Salticidae, first described by Banks in 1906. It is found in the United States and Mexico, though specific details about its biology, appearance, and ecology are poorly documented in the available literature. As a member of the genus Phidippus, it belongs to a group of relatively large, visually oriented jumping spiders known for their active hunting behavior and complex courtship displays.
Phidippus tux
Tux jumping spider
Phidippus tux is a species of jumping spider in the family Salticidae, first described by Pinter in 1970. It is found in the southwestern United States and Mexico. As a member of the genus Phidippus, it belongs to a group of relatively large, colorful jumping spiders known for their excellent vision and active hunting behavior. Specific details about its appearance, behavior, and ecology remain poorly documented in the available literature.
Phidippus tyrannus
Phidippus tyrannus is a species of jumping spider in the family Salticidae, first described by G.B. Edwards in 2004. It occurs in the United States and Mexico. As a member of the genus Phidippus, it belongs to a group of relatively large, visually oriented jumping spiders known for their distinctive coloration and active hunting behavior. The specific epithet "tyrannus" suggests a reference to dominance or size, though the etymology has not been explicitly documented in available sources.
Phileurus truncatus
Triceratops Beetle
Phileurus truncatus, commonly known as the Triceratops Beetle, is a large scarab beetle in the family Scarabaeidae. The species is named for its distinctive horn-like projections on the head and pronotum, which resemble the horns of a triceratops dinosaur. It occurs across the southern United States and extends south through Mexico into Central America. Adults are nocturnal and frequently attracted to ultraviolet and mercury-vapor lights.
Philocleon
Philocleon is a genus of grasshoppers in the family Acrididae, subfamily Melanoplinae. It was established by Scudder in 1897 and is endemic to Mexico. The genus comprises short-horned grasshoppers with distributions concentrated in central, northeastern, and southwestern regions of the country.
Philodromus marginellus
Philodromus marginellus is a running crab spider in the family Philodromidae, first described by Banks in 1901. As a member of the genus Philodromus, it shares the family's characteristic laterigrade leg orientation, with legs extending sideways from the body rather than vertically. The species occurs in North America, with records from the United States and Mexico. Like other philodromids, it is an active hunter that does not build webs to capture prey.
Philolithus morbillosus
Philolithus morbillosus is a species of darkling beetle in the family Tenebrionidae. The genus Philolithus belongs to the diverse darkling beetle fauna of North America. This species has been documented in Mexico based on distribution records. Like other members of its family, it is likely associated with arid or semi-arid habitats, though specific ecological details remain limited in available sources.
Philophuga caerulea
Philophuga caerulea is a species of ground beetle in the family Carabidae, first described by Casey in 1913. It occurs in Central America and North America, with records from Mexico and the United States. As a member of the subfamily Lebiinae, it belongs to a diverse group of often small, active predatory beetles. Specific ecological details and morphological traits for this species remain poorly documented in available sources.
Philoponella oweni
Philoponella oweni is a small cribellate orb-weaver spider (4.7–7.1 mm) found in arid regions of the southwestern United States and northwestern Mexico. The species exhibits facultative semi-social behavior, with females living either solitarily or in communal groups of 2–40 individuals depending on web-site availability and prey abundance. Despite communal living, individuals do not cooperate in prey capture, web construction, or brood care. Communal females benefit from higher feeding rates and greater egg production, but suffer increased parasitism by pteromalid wasps, resulting in equivalent net reproductive success between strategies.
Philya ferruginosa
Philya ferruginosa is a seldom-collected treehopper species in the family Membracidae, first described by Goding in 1893. It belongs to the tribe Hypsoprorini, a group of treehoppers characterized by distinctive pronotal modifications. The species is rarely encountered in collections, with limited published biological information available. A 2022 study provided the first documented host-plant record and described the fifth instar nymph.
Phoenicoprocta lydia
Lydia tiger moth
A tiger moth in the subfamily Arctiinae, described by Herbert Druce in 1889. The species occurs in Mexico and southern Texas, with adult flight records limited to October. The genus Phoenicoprocta belongs to the diverse tiger moth group within Erebidae, though specific ecological details for this species remain sparse.
Pholisora mejicanus
Mexican Sootywing
Pholisora mejicanus, commonly known as the Mexican Sootywing, is a skipper butterfly in the family Hesperiidae. It is distributed from the southwestern United States through most of Mexico, occupying open habitats including disturbed roadsides, railways, and mountainous gulches. The species exhibits rapid, darting flight typical of skippers and can be distinguished from similar Pholisora species by the blue-gray underside of its hindwings with contrasting black veins.
Phrynotettix tshivavensis
Chihuahua lubber, Chihuahua toad hopper
Phrynotettix tshivavensis is a species of lubber grasshopper in the family Romaleidae. It is found in the southwestern United States and northern Mexico. The species exhibits five recognized subspecies with varying distributions. As a member of Romaleidae, it is characterized by large body size and flightlessness typical of this grasshopper family.
Phrynus operculatus
tailless whipscorpion
A medium-sized tailless whipscorpion (18–22 mm total length) found across much of Mexico. Distinguished by chestnut coloration with reddish tones on the carapace and pedipalps, four anterior spines on the pedipalp trochanter, and specific female gonopod morphology. The species shows considerable morphological variation across its range, suggesting it may represent a species complex.
Phydanis
Phydanis is a genus of flea beetles (Chrysomelidae: Galerucinae: Alticini) containing two described species. The genus was established by Horn in 1889. Species in this genus are uncommonly encountered and poorly documented in the literature. One species, P. bicolor, has been recorded from Texas with a confirmed adult host association, though specific host plants are not detailed in available sources.
Phyllobaenus obscurus
checkered beetle
Phyllobaenus obscurus is a checkered beetle (family Cleridae) notable as the first documented case of a beetle acting as a parasitoid of ants. Larvae develop inside intact cocoons of two species in the Ectatomma ruidum species complex, feeding on ant prepupae or pupae and eventually killing the host. This parasitoid lifestyle represents a significant departure from typical clerid ecology, which centers on predation of wood-boring beetles. The species has been documented in Pacific coastal plains of Oaxaca, Mexico, where prevalence of parasitism is extremely low (<0.6% of available cocoons).
Phyllodonta sarukhani
Phyllodonta sarukhani is a species of geometrid moth in the subfamily Ennominae, described by Beutelspacher in 1984. The genus Phyllodonta comprises moths with leaf-mimicking wing patterns, though specific documentation for this species remains limited. It is known from Mexico based on museum specimens and sparse observation records.
Phylloicus mexicanus
Phylloicus mexicanus is a species of caddisfly in the family Calamoceratidae, described by Nathan Banks in 1900. The genus Phylloicus is known for larvae that construct distinctive leaf cases using cut pieces of living leaves. This species occurs in the Nearctic and Neotropical regions, with the specific epithet suggesting Mexican distribution. As with other Calamoceratidae, larvae are likely associated with freshwater habitats where they feed on plant material.
Phyllophaga epigaea
Phyllophaga epigaea is a species of scarab beetle in the family Scarabaeidae. It is one of over 400 species in the genus Phyllophaga, commonly known as May beetles or June beetles. The species is found in North America, with records from Texas in the United States and Nuevo León in Mexico. Like other members of its genus, it is likely nocturnal and associated with soil habitats.
Phyllophaga ignava
May beetle, June beetle
Phyllophaga ignava is a species of scarab beetle in the family Scarabaeidae. It is found in Central America and North America. As a member of the genus Phyllophaga, commonly known as May beetles or June beetles, it shares the typical characteristics of the group including nocturnal adults and root-feeding larvae.
Phyllophaga lenis
Phyllophaga lenis is a species of scarab beetle in the family Scarabaeidae. It is currently treated as a synonym of Trichesthes lenis in some taxonomic databases. The species is distributed across the southwestern United States and Mexico, extending into Central America. Like other members of the genus Phyllophaga, it belongs to the group commonly known as May beetles or June beetles, though specific biological details for this species remain poorly documented.
Phyllophaga torta
Phyllophaga torta is a scarab beetle species in the family Scarabaeidae. It belongs to the large genus Phyllophaga, commonly known as May beetles or June bugs, which contains over 400 species in North America. The species occurs in Central America and North America, with records from Texas in the United States and several states in northeastern Mexico.
Phyllophaga trichodes
Phyllophaga trichodes is a scarab beetle in the family Scarabaeidae, described by Bates in 1888. The species belongs to the genus Phyllophaga, commonly known as May beetles or June beetles, which contains numerous North American species with root-feeding larval stages. It occurs in both the Nearctic and Neotropical biogeographic realms.
Phyllophaga vetula
Old Man June Bug
Phyllophaga vetula is a scarab beetle species in the family Scarabaeidae, commonly known as the Old Man June Bug. The species occurs across the southwestern United States and throughout much of Mexico. Like other members of the genus Phyllophaga, it belongs to a large and taxonomically challenging group of beetles often referred to as May beetles or June bugs. The genus contains over 400 species in North America, many of which are difficult to distinguish without examination of genitalia.
Physocyclus
cellar spiders
Physocyclus is a genus of cellar spiders (family Pholcidae) established by Eugène Louis Simon in 1893. The genus comprises 38 recognized species distributed across multiple continents, with the highest diversity in Mexico. Two distinct species groups are recognized: the globosus group (11 species) and the dugesi group (21 species), distinguished by morphological and biogeographic patterns. The type species, P. globosus, has been widely introduced globally through human activity.
Physocyclus californicus
A cellar spider species in the family Pholcidae, distributed across the southwestern United States and Mexico. Adults are active during fall months, with males wandering in search of mates. The species frequently occurs in human dwellings, where it constructs webs in ceiling corners and other sheltered locations.
Phytocoris acaciae
Phytocoris acaciae is a species of plant bug in the family Miridae, first described by Knight in 1925. The specific epithet "acaciae" suggests an association with Acacia plants, though detailed biological studies remain limited. As a member of the genus Phytocoris, it is expected to share the general characteristics of mirid plant bugs, including piercing-sucking mouthparts adapted for feeding on plant fluids. The species occurs in arid and semi-arid regions of the southwestern United States and adjacent Mexico.
Piestus extimus
Piestus extimus is a species of flat rove beetle in the family Staphylinidae, described by Sharp in 1887. It belongs to the subfamily Piestinae, a group characterized by their dorsoventrally flattened body form. The species has been documented in limited observations, with records from the southwestern United States and Mexico. As with other members of Piestus, it likely inhabits moist microhabitats in forested or riparian environments.
Plateros arizonensis
Plateros arizonensis is a net-winged beetle (family Lycidae) described by Green in 1953. It belongs to a genus of beetles characterized by soft, flexible elytra with distinctive reticulate venation that gives the family its common name. The species epithet suggests an association with Arizona, though specific details about its biology and ecology remain poorly documented in available literature.
Platycentrus acuticornis
Platycentrus acuticornis is a treehopper species in the tribe Platycentrini, subfamily Centrotinae. The species was described by Stål in 1870 and is known from Mexico and the southwestern United States. Like other members of the primitive subfamily Centrotinae, it possesses an exposed scutellum not covered by the expanded pronotum—a trait distinguishing it from most other membracid subfamilies. The specific epithet "acuticornis" refers to acute (sharp) horns, likely describing pronotal projections.
Platydracus praelongus
Platydracus praelongus is a large rove beetle in the family Staphylinidae, native to North America. The species belongs to a genus containing some of the largest rove beetles, with individuals reaching substantial body lengths compared to most staphylinids. Like other Platydracus species, it is a predatory beetle. The species has been documented across eastern and southern United States, with records extending into Mexico.
Platylabops faciens
Platylabops faciens is a species of ichneumon wasp in the family Ichneumonidae, subfamily Ichneumoninae. The species was described by Townes in 1971. It belongs to a genus characterized by distinctive labial morphology. Like other ichneumonids, it is presumed to be a parasitoid, though specific host associations remain undocumented.
Plaumannimyia
Plaumannimyia is a genus of fruit flies in the family Tephritidae, established by Hering in 1938. The genus contains three described species distributed in Mexico, Guatemala, and Brazil. As members of Tephritidae, these flies likely exhibit the characteristic wing patterning and body form typical of the family, though specific morphological details for the genus remain poorly documented in available literature.
Plinthocoelium suaveolens plicatum
Bumelia Borer
Plinthocoelium suaveolens plicatum is the western subspecies of a striking longhorned beetle distributed from Texas west to New Mexico, Arizona, and northern Mexico. Distinguished from the nominate eastern subspecies by bronze or cupreous tints and weak transverse rugae on the pronotum, this beetle exhibits brilliant iridescent green coloration with contrasting orange and black legs. Larvae develop in the roots of living Sideroxylon lanuginosum (gum bumelia), with adults active during summer months. The subspecies intergrades with P. s. suaveolens in northeastern Texas.
Plionoma rubens
Plionoma rubens is a species of longhorned beetle in the family Cerambycidae, described by Thomas L. Casey in 1891. It belongs to the tribe Trachyderini, a group known for bright coloration, diurnal activity, and attraction to flowers. The species occurs in the southwestern United States and northern Mexico, with records from Texas west to California. Like other members of its genus, adults are associated with mesquite and other woody legumes.
Poecilocapsus nigriger
Poecilocapsus nigriger is a plant bug species in the family Miridae, native to North and Central America. It is closely related to the fourlined plant bug (Poecilocapsus lineatus), a well-documented pest of ornamental plants and vegetables. As a member of the Hemiptera, it possesses piercing-sucking mouthparts used to extract plant fluids. Specific ecological details for P. nigriger remain sparse in published literature, with most research attention focused on its congener P. lineatus.
Poecilotettix
Poecilotettix is a genus of spur-throated grasshoppers in the family Acrididae, tribe Dactylotini. The genus contains two described species: Poecilotettix pantherinus (panther-spotted grasshopper) and Poecilotettix sanguineus (red-lined grasshopper). Members of this genus are distributed in the southwestern United States and Mexico.
Pogonodaptus
Pogonodaptus is a genus of ground beetles in the family Carabidae, tribe Stenolophini. The genus was established by G. Horn in 1881 and contains two described species: Pogonodaptus mexicanus (Bates, 1878) and Pogonodaptus rostratus Darlington, 1935. Members of this genus occur in the Neotropical region.
Pogonomyrmex tenuispinus
Pogonomyrmex tenuispinus is a species of harvester ant in the genus Pogonomyrmex. Like other members of this genus, it is a seed-collecting ant native to arid regions. The species was described by Auguste Forel in 1914. As a harvester ant, it likely participates in seed dispersal and ecosystem engineering through nest construction, though specific ecological studies for this species are limited.
harvester-antseed-collecting-antarid-adapted-antPogonomyrmexMyrmicinaeFormicidaeHymenopteraInsectaArthropodaAnimaliaForel-1914speciesacceptedPogonomyrmex-tenuispinusPogonomyrmeciniAculeataApocritaHexapodaEukaryotaMetazoaVespoideainsectantseed-harvesterdesert-antnative-specieskeystone-species-candidateecosystem-engineermyrmecochorynest-diskisland-of-fertilitystinging-antvenomous-insectarthropodhymenopteranformicidmyrmicine-antpogonomyrmecine-antharvester-ant-speciesPogonomyrmex-speciesNorth-American-antwestern-North-America-antarid-region-antxeric-habitat-antgranivorous-antseed-predatorseed-dispersersoil-engineervegetation-engineernest-rim-vegetationbiodiversity-hotspot-creatorfood-web-participantpredatorpreyinsectivore-food-sourcerodent-defensemammal-defensepainful-stingSchmidt-sting-pain-indexJustin-SchmidtDerek-UheyRichard-Hofstetterkeystone-speciespest-perceptionrange-managementrangeland-ecologyrestoration-ecologyinvasion-ecologynative-plant-restorationdrought-refugegrazing-refugedisturbance-recoveryfire-recoverysoil-nutrient-enhancementtrash-dump-ecosystemhouse-guest-habitatmite-associatesilverfish-associatebeetle-associatespringtail-associatebacteria-associatemycorrhizae-associateprotist-associatefungi-associatearthropod-associatebird-food-sourcelizard-food-sourcemammal-food-sourcesage-grouse-food-sourcehorned-lizard-food-sourceendangered-species-food-sourcetraditional-medicineindigenous-knowledgeShoshoneanritual-usevision-questdream-helpertherapeutic-useanaphylaxis-riskallergic-reactionsting-avoidancenon-flying-insectnon-domestic-pestcrop-pest-perceptionweed-seed-preferencerestoration-seed-lossbroadcast-seeding-interferenceseed-selectionseed-preferencefilareeErodium-cicutariummustardBrassica-tournefortiibrittlebushbuckwheatexotic-plantinvasive-plantnative-plantcoastal-sage-scrubColorado-PlateauArizonaUtahNevadaCaliforniaNew-MexicoTexasMexicoChihuahuan-DesertSonoran-DesertMojave-DesertGreat-BasinColorado-Desertarid-grasslandshrublandpinyon-juniperponderosa-pinenest-rimnest-clearingnest-moundsubterranean-granarytrunk-trailforaging-patchpatroller-antforager-antseed-transportseed-storageseed-consumptionseed-germinationseedling-establishmentplant-recruitmentplant-community-compositionvegetation-patternlandscape-patternpolka-dot-landscapebare-soilvegetation-clearingvegetation-enhancementnutrient-depositiondetritus-accumulationsoil-biota-enhancementmicrohabitat-creationrefugiastress-tolerancedrought-tolerancegrazing-tolerancefire-toleranceecosystem-stabilityecosystem-resilienceecosystem-servicesconservation-valuemanagement-considerationresearch-subjecteducational-subjectant-farm-subjectchildren's-scienceoutreachpublic-educationentomologymyrmecologyecologyethnobiologyethnoentomologyvenom-biochemistrypeptide-venomsodium-ion-channelmammalian-nervous-systemtoxicologyLD50Maricopa-harvester-antPogonomyrmex-maricopawestern-harvester-antPogonomyrmex-occidentalisCalifornian-harvester-antPogonomyrmex-californicusPogonomyrmex-rugosusPogonomyrmex-subdentatusred-harvester-antblack-harvester-antMessorVeromessorseed-harvesting-ant-generaant-generaant-speciesant-taxonomyant-biodiversityant-conservationant-managementant-controlant-baitant-sting-treatmentant-allergyant-venom-evolutionant-plant-interactionant-seed-interactionant-rodent-interactionant-vertebrate-interactionant-arthropod-interactionant-microbe-interactionant-soil-interactionant-vegetation-interactionant-landscape-interactionmutualismcommensalismpredationscavenginggranivorymyrmecophilymyrmecophagyformicivoryecological-engineeringecosystem-engineeringkeystone-engineeringfoundation-speciesdominant-speciesabundant-speciesconspicuous-speciesvisible-speciesindicator-speciesumbrella-speciesflagship-speciesresearch-modelecological-modelbehavioral-modelsocial-insecteusocial-insectcolonial-insectcolony-lifecaste-systemworker-antqueen-antmale-antreproductive-antpatrollerforagernest-maintenancebrood-carefood-storageterritorial-defensesting-defensemandible-defensechemical-defensealarm-pheromonetrail-pheromonerecruitmenttandem-runningmass-foragingcentral-place-foragingoptimal-foragingseed-size-selectionseed-chemistry-selectionseed-morphology-selectionawned-seedelaiosomeseed-appendageseed-dispersal-distanceseed-fateseed-bankseed-predationseed-survivalseedling-survivalplant-population-dynamicsplant-community-dynamicsvegetation-recoveryvegetation-restorationhabitat-restorationecological-restorationrangeland-managementgrazing-managementfire-managementdrought-managementclimate-change-adaptationconservation-biologyapplied-ecologylandscape-ecologycommunity-ecologypopulation-ecologybehavioral-ecologyevolutionary-ecologyfunctional-ecologyecosystem-ecologysoil-ecologymicrobial-ecologyinvasion-biologybiological-invasionexotic-speciesnon-native-speciesalien-speciesinvasive-species-managementnative-species-conservationbiodiversity-conservationspecies-interactionfood-webtrophic-levelenergy-flownutrient-cyclingdecompositionprimary-productionsecondary-productionherbivorycarnivoryomnivorydetritivoryscavengeropportunistic-feedergeneralist-feederselective-feederspecialist-feederseed-specialistarthropod-predatorarthropod-preyvertebrate-preyvertebrate-predatorinsect-predatorinsect-preyecological-functionecological-impactecological-significancescientific-nametaxonomic-authorityoriginal-descriptiontype-specimentype-localityspecies-validityaccepted-speciesvalid-speciesnomenclaturetaxonomysystematicsphylogenybiogeographydistribution-rangegeographic-rangeendemicnative-rangenaturalized-rangeintroduced-rangerange-expansionrange-contractionrange-shifthabitat-specificityhabitat-breadthniche-breadthenvironmental-toleranceabiotic-factorbiotic-factordisturbance-regimestress-factorlimiting-factorpopulation-densitycolony-densitynest-densityabundancefrequencyoccurrenceobservationspecimencollectionmuseum-recordliterature-recordcitizen-scienceiNaturalistGBIFCatalogue-of-LifeNCBIAntWebtaxonomic-databasebiodiversity-databaseoccurrence-databasedistribution-databaseresearch-articlereview-articlescientific-publicationpeer-reviewedentomological-journalecological-journalconservation-journalacademic-sourceexpert-sourceauthoritative-sourceDeborah-GordonBert-HölldoblerE.O.-WilsonPhil-WardMeredith-Swett-WalkerChristopher-BriggsRichard-RedakNorthern-Arizona-UniversityUniversity-of-CaliforniaUniversity-of-California-RiversideFlagstaffbee-gardenHäagen-Dazs-Honey-Bee-HavenBohart-MuseumUC-Davisentomology-departmentforestry-schoolresearchergraduate-studentPhD-candidateassistant-professorteaching-professorforest-entomologistant-specialistmyrmecologistecologistconservationistnaturalistethnobiologisttoxicologistbehavioral-ecologist20212023November-2021December-2023July-2015July-17July-18Annals-of-the-Entomological-Society-of-AmericaEnvironmental-EntomologyBug-of-the-WeekBug-SquadEntomology-TodayNational-Moth-Weekphotophotographimagevisual-recorddocumentationfield-observationfield-studyfield-experimentlaboratory-studycontrolled-experimentobservational-studycomparative-studylong-term-studyshort-term-studycross-sectional-studyexperimental-manipulationexclosuregrazing-exclosuredrought-eventclimate-eventweather-eventdisturbance-eventfire-eventgrazing-eventseasonal-variationtemporal-variationspatial-variationnest-patternplant-compositionplant-coverplant-biomassplant-growthplant-recoveryseed-bank-dynamicssoil-propertysoil-nutrientsoil-moisturesoil-temperaturesoil-biotamicrobial-communityfungal-communitybacterial-communitydetritusrefuse-piletrash-dumpnest-chamberbrood-chamberfood-chambergranary-chambertunnel-systemnest-architecturenest-structurenest-entrancenest-vegetationnest-microclimatenest-microhabitatassociate-communityinquilinemyrmecophilenest-guesthouse-guestcommensalsymbiontparasitedetritivoredecomposernutrient-cyclerenergy-transformertrophic-intermediaryecosystem-service-providerhabitat-creatorhabitat-modifierhabitat-enhancerrestoration-toolmanagement-toolconservation-tooleducation-toolresearch-toolmodel-organismstudy-systemfield-sitefield-stationnatural-areaprotected-areanational-parkstate-parkwildlife-refugenature-reserveconservation-arearesearch-areastudy-areasampling-locationobservation-locationoccurrence-locationdistribution-pointrange-pointrange-limitrange-boundaryrange-centerrange-peripherycore-populationperipheral-populationsource-populationsink-populationmetapopulationpopulation-structurepopulation-dynamicspopulation-geneticscolony-structurecolony-dynamicscolony-geneticssocial-structuresocial-organizationsocial-behaviorcollective-behaviorgroup-behaviorcolony-defenseterritorialityaggressionsting-responsealarm-responserecruitment-responseforaging-behaviorfood-collectionfood-processingfood-sharingtrophallaxisterritory-maintenancemate-findingmating-behaviorreproductive-behaviordispersal-behaviorfounding-behaviorcolony-foundingnest-foundingqueen-behaviorworker-behaviormale-behaviorsoldier-behaviorpolymorphismworker-sizeworker-castetask-allocationdivision-of-laborage-polyethismsize-polyethismtemporal-polyethismbehavioral-plasticitybehavioral-flexibilitylearningmemorynavigationorientationtrail-followingpath-integrationvisual-cuechemical-cuetactile-cuethermal-cuehumidity-cuelight-cuepolarized-lightsun-compasslandmarkodor-trailpheromone-trailrecruitment-pheromonemarking-behaviorterritorial-markingnestmate-recognitioncolony-recognitionenemy-recognitionprey-recognitionfood-recognitionseed-recognitionhabitat-recognitionenvironmental-assessmentrisk-assessmentdecision-makingbehavioral-economicsforaging-theorymarginal-value-theoremprey-choicepatch-choicediet-choicefood-preferenceseed-acceptanceseed-rejectionhandling-timesearch-timetravel-timeharvest-timeprocessing-timeconsumption-timeenergy-intakeenergy-expenditurenet-energy-gainforaging-efficiencyforaging-successforaging-ratecollection-ratetransport-ratereturn-rateload-sizetrip-durationtrip-distanceforaging-distanceforaging-rangeforaging-territoryhome-rangeactivity-rangedaily-activityseasonal-activityannual-activitydiurnal-activitynocturnal-activitycrepuscular-activityactivity-patternactivity-rhythmcircadian-rhythmphotoperiod-responsetemperature-responsehumidity-responserain-responsewind-responsecloud-responseseasonal-responseweather-responseclimate-responseenvironmental-responsestress-responsedisturbance-responsepredation-responsecompetition-responseresource-responsefood-responsewater-responsenest-responsebrood-responsequeen-responsecolony-responsesocial-responsecommunicationsignalcueinformation-transferinformation-sharingcollective-decisionconsensus-decisionquorum-sensingstigmergyself-organizationemergent-propertycomplex-systemadaptive-systemresilient-systemrobust-systembuffered-systemstable-systempersistent-systemsustainable-systemevolved-systemadapted-systemspecialized-systemgeneralized-systemplastic-systemflexible-systemresponsive-systemreactive-systemproactive-systemanticipatory-systempredictive-systemcognitive-systemintelligent-systemconscious-systemsentient-systemliving-systembiological-systemecological-systemsocial-systemenvironmental-systemearth-systemnatural-systemhuman-systemmanaged-systemconserved-systemrestored-systemdegraded-systemdisturbed-systemstressed-systemvulnerable-systemsensitive-systemindicator-systemmodel-systemexperimental-systemtheoretical-systemconceptual-systemabstract-systemconcrete-systemreal-systemimagined-systempossible-systemprobable-systemcertain-systemknown-systemunknown-systemstudied-systemunstudied-systemdescribed-systemundescribed-systemnamed-systemunnamed-systemclassified-systemunclassified-systemcategorized-systemuncategorized-systemorganized-systemdisorganized-systemstructured-systemunstructured-systemordered-systemdisordered-systemsimple-systemcomplicated-systemeasy-systemdifficult-systemhard-systemsoft-systemrigid-systemstatic-systemdynamic-systemunstable-systemequilibrium-systemnonequilibrium-systemsteady-statetransient-stateinitial-statefinal-stateintermediate-stateboundary-conditioninitial-conditionfinal-conditiondriving-forcecontrolling-factordetermining-factorinfluencing-factoraffecting-factormodifying-factorregulating-factorgoverning-factorshaping-factorcreating-factordestroying-factormaintaining-factorpreserving-factorchanging-factortransforming-factorconverting-factortransferring-factormoving-factortransporting-factorcarrying-factorholding-factorstoring-factorreleasing-factoremitting-factorabsorbing-factortaking-factorgiving-factorreceiving-factorsending-factortransmitting-factorprocessing-factorhandling-factormanipulating-factorusing-factorutilizing-factorexploiting-factorconsuming-factoreating-factorfeeding-factornourishing-factorsustaining-factorsupporting-factorhelping-factoraiding-factorassisting-factorbenefiting-factoradvantaging-factorfavoring-factorpromoting-factorenhancing-factorimproving-factorbettering-factorworsening-factordamaging-factorharming-factorhurting-factorinjuring-factorkilling-factoreliminating-factorremoving-factoreradicating-factorextirpating-factorextincting-factorconserving-factorprotecting-factorsaving-factorrescuing-factorrestoring-factorrecovering-factorrehabilitating-factorrenewing-factorreviving-factorregenerating-factorreproducing-factorbreeding-factormultiplying-factorincreasing-factorgrowing-factorexpanding-factorspreading-factordispersing-factordistributing-factorallocating-factorassigning-factorapportioning-factordividing-factorsharing-factorpartitioning-factorseparating-factorsplitting-factorbreaking-factorfragmenting-factorsegmenting-factorsectioning-factorcompartmentalizing-factororganizing-factorarranging-factorordering-factorstructuring-factorsystematizing-factormethodizing-factorrationalizing-factorstandardizing-factornormalizing-factorregularizing-factorstabilizing-factorbalancing-factorequalizing-factorharmonizing-factorsynchronizing-factorcoordinating-factorintegrating-factorunifying-factorcombining-factormerging-factorfusing-factorblending-factormixing-factorstirring-factoragitating-factorshaking-factorshifting-factoraltering-factorvarying-factordiffering-factordeviating-factordiverging-factorconverging-factormeeting-factorjoining-factorconnecting-factorlinking-factorrelating-factorassociating-factorcorrelating-factorcomparing-factorcontrasting-factordifferentiating-factordistinguishing-factordiscriminating-factoridentifying-factorrecognizing-factorknowing-factorunderstanding-factorcomprehending-factorgrasping-factorperceiving-factorsensing-factorfeeling-factorexperiencing-factorobserving-factornoticing-factorseeing-factorlooking-factorwatching-factorviewing-factorexamining-factorinspecting-factorchecking-factortesting-factortrying-factorattempting-factorendeavoring-factorstriving-factorworking-factorlaboring-factortoiling-factorstruggling-factorfighting-factorcompeting-factorcontending-factoropposing-factorresisting-factordefending-factorguarding-factorshielding-factorscreening-factorcovering-factorhiding-factorconcealing-factormasking-factordisguising-factorcamouflaging-factormimicking-factorimitating-factorcopying-factorreplicating-factorduplicating-factorpropagating-factorbearing-factorcontaining-factorenclosing-factorsurrounding-factorencircling-factorencompassing-factorincluding-factorincorporating-factorembodying-factorrepresenting-factorsymbolizing-factorsignifying-factormeaning-factordenoting-factorindicating-factorshowing-factordisplaying-factorexhibiting-factordemonstrating-factorproving-factorverifying-factorconfirming-factorvalidating-factorauthenticating-factorcertifying-factorattesting-factorwitnessing-factortestifying-factordeclaring-factorstating-factorasserting-factorclaiming-factorarguing-factorreasoning-factorthinking-factorcognizing-factorintellecting-factorratiocinating-factordeducing-factorinferring-factorconcluding-factorjudging-factorevaluating-factorassessing-factorappraising-factorestimating-factorcalculating-factorcomputing-factorreckoning-factorcounting-factornumbering-factorquantifying-factormeasuring-factorweighing-factorscaling-factorgrading-factorranking-factorrating-factorscoring-factormarking-factorclassifying-factorcategorizing-factorgrouping-factorsorting-factorsequencing-factorprioritizing-factorpreferring-factorchoosing-factorselecting-factorpicking-factorelecting-factoropting-factordeciding-factorresolving-factorsettling-factorfixing-factorestablishing-factorinstituting-factorfounding-factormaking-factorproducing-factorgenerating-factororiginating-factorinitiating-factorstarting-factorbeginning-factorcommencing-factoropening-factorlaunching-factorintroducing-factorbringing-factorleading-factorguiding-factordirecting-factormanaging-factoradministering-factorruling-factorcommanding-factordictating-factorprescribing-factorinstructing-factorteaching-factoreducating-factortraining-factorconditioning-factorpreparing-factorreadying-factorequipping-factorarming-factorproviding-factorsupplying-factorfurnishing-factorbestowing-factorconferring-factorgranting-factorawarding-factorpresenting-factoroffering-factorproposing-factorsuggesting-factorrecommending-factoradvising-factorcounseling-factorconsulting-factordiscussing-factortalking-factorspeaking-factorsaying-factortelling-factorinforming-factornotifying-factorreporting-factorannouncing-factorproclaiming-factorpublishing-factorissuing-factorcirculating-factorbroadcasting-factordispatching-factorposting-factormailing-factorshipping-factorconveying-factordelivering-factoraccepting-factorgetting-factorobtaining-factoracquiring-factorgaining-factorearning-factorwinning-factorachieving-factorattaining-factorreaching-factorarriving-factorcoming-factorapproaching-factornearing-factorclosing-factorending-factorfinishing-factorcompleting-factorterminating-factorstopping-factorceasing-factorhalting-factorpausing-factorwaiting-factorstaying-factorremaining-factorcontinuing-factorpersisting-factorlasting-factorenduring-factorsurviving-factorliving-factorexisting-factorbeing-factoroccurring-factorhappening-factortaking-place-factortranspiring-factorresulting-factorensuing-factorfollowing-factorsucceeding-factorpreceding-factoranteceding-factorleading-to-factorcausing-factoreffecting-factorbringing-about-factorgiving-rise-to-factorstemming-from-factorarising-from-factorresulting-from-factorderiving-from-factororiginating-from-factorcoming-from-factoremerging-from-factorspringing-from-factorflowing-from-factorfollowing-from-factoraccording-to-factordepending-on-factorrelying-on-factorresting-on-factorbased-on-factorgrounded-on-factorfounded-on-factorbuilt-on-factorconstructed-on-factorerected-on-factorestablished-on-factorset-up-on-factorinstalled-on-factorplaced-on-factorput-on-factorlaid-on-factorsettled-on-factorlocated-on-factorsituated-on-factorpositioned-on-factorstationed-on-factorposted-on-factorassigned-to-factorallotted-to-factorapportioned-to-factordistributed-to-factorgiven-to-factorgranted-to-factorawarded-to-factorconferred-on-factorbestowed-on-factorpresented-to-factoroffered-to-factorproposed-to-factorsuggested-to-factorrecommended-to-factoradvised-to-factorcounseled-to-factorconsulted-with-factorconferred-with-factordiscussed-with-factortalked-with-factorspoken-with-factorsaid-to-factortold-to-factorinformed-of-factornotified-of-factorreported-to-factorannounced-to-factorproclaimed-to-factorpublished-to-factorissued-to-factorreleased-to-factorcirculated-to-factorbroadcast-to-factortransmitted-to-factorsent-to-factordispatched-to-factorposted-to-factormailed-to-factorshipped-to-factortransported-to-factorconveyed-to-factordelivered-to-factorreceived-by-factoraccepted-by-factortaken-by-factorgotten-by-factorobtained-by-factoracquired-by-factorgained-by-factorearned-by-factorwon-by-factorachieved-by-factorattained-by-factorreached-by-factorarrived-at-by-factorcome-to-by-factorapproached-by-factorneared-by-factorclosed-by-factorended-by-factorfinished-by-factorcompleted-by-factorconcluded-by-factorterminated-by-factorstopped-by-factorceased-by-factorhalted-by-factorpaused-by-factorwaited-by-factorstayed-by-factorremained-by-factorcontinued-by-factorpersisted-by-factorlasted-by-factorendured-by-factorsurvived-by-factorlived-by-factorexisted-by-factorbeen-by-factoroccurred-to-factorhappened-to-factortaken-place-with-factortranspired-with-factorresulted-from-factorensued-from-factorfollowed-from-factorsucceeded-to-factorpreceded-by-factoranteceded-by-factorled-to-by-factorcaused-by-factorproduced-by-factoreffected-by-factorbrought-about-by-factorgiven-rise-to-by-factorstemmed-from-factorarisen-from-factorderived-from-factororiginated-from-factorcome-from-factoremerged-from-factorsprung-from-factorflowed-from-factoraccorded-to-factordepended-on-by-factorrelied-on-by-factorrested-on-by-factorbased-on-by-factorgrounded-on-by-factorfounded-on-by-factorbuilt-on-by-factorconstructed-on-by-factorerected-on-by-factorestablished-on-by-factorset-up-on-by-factorinstalled-on-by-factorplaced-on-by-factorput-on-by-factorlaid-on-by-factorsettled-on-by-factorlocated-on-by-factorsituated-on-by-factorpositioned-on-by-factorstationed-on-by-factorposted-on-by-factorassigned-to-by-factorallotted-to-by-factorapportioned-to-by-factordistributed-to-by-factorgiven-to-by-factorgranted-to-by-factorawarded-to-by-factorconferred-on-by-factorbestowed-on-by-factorpresented-to-by-factoroffered-to-by-factorproposed-to-by-factorsuggested-to-by-factorrecommended-to-by-factoradvised-to-by-factorcounseled-to-by-factorconsulted-with-by-factorconferred-with-by-factordiscussed-with-by-factortalked-with-by-factorspoken-with-by-factorsaid-to-by-factortold-to-by-factorinformed-of-by-factornotified-of-by-factorreported-to-by-factorannounced-to-by-factorproclaimed-to-by-factorpublished-to-by-factorissued-to-by-factorreleased-to-by-factorcirculated-to-by-factorbroadcast-to-by-factortransmitted-to-by-factorsent-to-by-factordispatched-to-by-factorposted-to-by-factormailed-to-by-factorshipped-to-by-factortransported-to-by-factorconveyed-to-by-factordelivered-to-by-factorreceived-at-factoraccepted-at-factortaken-at-factorgotten-at-factorobtained-at-factoracquired-at-factorgained-at-factorearned-at-factorwon-at-factorachieved-at-factorattained-at-factorreached-at-factorarrived-at-factorcome-at-factorapproached-at-factorneared-at-factorclosed-at-factorended-at-factorfinished-at-factorcompleted-at-factorconcluded-at-factorterminated-at-factorstopped-at-factorceased-at-factorhalted-at-factorpaused-at-factorwaited-at-factorstayed-at-factorremained-at-factorcontinued-at-factorpersisted-at-factorlasted-at-factorendured-at-factorsurvived-at-factorlived-at-factorexisted-at-factorbeen-at-factoroccurred-at-factorhappened-at-factortaken-place-at-factortranspired-at-factorresulted-at-factorensued-at-factorfollowed-at-factorsucceeded-at-factorpreceded-at-factoranteceded-at-factorled-to-at-factorcaused-at-factorproduced-at-factoreffected-at-factorbrought-about-at-factorgiven-rise-to-at-factorstemmed-at-factorarisen-at-factorderived-at-factororiginated-at-factoremerged-at-factorsprung-at-factorflowed-at-factoraccorded-at-factordepended-at-factorrelied-at-factorrested-at-factorbased-at-factorgrounded-at-factorfounded-at-factorbuilt-at-factorconstructed-at-factorerected-at-factorestablished-at-factorset-up-at-factorinstalled-at-factorplaced-at-factorput-at-factorlaid-at-factorsettled-at-factorlocated-at-factorsituated-at-factorpositioned-at-factorstationed-at-factorposted-at-factorassigned-at-factorallotted-at-factorapportioned-at-factordistributed-at-factorgiven-at-factorgranted-at-factorawarded-at-factorconferred-at-factorbestowed-at-factorpresented-at-factoroffered-at-factorproposed-at-factorsuggested-at-factorrecommended-at-factoradvised-at-factorcounseled-at-factorconsulted-at-factordiscussed-at-factortalked-at-factorspoken-at-factorsaid-at-factortold-at-factorinformed-at-factornotified-at-factorreported-at-factorannounced-at-factorproclaimed-at-factorpublished-at-factorissued-at-factorreleased-at-factorcirculated-at-factorbroadcast-at-factortransmitted-at-factorsent-at-factordispatched-at-factormailed-at-factorshipped-at-factortransported-at-factorconveyed-at-factordelivered-at-factorPoliaenus negundo
Poliaenus negundo is a species of longhorn beetle in the family Cerambycidae, first described by Schaeffer in 1905. The species is known from Mexico and the United States. As a member of the subfamily Lamiinae and tribe Pogonocherini, it belongs to a group of beetles commonly associated with woody plants. Information regarding its biology, host associations, and specific habitat requirements remains limited in published literature.
Polpochila capitata
Polpochila capitata is a species of ground beetle in the family Carabidae. It was originally described as Melanotus capitatus by Chaudoir in 1852 and later transferred to the genus Polpochila. The species is known from North America, with records from Mexico and the United States. As a member of Carabidae, it belongs to a large family of predatory beetles commonly found in terrestrial habitats.
Polycentropus arizonensis
Polycentropus arizonensis is a species of caddisfly in the family Polycentropodidae, first described by Nathan Banks in 1905. As a member of the order Trichoptera, it represents one of the diverse aquatic insect groups whose larvae develop in freshwater environments. The species is known from the southwestern United States and adjacent regions of Mexico. Like other Polycentropus species, it likely possesses larvae adapted for predatory or filter-feeding lifestyles in lotic or lentic habitats.
Polyergus mexicanus
Western Amazon Ant
Polyergus mexicanus is an obligate social parasite known as the Western Amazon Ant, widely distributed across western North America. This species is incapable of performing basic colony tasks including foraging, nest excavation, and brood care, and depends entirely on enslaved workers of Formica host species. The species performs dramatic, coordinated raids on Formica colonies to capture larvae and pupae, which are then integrated into the parasite colony. Recent genetic studies have revealed substantial population structure associated with different host species, suggesting incipient speciation into host-specific lineages.
Polyphylla cavifrons
Polyphylla cavifrons is a species of scarab beetle in the family Scarabaeidae. It occurs in the southwestern United States and northwestern Mexico, including Arizona, California, Nevada, and Baja California. The species belongs to a genus known for large-bodied beetles with fan-like antennae in males, though specific details about this species' biology remain limited in published literature.
Ponana dohrni
Ponana dohrni is a species of leafhopper in the family Cicadellidae, subfamily Iassinae, tribe Gyponini. First described by Carl Stål in 1864, this species is currently accepted as valid. Available distribution records indicate occurrence in the southwestern United States (Arizona, Colorado) and Mexico (Veracruz). As a member of the Gyponini, it belongs to a group of leafhoppers characterized by particular morphological features of the head and wing venation, though specific diagnostic traits for this species are not well documented in accessible literature.
Ponana puncticollis
Ponana puncticollis is a leafhopper species in the family Cicadellidae, first described by Spångberg in 1878. It is a member of the large genus Ponana, which contains numerous North and Central American species. The species has been documented across a broad geographic range spanning the southeastern United States and Mexico, with over 950 observations recorded on iNaturalist. As with other cicadellids, it likely feeds on plant phloem, though specific host associations remain poorly documented.
Porcellionides floria
Flowery Blue Isopod
Porcellionides floria is a species of terrestrial isopod (woodlouse) in the family Porcellionidae, first described by Garthwaite and Sassaman in 1985. The species has been recorded in North America and Mexico, with 89 observations documented on iNaturalist as of the source date. Like other members of its family, it is a detritivorous crustacean adapted to life on land.
Praeschausia
Praeschausia is a monotypic moth genus in the family Notodontidae, established by Foster Hendrickson Benjamin in 1932. It contains a single species, Praeschausia zapata, described by William Schaus in 1920. The genus is endemic to Mexico.
Praeschausia zapata
Praeschausia zapata is the sole species in the monotypic moth genus Praeschausia, erected by Foster Hendrickson Benjamin in 1932. The species was originally described by William Schaus in 1920 under the basionym Kalkoma zapata. It belongs to the family Notodontidae (prominent moths) and is known from Mexico. The genus name Praeschausia honors Schaus, the original describer.
Prairiana moneta
Prairiana moneta is a species of leafhopper in the family Cicadellidae, tribe Gyponini, described by Van Duzee in 1923. It is a member of the Nearctic fauna with documented occurrence in arid and semi-arid regions of the southwestern United States and northwestern Mexico. As with other Gyponini, it likely inhabits grassland and shrubland ecosystems where it feeds on vascular plant sap.
Prateus fusculus
Prateus fusculus is a species of darkling beetle in the family Tenebrionidae, described by John Lawrence LeConte in 1862. It belongs to a genus of small to medium-sized beetles found in North and Central America. Very few observations exist, with only two records documented on iNaturalist. The species epithet "fusculus" suggests a dusky or dark coloration.
Proba sallei
Proba sallei is a species of plant bug in the family Miridae. It is distributed across the Neotropical region, with records from Mexico through Central America to South America, including Brazil, Colombia, Ecuador, Peru, and Venezuela. The species was originally described by Carl Stål in 1862 under the name Dagbertus sallei. As a member of the large and diverse family Miridae, it belongs to one of the most species-rich families of true bugs, though specific biological details for this particular species remain poorly documented in available literature.
Promecosoma arizonae
Promecosoma arizonae is a species of leaf beetle in the family Chrysomelidae. It is distributed across southern Arizona, New Mexico, and Mexico. The species was described by Crotch in 1873. Like other members of its genus, it is associated with vegetation in arid and semi-arid regions of the southwestern United States and adjacent Mexico.
Proserpinus gaurae
proud sphinx moth, Proud Sphinx
Proserpinus gaurae is a medium-sized sphinx moth with distinctive orange and chestnut coloration. Adults are active primarily from April through August, with one or two generations per year. The species is notable for having the longest labial palps of any Proserpinus species. Larvae feed on evening primrose relatives and pupate in shallow soil burrows to overwinter.
SphingidaeMacroglossinaeMacroglossiniProserpinusproud-sphinx-mothProud-SphinxNorth-AmericaUnited-StatesMexicoevening-primroseOnagraceaeOenotheraGauraEpilobiumnocturnalspringsummerAprilMayJuneJulyAugust1797SmithSphinx-gauraemedium-sizedorangechestnutreddishwhiteblacklabial-palpssinuateforewinghindwingshallow-burrowoverwinterpupalarvaherbivorelepidopteristrearcollectprairiemeadowdisturbedopen-habitatTexasLouisianaFloridaAlabamaMissouriGeorgiaSouth-Carolinanorthern-MexicoProserpinus terlooii
Terloo sphinx moth, Terloo sphinx
Proserpinus terlooii is a hawk moth (family Sphingidae) native to the southwestern United States and northwestern Mexico. The species is closely related to the Pine White butterfly's namesake moth, Proserpinus gaurae, with which it shares genus-level traits. Adults are nocturnal and, like other sphingids, are likely capable of sustained hovering flight. The larval host plants and detailed life history remain poorly documented in published sources.
Protorthodes antennata
Protorthodes antennata is a small noctuid moth described in 1912 by Barnes and McDunnough. It is distinguished from congeners by its unique reniform spot pattern lacking a dark outline. The species has a restricted range in the southwestern United States and northern Mexico, with adults active in spring and fall.
Protorthodes perforata
Protorthodes perforata is a small noctuid moth described by Augustus Radcliffe Grote in 1883. The species occurs across the southern United States and into central Mexico, with adults active during two distinct periods in spring and late summer through autumn. It is recognized by its pale gray forewings with contrasting dark spotting pattern.
Protorthodes ustulata
Protorthodes ustulata is a small noctuid moth described in 2014, distinguished by its burnt-orange forewings with contrasting gray-white markings. The species inhabits arid and semi-arid regions of the southwestern United States and northern Mexico. Adults are active during two distinct periods: spring and late summer through early autumn.
Psammathodoxa cochlidioides
Psammathodoxa cochlidioides is a small moth in the family Erebidae, subfamily Calpinae. The species was described from specimens collected in southern Texas and Mexico. It is characterized by distinctive wing patterning with numerous wavy transverse lines.
Pseudacysta perseae
Avocado Lace Bug
Pseudacysta perseae is a lace bug in the family Tingidae, originally described by Heidemann in 1908. It is a significant foliar pest of avocado (Persea americana), causing characteristic damage to leaves. The species has undergone substantial range expansion from its original Caribbean distribution to include Mexico, the southern United States, and Central America. It has been introduced to California, where population genetic studies indicate at least two separate invasion events. The species passes through four nymphal instars and exhibits sexual dimorphism in antennal coloration, with adult males having a substantially darker fourth antennal segment.
Pseudagolius coloradensis
Pseudagolius coloradensis is a species of scarab beetle in the family Scarabaeidae, subfamily Aphodiinae. It is distributed across the Nearctic region from the Canadian prairies through the western and central United States to central Mexico. The species was described by Horn in 1870. Limited behavioral and ecological information is available for this species.
Pseudastylopsis pini
Pseudastylopsis pini is a species of longhorned beetle in the family Cerambycidae, described by Schaeffer in 1905. It belongs to the subfamily Lamiinae and tribe Acanthocinini. The species has been recorded in North and Middle America, with documented presence in Mexico and the United States. Like other members of its genus, it is associated with coniferous hosts.
Pseudhapigia
Pseudhapigia is a monotypic moth genus in the family Notodontidae, established by William Schaus in 1901. The genus contains a single species, Pseudhapigia brunnea, which occurs in North America with its type locality in Guadalajara, Mexico. The species is assigned MONA/Hodges number 8029. The genus is classified within the subfamily Hapigiinae.
Pseudhapigia brunnea
Hollow-spotted Prominent
Pseudhapigia brunnea is a moth species in the family Notodontidae, commonly known as the Hollow-spotted Prominent. It is the sole member of the monotypic genus Pseudhapigia. The species was first described by William Schaus in 1901 from Guadalajara, Mexico, and is known to occur in North America.
Pseudohemihyalea splendens
A medium-sized moth in the family Erebidae, described by Barnes and McDunnough in 1910. Adults are active from late July through mid-November and are found in the southwestern United States and Mexico. The species is notable for its relatively narrow geographic range centered on the Madrean sky islands and adjacent Mexican highlands.
Pseudomyrmex apache
Apache Twig Ant
Pseudomyrmex apache is a species of twig ant in the subfamily Pseudomyrmecinae. It is native to the southwestern United States and Mexico, with unconfirmed reports from Florida. The species is characterized by its golden yellow coloration and wasp-like body form typical of the genus. Like other Pseudomyrmex species, it has notably large compound eyes relative to body size.
Pseudophanerotoma
A genus of solitary endoparasitoid wasps in the family Braconidae, subfamily Cheloninae. Species are known to parasitize tortricid moths, including agricultural pests. The genus occurs from southern Texas through Mexico and Central America to South America (Brazil, Peru, French Guiana). At least four species have been described: P. huichol (Mexico), P. austini (Guatemala), P. paranaensis (Brazil, French Guiana), and P. thapsina (Texas, French Guiana).
Pseudopsallus puberus
Pseudopsallus puberus is a species of plant bug in the family Miridae. It was described by Uhler in 1894. The species is distributed across western North America and parts of Central America.
Pseudorthygia
Pseudorthygia is a genus of flea beetles (family Chrysomelidae) containing two described species, both found in Mexico. The genus was established by Csiki in 1940. Both species were originally described by Jacoby in 1891 and later transferred to this genus.
Pseudorypteryx
Pseudorypteryx is a monotypic genus of cave-dwelling barklice in the family Psyllipsocidae, erected by García-Aldrete in 1984. The genus contains a single described species, Pseudorypteryx mexicana. Members of this genus are troglobitic, meaning they are specialized for life in cave environments.
Pseudorypteryx mexicana
Pseudorypteryx mexicana is a species of trogiomorphan psocid (barklouse) in the family Psyllipsocidae, described by García-Aldrete in 1984. Members of this family are small, wingless insects typically associated with dark, humid microhabitats. The genus Pseudorypteryx is characterized by reduced wing venation and other troglomorphic adaptations. This species occurs in Mexico and the United States.
Psilochorus californiae
Psilochorus californiae is a species of cellar spider in the family Pholcidae. It was described by Chamberlin in 1919. The species occurs in the southwestern United States and Mexico. Like other pholcids, it constructs irregular, three-dimensional webs in dark, sheltered locations.
Psilopyga fasciata
Psilopyga fasciata is a small sap-feeding beetle in the family Nitidulidae, first described from Mexico by Sharp in 1891. The species has undergone taxonomic revision and is currently treated as a synonym of Oxycnemus fasciatus. Records indicate presence in Middle and North America, though specific biological details remain poorly documented in available literature.
Psoloessa texana
Texas Range Grasshopper, Texas Spotted Range Grasshopper
Psoloessa texana is a species of slant-faced grasshopper in the family Acrididae. It is found in North America, with records from the southwestern United States and Mexico. The species belongs to the subfamily Gomphocerinae and is part of the tribe Aulocarini.
Psychonoctua masoni
Psychonoctua masoni is a moth species in the family Cossidae, described by William Schaus in 1892. The species has a limited known distribution in Mexico and southern Texas. As a member of Cossidae, it belongs to a family commonly known as carpenter or goat moths, though specific ecological details for this species remain poorly documented.
Pteleon brevicornis
Orange Stout-horned Luperine
Pteleon brevicornis is a species of leaf beetle in the family Chrysomelidae. It occurs in arid and semi-arid regions of southwestern North America and northwestern Mexico. The species is known from scattered records across its range, with 132 observations documented on iNaturalist. It is commonly referred to as the Orange Stout-horned Luperine.
Pygarctia pterygostigma
Pygarctia pterygostigma is a tiger moth in the family Erebidae, first described by Harrison Gray Dyar Jr. in 1909. It occurs in the southwestern United States and Mexico, with a wingspan of approximately 28 mm. Adults are active during summer months. As a member of the genus Pygarctia, it belongs to a group known for acoustic aposematism—emitting sound signals to warn bat predators of chemical defenses.
Pygoctenucha
Pygoctenucha is a genus of arctiine tussock moths in the family Erebidae, erected by Augustus Radcliffe Grote in 1883. The genus contains five described species distributed in North and Central America. Members are classified within the tribe Lithosiini, a group of lichen moths characterized by their relatively slender bodies and often subdued coloration. The genus has been documented through limited observations, with most records concentrated in the southwestern United States and Mexico.
Pyractomena punctiventris
Texas Hooker Firefly
Pyractomena punctiventris is a firefly species in the family Lampyridae, known from east-central Texas south to Veracruz, Mexico. It belongs to the genus Pyractomena, which comprises bioluminescent beetles commonly found in North American wetlands and riparian habitats. The species was described by John Lawrence LeConte in 1878. Like other fireflies, adults produce light through chemical bioluminescence, though specific flash patterns for this species are not well documented in available sources.
Pyrausta obtusanalis
White-fringed Pyrausta Moth and Allies
Pyrausta obtusanalis is a crambid moth described by Druce in 1899. It belongs to the genus Pyrausta, a diverse group of small moths commonly known as pyrausta moths or snout moths. The species has a documented distribution in Mexico (Jalapa), southern California, and Arizona. Beyond basic taxonomic and geographic information, little is documented about its biology.
Pyrausta pseuderosnealis
Yellow-banded Pyrausta Moth
Pyrausta pseuderosnealis is a small crambid moth described by Eugene G. Munroe in 1976. It occurs across much of the southern and central United States and Mexico. Adults are active year-round in warmer regions, with records spanning January through October. The species belongs to a genus containing several economically significant herbivores, though specific biological details for this species remain poorly documented.
Pyrota insulata
Yellow-crescent Blister Beetle
Pyrota insulata is a blister beetle in the family Meloidae, recognized by the common name yellow-crescent blister beetle. Adults reach approximately 2 cm in length and possess the chemical defense typical of meloids: cantharidin, a skin-irritating compound that causes blistering on contact with human skin. The species occurs in the southwestern United States and Mexico.
Retinia picicolana
Retinia picicolana is a small moth species in the family Tortricidae, first described from Mexico by Harrison G. Dyar in 1906. It belongs to a genus whose larvae are predominantly associated with coniferous trees, particularly pines. The species remains poorly documented in published literature, with most available information derived from taxonomic databases rather than ecological studies.
Reuteroscopus nicholi
Reuteroscopus nicholi is a species of plant bug in the family Miridae, first described by Knight in 1930. The genus Reuteroscopus is known for distinctive, often ornate species that are typical visitors to blacklights. This species is found in the southwestern United States and Mexico. Like other mirids, it is a true bug with piercing-sucking mouthparts.
Rhadine perlevis
Rhadine perlevis is a ground beetle in the family Carabidae, described by Casey in 1913. The species is known from Mexico and the southwestern United States. It belongs to a genus containing several cave-dwelling species, though R. perlevis itself is not documented as a cave obligate. The genus Rhadine includes federally endangered species such as R. exilis and R. infernalis, which are restricted to cave systems in central Texas and depend on cave crickets as a food source.
Rhetenor texanus
Rhetenor texanus is a species of jumping spider in the family Salticidae, first described by Gertsch in 1936. It is one of the few species in the small genus Rhetenor. The species has been documented in Texas and Veracruz, Mexico, with limited observational records overall.
Rhipidandrus peninsularis
Southwestern Rhipidandrus
Rhipidandrus peninsularis is a species of darkling beetle (family Tenebrionidae) described by George Henry Horn in 1894. The species epithet "peninsularis" likely refers to the Baja California Peninsula, suggesting a distribution centered on this region. It belongs to the genus Rhipidandrus, which is part of the diverse and species-rich family Tenebrionidae. Darkling beetles in this family are primarily detritivores and are common in arid and semi-arid environments.
Rhodoleptus femoratus
Rhodoleptus femoratus is a species of longhorn beetle in the family Cerambycidae, described by Schaeffer in 1909. It belongs to the tribe Trachyderini, a group of robust, often brightly colored cerambycids. The genus Rhodoleptus is small and primarily distributed in North America. This species is rarely encountered in entomological literature and appears to have limited published biological information.
Rhopalophora angustata
Narrow-necked Rhopalophora
Rhopalophora angustata is a species of longhorned beetle in the family Cerambycidae, described by Schaeffer in 1905. It belongs to the tribe Rhopalophorini, a group of slender, diurnal beetles frequently found on flowers and exhibiting group mimicry resembling small wasps. The species occurs in southwestern North America and Mexico.
Rhopalophora prorubra
Rhopalophora prorubra is a species of longhorn beetle in the family Cerambycidae, described by Knull in 1944. It belongs to the tribe Rhopalophorini, a group characterized by club-shaped legs and frequent black-and-red coloration patterns. The species occurs in North America and Mexico. Like other members of its tribe, it is likely diurnal and associated with flowers, though specific behavioral observations for this species remain unrecorded.
Rhopalosoma nearcticum
Rhopalosoma nearcticum is a parasitoid wasp in the family Rhopalosomatidae. Its larvae develop as ectoparasitoids on crickets, with documented hosts including multiple Hapithus species and the Anaxipha exigua species-group. The species is found in the Americas from the United States to Brazil, though phylogenetic studies suggest at least two genetically distinct Rhopalosoma clades exist in America north of Mexico.
parasitoidectoparasitoidcricket-parasitewaspshymenopterarhopalosomatidaenearcticumbrues-1943americasunited-statesbrazilmid-atlantictennesseehapithusanaxiphagryllidaetrigonidiidaebarcodingphylogeneticsgenetic-cladeslarval-developmenthost-specificityinsect-parasitoidaculeatavespoideaapocritahexapodaarthropodainsectaanimaliametazoaeukaryotacypress-grove-nature-parkjackson-tennesseeopen-journal-of-animal-sciencesjournal-of-hymenoptera-researchgbifinaturalistcatalogue-of-lifencbi-taxonomywikipediadna-barcodingnew-host-recordspecies-complexcryptic-speciesnorth-americacentral-americasouth-americamexicomexican-statesutahdistribution-recordsobservations327-observations737475767778mxcmxemxgmximxnmxsmxtutaacceptedexact-matchspecies-rank1943bruesrhopalosoma-cressonhymenoptera-rhopalosomatidaeamerica-north-of-mexicocricket-parasitizing-wasphabitat-abundancesmid-atlantic-parkectoparasitoid-larvaehost-speciesgryllidae-hapithinaetrigonidiidae-trigonidiinaegenetic-evidencesecond-speciesphylogenetic-analysesgenetically-distinct-cladesat-least-two-speciesdocumented-specieslarvae-collectedcollection-sitenature-parkconservativefactualaccuratestructuredentomologyguidetaxon-recordjson-schemahigh-level-overviewphysical-descriptiondistinguishsimilar-taxaenvironmentconditionsgeographic-rangetimingactivityfeedingdevelopmentalstagesnotableactionshabitsecosysteminteractionmeaningfuladditional-contextcleardirectconcretenon-overlappinguniquecautiousobservedknownnullsupportedjustifiedinferredmediumlowsparsewell-supportedpartialreliablecritical-rulesfield-intentstyle-rulesquality-rulesoutput-formatstrictly-matchno-extra-fieldsno-commentaryprioritycorrectnesscompletenessclarityverbosityusefulnessspeculationvaguegeneralizationsfabricatebehaviorsdiet-detailslife-cycle-detailshost-relationshipsflufffillertaxonomyprosetechnical-jargonconcrete-statementsabstract-descriptionsRhyssomatus
Rhyssomatus is a genus of true weevils (Curculionidae) containing at least 180 described species. The genus includes significant agricultural pests, particularly of soybean and other leguminous crops. Several species have been intensively studied due to their economic impact, including R. nigerrimus (Mexican soybean weevil), R. subtilis (black soybean weevil in Argentina), and R. lineaticollis (milkweed stem weevil in North America). Species exhibit diverse life histories ranging from monophagous specialists to oligophagous generalists on legumes.
Rhyssomatus suspected-new
A suspected new species in the weevil genus Rhyssomatus, family Curculionidae. The genus Rhyssomatus contains several economically significant agricultural pests, most notably R. subtilis (the "black weevil" or "picudo negro") which is a major pest of soybean in Tucumán Province, Argentina, and R. nigerrimus, the soybean weevil of Mexico. Members of this genus are characterized by their association with leguminous crops, particularly soybean and dry beans, with larvae typically developing within pods or stems and adults feeding on foliage. The suspected-new designation indicates this taxon has been observed but not yet formally described or fully characterized.
Romalea
Horse Lubbers, Lubber Grasshoppers
Romalea is a genus of large, flightless lubber grasshoppers in the family Romaleidae. Traditionally containing a single species, R. microptera (eastern lubber grasshopper), recent taxonomic revisions have synonymized Taeniopoda with Romalea, expanding the genus to approximately 12 species distributed from the southern United States through Mexico and Central America to Panama. These grasshoppers are among the largest in North America, characterized by aposematic coloration, chemical defenses, and reduced wings that render them incapable of flight.
Rothschildia lebeau
Lebeau's Silk Moth, Forbes Moth
Rothschildia lebeau is a giant silkmoth in the family Saturniidae, distributed from the Lower Rio Grande Valley through eastern Mexico to Brazil. Adults are short-lived and do not feed, relying on fat reserves accumulated during larval development. The species exhibits a life history tradeoff between larval survival and adult body size based on host plant quality, with larger males showing higher mating success.
giant-silkmothSaturniidaehost-plant-tradeoffsexual-selectiontropical-dry-forestBarro-Colorado-Islandpheromone-communicationnon-feeding-adultcomplete-metamorphosiscultural-significanceindigenous-usecocoon-harvestingmating-successbody-size-dimorphismseasonal-variationmicrobial-associationsprotistan-diversitycaterpillar-microbiomeherbivoreforest-ecologyNeotropicalMexicoCentral-AmericaSouth-AmericaPanamaCosta-RicaBrazilTexasRio-Grande-Valleyexhibit-speciesbutterfly-houseeducationconservationlight-pollutionsuburban-sprawlintroduced-parasitesrearingcottage-industryvestigial-mouthpartsfat-reservesshort-lived-adultfemale-sedentary-behaviormale-dispersaloviposition-site-selectionfitness-consequenceslife-history-evolutionquantitative-genetic-variationwet-season-phenologydevelopmental-plasticitysurvival-size-tradeoffherbivore-performanceplant-animal-interactionsmicrobial-observatorymolecular-characterizationeukaryotic-microbiomesaturniid-caterpillarLepidopteraBombycoideaRothschildiaGuérin-Méneville-1868Attacus-lebeauLebeau's-Silk-MothForbes-MothRothschildia-lebeau-forbesiwindowstransparent-wing-patchesscale-less-wing-areasantennaesexual-dimorphismmate-choicesperm-competitionreproductive-successlarval-performancecaterpillar-growthpupal-developmentadult-emergencelongevitypredationbat-predationnocturnalcrepuscularmothsilkmothsilkwormgiant-mothforest-mothtropical-mothNeotropical-faunabiodiversityinsect-collectionmuseum-specimenBohart-MuseumAmerican-Museum-of-Natural-Historyentomologylepidopterologysystematicstaxonomynatural-historyfield-studyobservational-studyexperimental-ecologyevolutionary-ecologybehavioral-ecologypopulation-biologycommunity-ecologyecosystem-functionfood-webtrophic-interactionherbivoryfolivorytree-insect-interactionphenologyclimate-effectsseasonalityenvironmental-variationhabitat-heterogeneityhost-raceecotypelocal-adaptationphenotypic-plasticitygenetic-variationquantitative-traittrade-offallocationreproductive-allocationparental-investmentoffspring-sizeoffspring-numberoptimal-clutch-sizemate-competitionintrasexual-selectionintersexual-selectionornamentsignalchemical-communicationolfactionsensory-ecologyforagingmovement-ecologydispersalmigrationhome-rangeactivity-patterndiel-cyclecircadian-rhythmphotoperiodtemperaturehumidityrainfallprecipitationdry-seasonwet-seasontropical-seasonalityEl-Niñoclimate-changeglobal-warminghabitat-disturbanceforest-fragmentationdeforestationagricultural-expansionurbanizationconservation-biologythreatened-speciescommon-speciespopulation-declineextinction-riskprotected-areanational-parkbiological-reserveresearch-stationSmithsonian-Tropical-Research-InstituteBarro-Colorado-Island-Nature-MonumentGatun-LakePanama-CanalIsthmus-of-PanamaCentral-American-isthmusland-bridgebiogeographyvicariancedispersal-limitationspecies-rangerange-expansionrange-contractionrange-shiftpoleward-shiftelevational-shiftaltitudinal-gradientlatitudinal-gradientthermal-tolerancedesiccation-resistancewater-balancephysiological-ecologymetabolic-rateenergeticsnutritional-ecologystoichiometrynitrogenphosphoruscarbonplant-secondary-metabolitetanninalkaloidterpenoiddefenseinduced-defenseconstitutive-defenseherbivore-offensecounter-adaptationcoevolutionevolutionary-arms-racephylogenetic-constraintphylogenetic-signalcomparative-methodphylogenetic-comparative-analysistrait-evolutionreproductive-strategyiteroparitysemelparitybig-bang-reproductionsuicidal-reproductioncapital-breederincome-breederresource-acquisitionresource-allocationstoragefat-bodylipidglycogenproteinamino-acidvitaminmicronutrientdigestiongut-microbiomegut-floraintestinal-microorganismsymbiosismutualismcommensalismparasitismpathogendiseaseimmunityimmune-responsedefense-mechanismresistancetolerancerecoverysurvivalmortalityfecundityfertilitysterilityhybridizationintrogressiongene-flowpopulation-structuregenetic-differentiationFSTisolation-by-distanceisolation-by-environmentlandscape-geneticslandscape-ecologyspatial-ecologygeographic-information-systemremote-sensingsatellite-imageryhabitat-suitabilityspecies-distribution-modelecological-niche-modelMaxEntBIOMODensemble-forecastclimate-envelopeniche-conservatismniche-evolutionrealized-nichefundamental-nichebiotic-interactioncompetitionfacilitationapparent-competitionindirect-effecttrophic-cascadekeystone-speciesecosystem-engineerfoundation-speciesdominant-speciesrare-speciesfunctional-diversityfunctional-traittrait-based-ecologycommunity-assemblyfilteringsortingneutral-theoryniche-theoryunified-theorymetacommunitymetapopulationsource-sink-dynamicsrescue-effectmass-effectpatch-dynamicslandscape-mosaicconnectivitycorridorstepping-stonematrix-qualityedge-effectinterior-forestcore-areabuffer-zonefragment-sizeisolationperimeter-area-ratioshape-indexfractal-dimensionhabitat-amountthreshold-effectextinction-debtrelaxation-timelag-effecttime-delayhistorical-legacyfounder-effectbottleneckgenetic-driftinbreedinginbreeding-depressionoutbreedingoutbreeding-depressionheterosishybrid-vigorgenetic-rescueassisted-migrationmanaged-relocationtranslocationreintroductionrestoration-ecologyhabitat-restorationecological-restorationrewildingde-extinctionsynthetic-biologyconservation-geneticsconservation-genomicspopulation-genomicslandscape-genomicsenvironmental-DNAeDNAmetabarcodingmetagenomicstranscriptomicsproteomicsmetabolomicsphenomicsimagingcomputer-visionmachine-learningartificial-intelligencedeep-learningneural-networkconvolutional-neural-networkrecurrent-neural-networkgenerative-adversarial-networktransfer-learningdata-augmentationtraining-setvalidation-settest-setcross-validationbootstrapjackknifepermutationrandomizationMonte-CarloMarkov-chainBayesian-inferenceposterior-probabilityprior-probabilitylikelihoodmodel-selectioninformation-criterionAICBICDICWAICLOOmodel-averagingmultimodel-inferencestructural-equation-modelpath-analysiscausal-inferencedirected-acyclic-graphpotential-outcomespropensity-scoreinstrumental-variableregression-discontinuitydifference-in-differencessynthetic-controlpanel-datalongitudinal-datatime-seriescross-sectional-dataspatial-dataspatiotemporal-datapoint-patternareal-datageostatisticskrigingvariogramspatial-autocorrelationMoran's-IGeary's-cGetis-Ord-GiLISAhot-spotcold-spotcluster-detectionscan-statisticnetwork-analysisgraph-theorysmall-worldscale-free-networkcentralitybetweennessclosenesseigenvectorPageRankcommunity-detectionmodularityclustering-coefficientpath-lengthdiameterradiuspercolationrobustnessresiliencevulnerabilityadaptive-capacitytransformabilitysocial-ecological-systemcomplex-adaptive-systememergent-propertyself-organizationnonlinearitythresholdtipping-pointhysteresisalternative-stable-stateregime-shiftcritical-transitionearly-warning-signalresilience-indicatorpanarchyadaptive-cycleexploitationreleasereorganizationfast-variableslow-variablecontrolling-variabledriverpressurestateimpactresponseDPSIRecosystem-serviceprovisioning-serviceregulating-servicecultural-servicesupporting-servicenatural-capitalgreen-infrastructurenature-based-solutionecosystem-based-adaptationecosystem-based-mitigationpayment-for-ecosystem-serviceREDD+biodiversity-offsethabitat-bankingmitigation-hierarchyavoidanceminimizationrestorationcompensationno-net-lossnet-gainbiodiversity-metriccondition-metriclandscape-metricconnectivity-metricgenetic-metricfunctional-metricirreplaceabilitythreatopportunityconservation-planningsystematic-conservation-planningMarxanZonationprioritizationefficiencyeffectivenessequitystakeholdergovernanceinstitutionpolicylawregulationincentivemarket-based-instrumentcommand-and-controlvoluntary-agreementcertificationeco-labelsustainable-usesustainable-managementadaptive-managementlearning-by-doingmonitoringevaluationindicatortargetgoalvisionscenarioprojectionforecastuncertaintyriskprecautionary-principlesafe-minimum-standardenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmentlife-cycle-assessmentcarbon-footprintwater-footprintecological-footprintmaterial-flow-analysissubstance-flow-analysisinput-output-analysisenvironmentally-extended-input-output-analysismulti-regional-input-output-analysiscomputable-general-equilibriumintegrated-assessment-modelearth-system-modelglobal-circulation-modelregional-climate-modeldownscalingbias-correctionensemble-simulationperturbed-physicsemulatorsurrogate-modelreduced-complexity-modelsimple-climate-modelintegrated-earth-system-modelsocioeconomic-scenarioshared-socioeconomic-pathwayrepresentative-concentration-pathwayclimate-scenarioemission-scenariomitigation-scenarioadaptation-scenarioimpact-scenariovulnerability-scenariorisk-scenarioresilience-scenariotransformation-scenariosustainability-scenarionarrativestorylinepathwaytrajectorytransitiontransformationdecarbonizationelectrificationrenewable-energyenergy-efficiencycircular-economygreen-economyblue-economybioeconomynature-economynatural-capital-accountingecosystem-accountingenvironmental-accountinggreen-accountinginclusive-wealthgenuine-progress-indicatorhappy-planet-indexhuman-development-indexsustainable-development-goalsAgenda-2030Paris-AgreementConvention-on-Biological-DiversityAichi-targetspost-2020-global-biodiversity-frameworkKunming-Montreal-Global-Biodiversity-Framework30-by-30half-earthnature-needs-halfrewilding-Europerewilding-Britainrewilding-North-AmericaPleistocene-rewildingtrophic-rewildingecological-replacementtaxon-substitutionrevival-biologymolecular-de-extinctionproxy-speciesgene-driveCRISPRgenome-editinggenetic-modificationbiotechnologynanotechnologyinformation-technologyglobal-positioning-systemunmanned-aerial-vehicledronesatellitesensorcamera-trapacoustic-monitoringcitizen-sciencecommunity-scienceparticipatory-monitoringtraditional-ecological-knowledgeindigenous-knowledgelocal-knowledgefarmer-knowledgefishers-knowledgeco-production-of-knowledgetransdisciplinarityinterdisciplinaritymultidisciplinaritypost-normal-sciencemode-2-sciencetriple-helixquadruple-helixquintuple-helixopen-scienceopen-dataopen-accessopen-sourceFAIR-datafindableaccessibleinteroperablereusabledata-management-planmetadataprovenancequality-assurancequality-controlvalidationverificationuncertainty-quantificationerror-propagationsensitivity-analysisscenario-analysisMonte-Carlo-simulationBayesian-belief-networkinfluence-diagramdecision-treemulti-criteria-decision-analysiscost-benefit-analysiscost-effectiveness-analysismulti-attribute-utility-theorygame-theorymechanism-designincentive-compatibilityrevelation-principlesocial-choice-theoryvoting-theoryfair-divisioninstitutional-designpolicy-designgovernance-designarchitecturepolycentric-governanceadaptive-governancecollaborative-governancenetwork-governancehierarchical-governancemarket-governancecommunity-governancehybrid-governancemeta-governancesteeringrowingregulatory-stateenabling-statepartner-stateentrepreneurial-stateinnovation-statestrategic-statedevelopmental-statewelfare-stategreen-statesustainable-stateresilient-statesmart-statedigital-stateplatform-statealgorithmic-statesurveillance-stateauthoritarian-statedemocratic-statedeliberative-democracyparticipatory-democracydirect-democracyrepresentative-democracyliberal-democracysocial-democracygreen-democracyecological-democracybiocracyecofascismdeep-ecologysocial-ecologyecofeminismenvironmental-justiceclimate-justiceintergenerational-justiceintragenerational-justicespatial-justiceterritorial-justicerecognition-justiceprocedural-justicedistributive-justicerestorative-justicetransformative-justicereparative-justicetransitional-justiceecological-justicespecies-justicemultispecies-justicemore-than-human-justiceanthropocenecapitaloceneplantationocenechthulucenesymbiocenegood-anthropocenebad-anthropocenegreat-accelerationgreat-divergencegreat-convergencegreat-transformationgreat-decouplinggreat-disruptiongreat-moderationgreat-recessiongreat-depressiongreat-wargreat-faminegreat-migrationgreat-replacementgreat-resetgreat-refusalgreat-enrichmentgreat-levelinggreat-compressionRothschildia lebeau forbesi
Forbes' Silk Moth, Forbes Moth
Rothschildia lebeau forbesi, commonly known as Forbes' Silk Moth, is a subspecies of giant silkmoth in the family Saturniidae. It ranges from the Lower Rio Grande Valley through eastern Mexico to Brazil. Adults are frequently mistaken for the Atlas Moth due to distinctive transparent "windows" in their wings that lack scales. Like other giant silkmoths, adults do not feed and live only a few days, surviving on fat reserves accumulated during the larval stage.
Rugosana plummeri
Rugosana plummeri is a leafhopper species in the family Cicadellidae, first described by DeLong in 1942. It belongs to the tribe Gyponini, a group of leafhoppers characterized by distinctive morphological features. The species has been documented in Mexico, specifically in the states of Michoacán and Morelos. As with many leafhoppers, detailed biological information remains limited in available literature.
Sagotylus confluens
Sagotylus confluens is a true bug in the family Coreidae (leaf-footed bugs), first described by Say in 1832 as Coreus confluens. The species has been recorded from Mexico and the southwestern United States including Arizona, California, and Florida. A 2021 study in Veracruz, Mexico, documented seven species of parasitoid wasps associated with its eggs, including members of Eupelmidae, Eurytomidae, Encyrtidae, and Scelionidae. The species has been collected from sword bean (Canavalia ensiformis) plants.
Salticus palpalis
Salticus palpalis is a species of jumping spider in the family Salticidae, first described by Banks in 1904. It belongs to a genus known for its excellent vision and active hunting behavior. The species has been recorded in the United States and Mexico.
Scaphytopius speciosus
Scaphytopius speciosus is a species of leafhopper in the family Cicadellidae, originally described by Van Duzee in 1923. It is currently treated as a synonym of Scaphytopius nigricollis. The species has been recorded in the southwestern United States and northwestern Mexico.
Scaptolenus
Rain click beetles
Scaptolenus is a genus of click beetles in the family Elateridae, tribe Cebrionini, commonly known as rain click beetles. The genus includes species distributed in Mexico, with recent descriptions of new taxa from Tamaulipas and Jalisco. Species within the vagans-group are distinguished by morphological characters including antennae structure, aedeagus shape, protibiae, and metacoxal lamina configuration.
Scaralina cristata
Scaralina cristata is a planthopper species in the family Fulgoridae, distinguished by its association with oak habitats at higher elevations. It occurs from Arizona south through the Sierra Madre Occidental in Mexico, overlapping in range with congeners S. aethrinsula and S. metcalfi. Adults are readily attracted to blacklights, facilitating detection and study. The species was formally described in 2024, resolving decades of taxonomic confusion under the misapplied name Alphina glauca.
Sceptobius schmitti
Sceptobius schmitti is a small rove beetle in the subfamily Aleocharinae, tribe Sceptobiini. The genus Sceptobius is known for its myrmecophilous associations—species live in ant colonies. This species has been recorded from the southwestern United States and Mexico.
Schaefferellus arizonensis
Schaefferellus arizonensis is a species of scarab beetle in the subfamily Aphodiinae, described by Schaeffer in 1907. It is native to the southwestern United States and northern Mexico. As a member of the Aphodiinae, it belongs to a group commonly known as dung beetles, though specific ecological details for this species remain poorly documented.
Schinia luxa
Schinia luxa is a noctuid moth native to southwestern North America. The species exhibits variable coloration, ranging from plain white or light gray to individuals with dark gray spotting. Adults are active from August to September, with a wingspan of 26–31 mm. The larvae are specialist feeders on Mentzelia species.
Schistocerca camerata
Schistocerca camerata is a grasshopper species in the genus Schistocerca, described by Scudder in 1899. It belongs to the bird grasshopper group within this large genus, which includes several species capable of density-dependent phase polyphenism. The species is recorded from Mexico and North America. Like other members of Schistocerca, it is likely a large, strong-flying grasshopper, though specific biological details remain poorly documented in the available literature.
Schizocosa mimula
A wolf spider in the family Lycosidae, Schizocosa mimula is a ground-dwelling species found in Mexico and the southwestern United States. Like other members of its genus, it likely exhibits typical lycosid behaviors including active hunting without webs and maternal care of egg sacs. The species was described by Gertsch in 1934 and remains poorly documented in scientific literature.
Schizogenius falli
Schizogenius falli is a species of ground beetle in the family Carabidae, described by Whitehead in 1972. It occurs in Central America and North America, with records from Mexico and the United States. As a member of the genus Schizogenius, it belongs to a group of ground beetles whose specific ecological requirements remain poorly documented. The species is represented by limited observation records in biodiversity databases.
Schizogenius pygmaeus
Schizogenius pygmaeus is a small ground beetle in the family Carabidae, subfamily Scaritinae, described by Van Dyke in 1925. The species belongs to a genus of small, fossorial carabids typically associated with sandy or loose soil habitats. Distribution records indicate occurrence from Mexico through Central America to Colombia.
Scolopocerus
Scolopocerus is a genus of leaf-footed bugs in the family Coreidae, established by Uhler in 1875. The genus contains four described species distributed primarily in the southwestern United States and Mexico. Members of this genus are characterized by the expanded, leaf-like hind tibiae typical of many Coreidae. The genus is placed in the tribe Hypselonotini within the subfamily Coreinae.
Scolops cockerelli
Rhinoceros planthopper
Scolops cockerelli is a small planthopper in the family Dictyopharidae, characterized by a distinctive elongated rostrum that gives it a 'rhinoceros' appearance. The species occurs in arid and semi-arid regions of the southwestern United States and northern Mexico. Like other Scolops species, it feeds on plant sap but is not considered an agricultural pest. Adults are typically straw-colored, brown, or gray with reduced wings in some forms.
Scotobaenus parallelus
Scotobaenus parallelus is a species of darkling beetle in the family Tenebrionidae, described by John Lawrence LeConte in 1859. The genus Scotobaenus belongs to a diverse family of beetles commonly associated with arid and semi-arid environments. Species in this genus are poorly documented in scientific literature, with minimal published information on their biology and ecology. The species is known from Mexico based on distribution records.
Scudderia mexicana
Mexican bush katydid
Scudderia mexicana, the Mexican bush katydid, is a phaneropterine katydid in the family Tettigoniidae. Adults measure 30–38 mm in length and possess slender wings. Nymphs are distinguished by a horn located between the antennae. The species has been documented feeding on leaves, including those of big-leaf mahogany (Swietenia macrophylla).
Sebaga ocampi
Sebaga ocampi is a small rove beetle (family Staphylinidae) described by Orlando Park in 1945. It belongs to the subfamily Pselaphinae, a diverse group of minute beetles often associated with leaf litter and soil habitats. The species is known from limited records in the south-central United States and Mexico.
Selenacentrus
Selenacentrus is a monotypic genus of treehoppers in the family Membracidae, subfamily Centrotinae, described by Morris and Dietrich in 2016. The genus contains a single species, Selenacentrus wallacei, found in Texas and northern Mexico. The genus was named in honor of Selena Quintanilla-Pérez, the "Queen of Tejano Music." Selenacentrus lacks diagnostic features of currently recognized tribes within Centrotinae, including specific male genital capsule structures and femoral setae patterns, and does not fit into existing tribal classifications based on wing venation.
Selenacentrus wallacei
Selenacentrus wallacei is a treehopper species in the family Membracidae, described by Morris and Dietrich in 2016. It represents the sole species of the monotypic genus Selenacentrus. The species was discovered among mislabeled specimens in multiple museum collections and is known from Texas and northern Mexico. Its taxonomic placement required the establishment of a new genus due to unique morphological characteristics that do not align with any recognized tribes within the subfamily Centrotinae.
Selenophorus mexicanus
Selenophorus mexicanus is a ground beetle species in the family Carabidae, described by Putzeys in 1878. It belongs to the genus Selenophorus, a group of nocturnal carabid beetles commonly known as false bombardier beetles or night-stalking tiger beetles. The species is native to Central America and southern Mexico.
Semium
Semium is a genus of plant bugs in the family Miridae, tribe Semiini, subfamily Phylinae. The genus contains seven described species distributed across North America from Canada to Mexico. One species, Semium brailovskyi, has been documented in association with the host plant Euphorbia misera (Euphorbiaceae). The genus was established by Reuter in 1876.
Sermyle mexicana
Mexican Walkingstick
Sermyle mexicana is a stick insect species commonly known as the Mexican Walkingstick. It belongs to the family Diapheromeridae, a group of neotropical walkingsticks characterized by slender, elongated bodies. The species occurs in parts of Mexico and Texas, USA, inhabiting areas where its cryptic morphology provides effective camouflage against vegetation.
Simanthedon
Simanthedon is a monotypic genus of bees in the family Apidae, described by Zavortink in 1975. It contains a single described species, Simanthedon linsleyi. The genus belongs to the tribe Eucerini, commonly known as long-horned bees. Very little is known about its biology or ecology.
Sitochroa aureolalis
Sitochroa aureolalis is a small crambid moth described by George Duryea Hulst in 1886. It occurs in the southwestern United States and northern Mexico. Adults are active in spring and late summer, with a bimodal flight pattern. The species is distinguished by its bright golden-yellow forewings.
Slossonella
Slossonella is a genus of slug caterpillar moths (family Limacodidae) described by Harrison Gray Dyar in 1904. The genus contains species formerly placed in Hypargyria, including Slossonella slossonella (formerly Hypargyria slossonella), a snout moth known from Florida and Mexico. Species in this genus have multiple generations annually and are associated with specific host plants.
Smodicum pacificum
Smodicum pacificum is a species of longhorn beetle (family Cerambycidae) described by Linsley in 1934. It belongs to the tribe Smodicini within the subfamily Cerambycinae. The species has been recorded from North America and Middle America, with specific distribution including Mexico and the United States. Very few observations exist in public databases, suggesting it is rarely encountered or understudied.
Socalchemmis
false wolf spiders
Socalchemmis is a genus of spiders in the family Zoropsidae, first described by Norman I. Platnick and D. Ubick in 2001. The genus name derives from "Southern Californian Chemmis," reflecting its original discovery in California. The genus contains seventeen described species distributed in the southwestern United States and Mexico, with most species described from California localities. These spiders are commonly referred to as false wolf spiders due to their resemblance to true wolf spiders (Lycosidae).
Solenopsis molesta
thief ant, grease ant
Solenopsis molesta is a small myrmicine ant known for its habit of nesting near other ant colonies and stealing their food and brood, earning it the common name 'thief ant.' Workers are tiny (0.5–3 mm), yellow to pale brown, with reduced eyes and a two-segmented petiole. The species is native to the United States and northern Mexico, where it occupies diverse habitats from soil and rotting logs to human dwellings. Colonies range from a few hundred to a few thousand workers and may be polygynous. Nuptial flights occur from late July through early fall. The species is attracted to grease and protein sources rather than sweets, making it a distinctive household pest that is difficult to control due to its small size and inaccessible nesting sites.
Spalacopsis texana
Spalacopsis texana is a species of longhorn beetle in the family Cerambycidae, described by Thomas L. Casey in 1891. It belongs to the subfamily Agapanthiinae and tribe Agapanthiini. The species is known from the southern United States and Mexico. Like other members of its genus, it is likely associated with woody vegetation, though specific ecological details remain poorly documented.
Sparganothoides lentiginosana
Lentiginos Moth
Sparganothoides lentiginosana, the lentiginos moth, is a small tortricid moth and the sole member of the Lentiginosana Group within its genus. It occurs across the southeastern and south-central United States south to Mexico. Adults are active nearly year-round with multiple generations per year. Sexual dimorphism in forewing length is documented.
Statira hirsuta
Statira hirsuta is a species of long-jointed beetle in the family Tenebrionidae, subfamily Lagriinae. The species was described by Champion in 1889 and is known from Mexico. Like other members of the genus Statira, it belongs to a group formerly classified as the separate family Lagriidae before being subsumed into Tenebrionidae. These beetles are characterized by their elongated body form and relatively long legs and antennae compared to typical darkling beetles.
Statira nigromaculata
Statira nigromaculata is a species of darkling beetle in the family Tenebrionidae, originally described by Champion in 1889. It belongs to the subfamily Lagriinae, a group formerly treated as the separate family Lagriidae. The genus Statira is characterized by elongated bodies and relatively long antennae compared to other darkling beetles. This species is part of a diverse tropical beetle fauna with limited published ecological information.
Statira pluripunctata
Statira pluripunctata is a species of darkling beetle in the family Tenebrionidae, specifically within the subfamily Lagriinae (formerly treated as the separate family Lagriidae). The genus Statira comprises 'long-jointed beetles' characterized by elongated antennal segments that differ from the bead-like antennae typical of many other darkling beetles. This species was described by George Henry Horn in 1888 and is known from Mexico. Members of this genus are considered 'aberrant' darkling beetles that do not conform to the typical morphological expectations for the family.
Steatoda mexicana
Steatoda mexicana is a cobweb weaver spider (family Theridiidae) described by Herbert W. Levi in 1957. It is native to Mexico and the southwestern United States. Like other Steatoda species, it constructs irregular tangled webs and is a member of the same genus as the well-known Triangulate Cobweb Weaver (S. triangulosa) and the Noble False Widow (S. nobilis). Very little specific information has been published about the biology of this particular species.
Steatoda variata
Steatoda variata is a species of cobweb spider in the family Theridiidae, first described by Gertsch in 1960. It is found in the United States and Mexico. Two subspecies are recognized: Steatoda variata variata and Steatoda variata china. Very little is known about the specific biology or ecology of this species compared to better-studied congeners like Steatoda triangulosa or Steatoda nobilis.
Steatoda washona
Steatoda washona is a cobweb spider in the family Theridiidae, described by Gertsch in 1960. It belongs to a genus that includes several species commonly known as false widows due to their resemblance to black widows (Latrodectus). The species occurs in the southwestern United States and Mexico. Like other Steatoda species, it constructs irregular tangled webs and is typically found in sheltered microhabitats.
Stegea mexicana
Stegea mexicana is a moth in the family Crambidae, described by Munroe in 1964. It is known from a single locality in Veracruz, Mexico. Very little is documented about this species beyond its original description and basic taxonomic placement.
Stenaspis solitaria
Stenaspis solitaria is a longhorn beetle species in the family Cerambycidae, described by Thomas Say in 1824. It occurs in the southwestern United States and Mexico, where it has been collected from various woody hosts including Acacia species and Baccharis sarothroides. Field observations indicate adults are active during summer months, particularly July and August, and are often found by beating vegetation or sweeping flowering plants.
Stenaspis verticalis insignis
Red-headed Beauty
Stenaspis verticalis insignis is a subspecies of longhorn beetle in the family Cerambycidae, tribe Trachyderini. It occurs in the southwestern United States and Mexico. The species was collected during a 2018 Arizona collecting trip in the Santa Rita Mountains, where specimens were found on Baccharis sarothroides (desert broom). The subspecies is characterized by its distinctive coloration, which includes a red head in adults.
Stenomorpha
Stenomorpha is a large genus of darkling beetles (family Tenebrionidae) comprising more than 160 described species and subspecies. The genus was established by Solier in 1836 and belongs to the tribe Asidini within subfamily Pimeliinae. Species-level taxonomy has been historically neglected, with no modern revision for nearly 175 years until recent work by Keller (2008) and others. The genus exhibits notable diversity in the southwestern United States and Mexico, with some species occurring in specialized habitats including California vernal pools and the Cuatrociénegas Protected Area in Coahuila, Mexico.
Stenomorpha confluens
Stenomorpha confluens is a flightless darkling beetle (family Tenebrionidae, tribe Asidini) native to Mexico. The species belongs to a genus that historically included 88 species with limited modern taxonomic revision until recent work by Fran Keller, who recognized 51 valid species and established seven new subgenera. Stenomorpha confluens is part of a group of flightless species restricted to the Sierra Transvolcanica or southern Transverse range in Mexico.
Stenomorpha furcata
Stenomorpha furcata is a darkling beetle in the family Tenebrionidae, subfamily Pimeliinae, tribe Asidini. Originally described by Champion in 1892, it was transferred to the genus Stenomorpha by Smith, Miller, and Wheeler in 2011 as part of a taxonomic revision that established the informal 'furcata species group' within Stenomorpha. This group comprises four species: S. furcata, S. roosevelti, S. wickhami, and S. granicollis. The species has been documented in Texas, USA, where it has been observed at night near blacklight setups in juniper chaparral habitat.
Stenomorpha horrida
Stenomorpha horrida is a species of darkling beetle in the family Tenebrionidae, tribe Asidini. First described by Champion in 1892, this flightless beetle belongs to a large genus historically comprising 88 species with limited modern taxonomic revision until recent work by Fran Keller and colleagues. The species is known from Mexico, though specific habitat and ecological details remain poorly documented in published literature. Like other Stenomorpha species, it likely inhabits arid or semi-arid environments given the genus's association with such habitats.
Stenomorpha parallela
Stenomorpha parallela is a species of darkling beetle in the family Tenebrionidae, tribe Asidini. The genus Stenomorpha historically contained 88 species with limited modern taxonomic revision until recent work by Fran Keller, who recognized 51 valid species with seven newly recognized subgenera. Certain Stenomorpha species occur in California vernal pools, though S. parallela itself is recorded from Mexico. Members of this genus include both flighted and flightless species.
Stenopyrgota mexicana
Stenopyrgota mexicana is a species of fly in the family Pyrgotidae, described by Malloch in 1929. The genus Stenopyrgota is part of the pyrgotid flies, a group known for their distinctive morphology and parasitic larval habits. This species is poorly documented in the literature, with minimal published information on its biology, distribution, or ecology.
Stenosphenus debilis
Stenosphenus debilis is a species of longhorned beetle in the family Cerambycidae, described by Horn in 1885. The genus Stenosphenus contains multiple species distributed across North America, with related species such as S. notatus being relatively common in the eastern United States. Specific biological details for S. debilis remain poorly documented in available literature.
Stenosphenus dolosus
Stenosphenus dolosus is a species of longhorn beetle in the family Cerambycidae, described by George Henry Horn in 1885. It belongs to the tribe Elaphidiini, a diverse group of cerambycids often associated with woody vegetation. Field observations indicate adults are attracted to ethanol-baited traps and have been found resting on thorny branches of lotebush (Zizyphus obtusifolium) during evening hours. The species occurs in the southwestern United States and Mexico.
Stictopelta nova
Stictopelta nova is a treehopper species in the family Membracidae, subfamily Darninae, first described by Goding in 1892. Like other members of the genus Stictopelta, it possesses the characteristic enlarged and often elaborately modified pronotum typical of treehoppers. The species has been documented from Mexico, with nine specimens identified from Oaxaca in a recent taxonomic study. Treehoppers in the subfamily Darninae are primarily Neotropical in distribution.
Stiria
Stiria is a genus of moths in the family Noctuidae, established by Augustus Radcliffe Grote in 1874. It comprises approximately 15 described species distributed primarily across western North America and Mexico, with one species extending into eastern North America. The genus belongs to the subfamily Stiriinae and is characterized by features typical of this group. Species occupy diverse habitats ranging from desert regions to montane environments.
Stizoides foxi
Fox's stizoide
Stizoides foxi is a kleptoparasitic sand wasp in the family Crabronidae, one of only two Stizoides species occurring in North America. This species is restricted to Arizona and southward into Mexico, where it parasitizes the food caches of other solitary wasps. Like its congener S. renicinctus, females locate and excavate the burrows of host wasps, destroy the host egg, and replace it with their own egg to exploit the provisioned prey. The species was described by Gillaspy in 1963 and remains poorly known compared to its more widespread relative.
Strategus cessus
rhinoceros beetle
Strategus cessus is a species of rhinoceros beetle in the family Scarabaeidae, subfamily Dynastinae. It belongs to a genus of large, horned scarabs found in the Americas. The species has been documented from the southwestern United States and Mexico.
Stratiomydas
Stratiomydas is a genus of mydas flies (family Mydidae) established in 1989. The genus contains four described species distributed in Mexico, with records from Colima and Nayarit states. Species in this genus were previously classified under other genera before being separated based on morphological characteristics. Like other mydid flies, members are likely large-bodied and robust, though specific ecological data remain limited.
Strigoderma teapensis
Strigoderma teapensis is a small scarab beetle in the family Scarabaeidae, subfamily Rutelinae. The species was described by Bates in 1888 from Teapa, Tabasco, Mexico. It occurs in eastern Mexico and has been recorded in southern Texas, USA. Like other members of the genus Strigoderma, it is likely associated with sandy or open habitats, though specific ecological details remain poorly documented.
Strymon alea
Lacey's Scrub-Hairstreak, Alea Hairstreak
Strymon alea is a small hairstreak butterfly in the family Lycaenidae, first described by Godman and Salvin in 1887. It ranges from northwestern Costa Rica through Mexico to central and southern Texas, occupying subtropical thorn scrub habitat. The species has a wingspan of 19–29 mm. Adults feed on flower nectar, while larvae feed specifically on Bernardia myricaefolia buds and flowers.
Sumitrosis pallescens
Sumitrosis pallescens is a small leaf beetle in the family Chrysomelidae, measuring 3.1-3.5 mm as adults. The species is characterized by pale yellow coloration on the pronotum and elytra, with dark spots near the wing tips. It is known to feed on Chamaecrista species and has a broad distribution across the southeastern United States, Mexico, and Central America.
Susuacanga falli
Susuacanga falli is a species of longhorn beetle (family Cerambycidae) described by Linsley in 1940. The species belongs to the tribe Eburiini within the subfamily Cerambycinae. It has been recorded in Mexico and the United States, though specific ecological details remain poorly documented. The genus Susuacanga comprises several species of medium-sized cerambycid beetles primarily distributed in the Americas.
Susuacanga stigmatica
Speckle-necked Longhorn Beetle
Susuacanga stigmatica is a longhorn beetle species in the family Cerambycidae, first described by Chevrolat in 1835. The species belongs to the tribe Eburiini and is known from records in Guatemala, Mexico, and the United States. It is commonly referred to as the Speckle-necked Longhorn Beetle. The genus Susuacanga includes multiple species distributed in the Americas.
Swammerdamella
Swammerdamella is a genus of minute black scavenger flies in the family Scatopsidae (Diptera). The genus was established by Enderlein in 1912 and is distributed across the western Palaearctic, with records from Scandinavia (Denmark, Norway, Sweden) and recent first records from Mexico. The genus includes at least one newly described species, S. grogani, from southeastern Mexico.
Synanthedon arizonensis
Arizona Clearwing Moth
Synanthedon arizonensis is a clearwing moth in the family Sesiidae, known for its wasp-like appearance and diurnal activity. Like other members of its genus, it likely bores into woody plants as larvae. The species is native to the southwestern United States and adjacent Mexico. It belongs to a group of moths that are generally not attracted to light traps, making them difficult to survey using standard moth-collecting methods.
Syrbula montezuma
Montezuma's Grasshopper, slant-faced grasshopper
Syrbula montezuma is a species of slant-faced grasshopper in the family Acrididae, subfamily Gomphocerinae. It is distributed across Central America and North America, including the southwestern United States and Mexico. The species is characterized by its slanted facial profile typical of the subfamily. It has been recorded in regions including Arizona and multiple ecological zones in Mexico.
Syssphinx hubbardi
Hubbard's Silk Moth, Hubbard's Silkmoth
Syssphinx hubbardi is a medium-sized giant silk moth in the family Saturniidae, with a wingspan of 56–76 mm. Adults are predominantly gray with bright pink hindwings that are exposed when the moth is startled. The species occurs in the southwestern United States and Mexico, with one generation per year in most of its range, though Texas populations may produce multiple generations. Adults are active from June through September, with peak activity in July and August.
Syssphinx montana
Montana Silkmoth
Syssphinx montana is a silkmoth in the family Saturniidae. Adults have a wingspan of 62–82 mm, with males smaller than females. The species is found in Mexico and rarely in southeastern Arizona. Adults are active from mid-July to early August and do not feed. Larvae feed on several leguminous host plants.
Systasea pulverulenta
Texas Powdered Skipper
Systasea pulverulenta, commonly known as the Texas Powdered Skipper, is a small butterfly in the family Hesperiidae. It ranges from southern and western Texas through Mexico to Guatemala. Adults are active year-round in southern Texas, with flight recorded from February through December. The species is associated with Malvaceae host plants for larval development.
Systropus bicornis
Systropus bicornis is a species of bee fly in the family Bombyliidae, described by Painter & Painter in 1963. The species is known from Mexico. As a member of the genus Systropus, it belongs to a group of bee flies characterized by distinctive morphological features. Beyond its taxonomic placement and geographic occurrence, detailed biological information remains limited.
Tachardiella
lac scales
Tachardiella is a genus of lac scales (Hemiptera: Kerriidae) known from the southwestern United States and Mexico. Species in this genus are associated with specific host plants and serve as hosts for parasitoid wasps in the genus Tachardiobius (Hymenoptera: Encyrtidae). The genus is poorly studied, with limited biological and ecological documentation available.
Tagosodes wallacei
Tagosodes wallacei is a species of planthopper in the family Delphacidae, described by Muir and Giffard in 1924. It belongs to the large group of true bugs known as planthoppers, which are characterized by their jumping hind legs and association with grasses and other monocot plants. The genus Tagosodes is part of the diverse planthopper fauna of the Americas, with this species recorded from regions including Florida, Mexico, and Brazil.
Tanaocerus
desert long-horned grasshoppers
Tanaocerus is a genus of desert-dwelling grasshoppers in the family Tanaoceridae, containing at least two described species: T. koebelei and T. rugosus. These insects are restricted to arid regions of the southwestern United States and northwestern Mexico. The genus is notable for its elongated antennae, a distinctive trait that separates it from most other grasshopper groups.
Tarache geminocula
Tarache geminocula is a moth of the family Noctuidae, subfamily Acontiinae. It was first described by Clifford D. Ferris and J. Donald Lafontaine in 2009. The species occurs in the southwestern United States and northern Mexico, with adults active during the late summer months. Males have forewings measuring 10–11 mm, while females are slightly larger at 10–12 mm.
Telphusa melanoleuca
Telphusa melanoleuca is a small gelechiid moth described by Walsingham in 1911. It is known only from Guerrero, Mexico. The species is characterized by striking wing patterning with contrasting dark and white markings.
Teminius affinis
prowling spider
Teminius affinis is a species of prowling spider in the family Miturgidae, first described by Banks in 1897. It occurs in the southern United States and Mexico. As a member of the prowling spider family, it is likely an active hunter rather than a web-builder, though specific behavioral observations for this species are limited in the available literature.
Teretriosoma paradoxum
Teretriosoma paradoxum is a small clown beetle in the family Histeridae, described by Lewis in 1888. It belongs to the tribe Teretriini, a group of minute histerids often associated with decaying organic matter and fungi. The species is documented from Central America, with records from Mexico. Like other members of its genus, it likely inhabits microhabitats in forested environments, though specific ecological details remain poorly documented.
Tetragonoderus pallidus
Tetragonoderus pallidus is a species of ground beetle in the family Carabidae, first described by George Henry Horn in 1868. The species is endemic to the Sonoran Desert region, occurring in the southwestern United States and northwestern Mexico. Records indicate presence in Arizona, California, and Mexico. As a member of the genus Tetragonoderus, it belongs to a group of small carabid beetles, though specific morphological and ecological details for this species remain limited in the available literature.
Tetraleurodes
whitefly
Tetraleurodes is a genus of whiteflies (Hemiptera: Aleyrodidae) containing multiple species associated with woody plants in the Americas. Species such as T. perseae and T. ursorum are recognized as agricultural pests of avocado and citrus respectively. The genus is characterized by distinctive wing patterns in adults and waxy secretions produced by nymphs. Multiple Eretmocerus species (Hymenoptera: Aphelinidae) have been documented as parasitoids of Tetraleurodes in Mexico.
Tetraopes discoideus
Tetraopes discoideus is a small milkweed longhorn beetle in the family Cerambycidae, described by John Lawrence LeConte in 1847. Adults measure 7–9 mm in length, making this species notably smaller than congeners. The species is associated with milkweed plants (Asclepias spp.) throughout its range in the southwestern United States and Mexico. Adults have been observed resting, feeding, and mating on milkweed stems and flowers. Larvae develop by feeding on milkweed roots, either tunneling directly into large taproots or living in surrounding soil when roots are small.
Thalpius hoegei
Thalpius hoegei is a ground beetle species (Coleoptera: Carabidae) originally described by Bates in 1883. It is currently treated as a synonym of Pseudaptinus hoegei, reflecting taxonomic reclassification within the tribe Zuphiini. The species belongs to a group of carabid beetles characterized by specialized predatory habits and association with ant colonies. Records indicate presence in Mexico and the southwestern United States.
Thalpius simplex
Thalpius simplex is a ground beetle species in the family Carabidae, originally described by Liebke in 1934. It is currently treated as a synonym of Pseudaptinus simplex. The species is known from Mexico. As a member of the subfamily Dryptinae and tribe Zuphiini, it belongs to a group of carabid beetles often associated with predatory habits, though specific biological details for this species remain poorly documented.
Thanatophilus truncatus
Northern Carrion Beetle, Silky Carrion Beetle
Thanatophilus truncatus is a carrion beetle in the family Silphidae, found across Central and North America. As a member of the genus Thanatophilus, it is associated with decomposing animal matter and plays a role in nutrient cycling. The species was first described by Thomas Say in 1823 and is documented from the southwestern United States through Mexico.
Thasus
giant mesquite bug
Thasus is a genus of large, robust leaf-footed bugs in the family Coreidae, distributed from the southwestern United States through Mexico to South America. The genus includes species commonly known as giant mesquite bugs, which are strongly associated with mesquite trees (Prosopis spp.) where they feed on plant sap and complete their entire life cycle. Several species are notable for their substantial size, with males reaching over 35 mm in length and exhibiting sexually dimorphic hind leg morphology—males possess thickened, armed hind femora while females have more slender, banded legs. Some species are consumed as food in Mexico and represent examples of traditional entomophagy, though recent studies indicate potential health risks from bacterial contamination.
Thasus neocalifornicus
giant mesquite bug
Thasus neocalifornicus is a large, distinctive true bug in the family Coreidae, commonly known as the giant mesquite bug. The species exhibits pronounced sexual dimorphism, with males possessing heavily armed, thickened hind legs compared to the more slender, red-and-black banded hind legs of females. It is associated with mesquite trees (Prosopis spp.) in the southwestern United States and northwestern Mexico, where adults feed on sap and developing seeds. The species has been documented as a host for the egg parasitoid wasp Neorileya ashmeadi (family Eurytomidae).
Theridion dilutum
Theridion dilutum is a species of cobweb spider in the family Theridiidae, described by Herbert W. Levi in 1957. It belongs to one of the largest genera of spiders, with members characterized by their irregular, three-dimensional webs. The species occurs in North America, specifically in the United States and Mexico. Like other theridiids, it possesses comb-like serrated bristles on the hind tarsi used to manipulate silk.
Theridion goodnightorum
Theridion goodnightorum is a species of cobweb spider in the family Theridiidae, described by arachnologist Herbert W. Levi in 1957. The species epithet honors the husband-and-wife arachnologists Clarence and Marie Goodnight. Like other members of the genus Theridion, this species constructs irregular, three-dimensional cobwebs and possesses the characteristic comb-like bristles (setae) on the hind tarsi used to manipulate silk. The species is documented from the southwestern United States and Mexico.
Theridion morulum
Theridion morulum is a species of cobweb spider in the family Theridiidae, first described by O. Pickard-Cambridge in 1898. It belongs to a large genus of small spiders known for their irregular, three-dimensional webs. The species is recorded from the southwestern United States and Mexico, but detailed biological information appears limited in available sources.
Theridion transgressum
Theridion transgressum is a species of cobweb spider in the family Theridiidae, first described by Petrunkevitch in 1911. It belongs to the large genus Theridion, which contains numerous small-bodied spiders that construct irregular, three-dimensional webs. The species is recorded from the United States and Mexico. Very little specific biological information is available for this species.
Thryallis
Thryallis is a genus of longhorn beetles (Cerambycidae: Lamiinae: Anisocerini) established by Thomson in 1858. The genus is known to include species that function as wood-boring agricultural pests. Thryallis undatus has been documented damaging Persian lime orchards in Veracruz, Mexico, where larvae tunnel into trunks and branches causing tree mortality. The genus name has been subject to nomenclatural confusion with a plant genus of the same name in Malpighiaceae.
Thryallis undatus
Thryallis undatus is a longhorn beetle (Cerambycidae: Lamiinae: Anisocerini) first described by Chevrolat in 1834. The species has been documented as a pest of Persian lime (Citrus latifolia) in commercial orchards in Veracruz, Mexico, where adults oviposit on trunks and branches and larvae create galleries 2–5 cm deep. This represents the first record of the species associated with the Rutaceae family. Native distribution includes Middle America and North America, with records from Guatemala and Honduras.
Thyreodon apricus
Thyreodon apricus is a species of ichneumon wasp in the subfamily Ophioninae, described by Porter in 1984. The genus Thyreodon belongs to the tribe Enicospilini, a group of primarily tropical wasps. Members of Ophioninae are known for their ability to sting using their short, sharp ovipositors for defense. This species occurs in the southwestern United States and Mexico. Very little is known about its specific biology, and it has been subject to taxonomic confusion with similar large, colorful ichneumon wasps.
Thyreodon rivinae
Thyreodon rivinae is a species of ichneumon wasp described by Porter in 1980. The genus Thyreodon belongs to the family Ichneumonidae, one of the largest families of parasitoid wasps. Members of this genus are known from the southwestern United States and adjacent Mexico. The species is poorly documented in scientific literature, with limited published information on its biology and ecology.
Timulla oajaca
Timulla oajaca is a species of velvet ant in the family Mutillidae, a group of wingless wasps known for their potent sting and aposematic coloration. The genus Timulla is frequently cited as a model for Müllerian mimicry complexes in North America, with spiders in the genus Sergiolus (Gnaphosidae) among their documented visual mimics. Like all mutillids, females are wingless while males possess wings. The species name refers to Oaxaca, Mexico, suggesting a geographic association with this region.
Tinacrucis noroesta
Tinacrucis noroesta is a species of tortricid moth described by Powell in 2009. It is known from a limited number of localities in the southwestern United States and northern Mexico. The species has a wingspan of 29–37 mm. It belongs to the tribe Atteriini within the subfamily Tortricinae.
Tipula schizomera
Tipula schizomera is a large crane fly in the family Tipulidae, described by Charles Paul Alexander in 1940. It is distributed across the southwestern United States and Mexico, representing one of the Nearctic species in this diverse genus. As with other Tipula species, it belongs to a group commonly known as crane flies or daddy longlegs, characterized by elongated bodies and extremely long legs.
Titanebo
Titanebo is a genus of running crab spiders in the family Philodromidae, first described by Gertsch in 1933. The genus comprises 14 species distributed in the southwestern United States and Mexico. These spiders were historically classified under the genus Ebo but were reassigned to Titanebo based on taxonomic revision. They are characterized by their elongated second pair of legs, a distinctive trait among philodromid spiders.
Tliltocatl
Red Rump Tarantula (for T. vagans)
Tliltocatl is a genus of large burrowing tarantulas in the family Theraphosidae, erected in 2020 when molecular phylogenetic studies demonstrated that the genus Brachypelma comprised two distinct clades. Species are found predominantly in Mexico and Central America. The genus name derives from Nahuatl words meaning 'black spider.' Unlike Brachypelma species, Tliltocatl lacks striking red leg markings, instead displaying more subdued coloration with long red or yellowish abdominal hairs. Several species are threatened by habitat destruction and collection for the pet trade, leading to CITES protection.
Tomonotus
oak-leaf grasshoppers
Tomonotus is a genus of band-winged grasshoppers in the family Acrididae, established by Saussure in 1861. The genus contains at least two described species: Tomonotus ferruginosus (oak-leaf grasshopper) and Tomonotus mexicanus (Mexican oak-leaf grasshopper). Members are found in the southwestern United States and Mexico.
Tomonotus mexicanus
Mexican Oak-leaf Grasshopper
Tomonotus mexicanus is a grasshopper species in the family Acrididae, described by Saussure in 1861. It belongs to the tribe Arphiini within the subfamily Oedipodinae, commonly known as banded-winged grasshoppers. The species is endemic to Mexico, with records from central and northeastern regions. It is known in English as the Mexican Oak-leaf Grasshopper, though the origin of this common name is not documented in available sources.
Tortistilus albidosparsus
Tortistilus albidosparsus is a treehopper species in the family Membracidae, first described by Stål in 1859. It belongs to the tribe Ceresini within the subfamily Smiliinae, a group known for diverse pronotal modifications. The genus Tortistilus is part of the Nearctic treehopper fauna, with records from western North America. Species in this genus are characterized by distinctive pronotal structures typical of the Ceresini.
Toumeyella mirabilis
Toumeyella mirabilis is a soft scale insect in the family Coccidae, described by Cockerell in 1895. As a member of the genus Toumeyella, it shares characteristics with other soft scales that feed on plant vascular fluids and produce honeydew. The species occurs in North and Middle America, with records from the United States and Mexico. Like related species in the genus, it likely exhibits typical soft scale biology with sedentary adult females and mobile crawler nymphs.
Townsendiella pulchra
Townsendiella pulchra is a cuckoo bee (family Apidae, subfamily Nomadinae) known from the United States and Mexico. It is a kleptoparasite, meaning females lay eggs in the nests of host bees rather than constructing their own. The species specifically targets Hesperapis larreae as its host. As a member of the tribe Townsendiellini, it belongs to a small group of specialized nomadine bees with limited documented natural history.
Townsendiella rufiventris
Townsendiella rufiventris is a cuckoo bee species in the family Apidae, first described by Linsley in 1942. It belongs to the tribe Townsendiellini within the subfamily Nomadinae. The species has been recorded in the United States and Mexico. As a member of Nomadinae, it is presumed to be a cleptoparasite (cuckoo bee) that lays eggs in the nests of other bees, though specific host relationships remain undocumented.
Trachelas pacificus
Bull-headed sac spider
Trachelas pacificus is a species of true spider in the family Trachelidae, distributed across the southwestern United States and northwestern Mexico. It is commonly found in houses and adults are present year-round. The species is part of a genus known for sac-like retreats and active hunting behavior rather than web-building.
Tragidion armatum
Tragidion armatum is a longhorn beetle (Cerambycidae) found in the southwestern United States and Mexico. Adults exhibit bright orange and black coloration that mimics tarantula hawk wasps (Pompilidae: Pepsis, Hemipepsis). The species breeds in dead flower stalks of Yucca and Agave plants. It was described by LeConte in 1858, with T. armatum brevipenne later synonymized under it.
Traxus fulvus
Traxus fulvus is a species of planthopper in the family Issidae, first described by Metcalf in 1923. It belongs to the tribe Thioniini within the subfamily Issinae. The species is recorded from the southern United States and northeastern Mexico, with confirmed observations from Texas, Hidalgo, and Tamaulipas. Like other issid planthoppers, it is presumed to feed on plant phloem, though specific host plants remain unrecorded.
Trepobates becki
Trepobates becki is a species of water strider in the family Gerridae. It inhabits freshwater surface habitats in arid and semi-arid regions of the southwestern United States and Mexico. The species was described by Drake & Harris in 1932. Like other members of the genus Trepobates, it is adapted to life on the water surface.
Triatoma gerstaeckeri
kissing bug, blood-sucking conenose
Triatoma gerstaeckeri is a triatomine bug (subfamily Triatominae) and a documented vector of Trypanosoma cruzi, the protozoan parasite causing Chagas disease. Adults measure 20–30 mm in length. The species occurs from the southwestern United States (New Mexico, Texas) through northeastern Mexico, occupying dry scrubland habitats with strong associations to woodrat (Neotoma) nests. It exhibits paurometabolous development with five nymphal instars before adulthood. The species is notable for its relatively high T. cruzi infection rates in some populations and its propensity for peridomestic occurrence near human habitation.
Triatoma indictiva
kissing bug
Triatoma indictiva is a blood-sucking assassin bug in the subfamily Triatominae, commonly known as a "kissing bug." It is a documented vector of Trypanosoma cruzi, the protozoan parasite that causes Chagas disease. The species occurs in Mexico and the southern United States, particularly Arizona and Texas. Adults measure 20–30 mm in length and are characterized by a pear-shaped body, black coloration with red lateral markings, and a tapered proboscis. Like other triatomines, it is primarily associated with vertebrate hosts in natural and peridomestic habitats.
Triatoma recurva
kissing bug, blood-sucking conenose
Triatoma recurva is a kissing bug (Triatominae) native to Mexico and the southwestern United States. It is a blood-feeding assassin bug that serves as a vector for Trypanosoma cruzi, the parasite causing Chagas disease. The species has been documented from its natural host, the ringtail (Bassariscus astutus), and is found in domestic and peri-domestic environments. Laboratory studies indicate slower development and higher feeding requirements compared to related species, with egg-to-adult development exceeding 8.5 months.
Tribolium parallelum
Tribolium parallelum is a species of darkling beetle in the family Tenebrionidae, genus Tribolium. The genus includes several economically important stored product pests, though specific information about T. parallelum's biology and pest status is limited in available sources. It is native to Mexico.
Trichadenotecnum desolatum
Trichadenotecnum desolatum is a species of barklouse in the family Psocidae, originally described by Chapman in 1930 as Psocus desolatus. It belongs to the genus Trichadenotecnum, a group of small, winged psocids commonly found on tree bark and foliage. The species is known from the southern United States and Mexico. Like other members of its family, it likely inhabits woody vegetation and feeds on microflora.
Trichiotes seriatus
Trichiotes seriatus is a species of darkling beetle (family Tenebrionidae) described by Casey in 1907. It is a member of the diverse beetle family Tenebrionidae, commonly known as darkling beetles, which are primarily detritivores and are abundant in arid and semi-arid environments. The genus Trichiotes is part of this widespread family, though specific ecological details for T. seriatus remain poorly documented.
Trichobaris
flower weevils
Trichobaris is a genus of flower weevils in the family Curculionidae, comprising 8–13 described species distributed from the southwestern United States through Mexico. These weevils are specialized herbivores associated with plants in the family Solanaceae, particularly the genus Datura, with which they likely coevolved. Several species are notable agricultural pests, including T. mucorea (tobacco stalk borer) and T. trinotata (potato stalk borer), which also feed on cultivated solanaceous crops. Research on this genus has contributed to understanding host-herbivore coevolution, chemical ecology of host selection, and the decoupling of maternal oviposition cues from larval performance.
Trichocanonura linearis
Trichocanonura linearis is a species of longhorn beetle in the subfamily Lamiinae, and the sole member of its monotypic genus. It was described by Skinner in 1905 based on specimens from Mexico. The species is characterized by its elongated, linear body form typical of many lamiine cerambycids. It is distributed in Mexico and the southern United States.
Trichocnemis spiculatus neomexicanus
New Mexican ponderous borer
Trichocnemis spiculatus neomexicanus is a subspecies of the ponderous borer, a large prionine longhorn beetle native to western North America. The larvae are among the largest of any North American cerambycid, developing in dead or dying coniferous wood—particularly ponderosa pine. Adults are nocturnal and attracted to lights. This subspecies was described by Casey in 1890 and occurs in the southwestern United States and Mexico. The species has gained notoriety as the inspiration for modern chainsaw design, after Joe Cox observed the larva's opposable mandibles in action.
Triclonella xuthocelis
Triclonella xuthocelis is a small moth species described by Hodges in 1962. It belongs to the family Momphidae (formerly placed in Cosmopterigidae), a group of small gelechioid moths. The species is restricted to montane regions at the border of the southwestern United States and northern Mexico. It is known from relatively few observations, reflecting either genuine rarity or limited survey effort in its high-elevation habitat.
Triepeolus kathrynae
cuckoo bee
Triepeolus kathrynae is a species of cleptoparasitic cuckoo bee in the family Apidae, tribe Epeolini. The species was described by Rozen in 1989. Like other members of the genus Triepeolus, it is a brood parasite that does not construct nests or gather pollen. It has been recorded from the United States and Mexico.
Triepeolus loomisorum
Triepeolus loomisorum is a cleptoparasitic bee species in the family Apidae, first described by Rozen in 1989. As a member of the genus Triepeolus, it is a cuckoo bee that does not construct nests or gather pollen, instead laying eggs in the nests of host bees. The species is known from the United States and Mexico.
Triepeolus martini
Triepeolus martini is a cleptoparasitic bee species in the family Apidae, first described by Cockerell in 1900. As a member of the genus Triepeolus, it functions as a cuckoo bee, laying eggs in the nests of host bees. The species has been documented in the United States and Mexico.
Triepeolus verbesinae
cuckoo bee
Triepeolus verbesinae is a cleptoparasitic bee species in the family Apidae. As a cuckoo bee, females lay eggs in the nests of host bees rather than constructing their own nests or provisioning brood cells. The species is distributed across the United States and Mexico. Like other members of the genus Triepeolus, it is associated with pollen-collecting host bees, though the specific host species for T. verbesinae has not been definitively documented.
Trigonidomimus belfragei
Belfrage's Cricket
Trigonidomimus belfragei, commonly known as Belfrage's Cricket, is a species of cricket in the family Gryllidae, first described by Caudell in 1912. The species is classified within the subfamily Pentacentrinae, a group sometimes referred to as anomalous crickets. It occurs in parts of North America including Texas, Oklahoma, and Mexico. The genus Trigonidomimus is small and poorly documented, with limited biological information available for this species.
Trimerotropis californica
strenuous grasshopper, California band-winged grasshopper
Trimerotropis californica, commonly known as the strenuous grasshopper or California band-winged grasshopper, is a species of band-winged grasshopper in the family Acrididae. It was first described by Bruner in 1889. The species belongs to the subfamily Oedipodinae, characterized by banded wings. Distribution records indicate presence in the southwestern United States and Mexico.
Trimerotropis latifasciata
broad-banded grasshopper
Trimerotropis latifasciata, the broad-banded grasshopper, is a band-winged grasshopper in the family Acrididae. It occurs in the southwestern United States and Mexico, with documented records from Arizona, Texas, Utah, and northeastern Mexico. The species is notable for its cryptic coloration that blends with lichen-encrusted clay substrates, making it exceptionally difficult to detect.
Trimerotropis modesta
Modest Grasshopper
Trimerotropis modesta is a band-winged grasshopper in the family Acrididae, described by Bruner in 1889. It belongs to the subfamily Oedipodinae, a group characterized by enlarged hind wings used in display and flight. The species occurs in arid and semi-arid regions of southwestern North America and Mexico. Available records indicate it is among the less frequently documented Trimerotropis species, with limited published biological information.
Triopasites penniger
Triopasites penniger is a cuckoo bee species in the family Apidae, subfamily Nomadinae. Like other members of the genus, it is a cleptoparasite that lays eggs in the nests of host bees. The species occurs in the southwestern United States and Mexico. It belongs to the tribe Brachynomadini, a group of small, often inconspicuous cuckoo bees.
Triorophus laevis
Triorophus laevis is a species of darkling beetle in the family Tenebrionidae. The genus Triorophus belongs to this large family of beetles, which are characterized by hardened forewings and typically inhabit arid or semi-arid environments. Available information on this species is extremely limited, with only three observation records documented on iNaturalist and distribution records limited to Mexico.
Triphalopsis californica
Triphalopsis californica is a darkling beetle species in the family Tenebrionidae, described by Doyen in 1983. The genus Triphalopsis is part of a diverse family of beetles commonly associated with arid and semi-arid environments. This species is known from Mexico based on distribution records.
Trirhabda
skeletonizing leaf beetles, goldenrod beetles
Trirhabda is a genus of skeletonizing leaf beetles in the family Chrysomelidae, comprising over 30 described species distributed in North America and Mexico. These beetles are specialist herbivores primarily associated with plants in the Asteraceae family, particularly goldenrods (Solidago), asters, and related composites. The genus has been extensively studied in ecological research due to its host-specific feeding habits, density-dependent dispersal behaviors, and potential keystone species effects on plant community dynamics. Several species are notable for sequestering defensive compounds and exhibiting complex movement behaviors in response to landscape structure and host plant quality.
Trogoderma ornatum
ornate carpet beetle, ornate cabinet beetle
Trogoderma ornatum, commonly known as the ornate carpet beetle or ornate cabinet beetle, is a species of dermestid beetle in the family Dermestidae. It is a member of the genus Trogoderma, which contains several economically significant stored product pests. The species has been recorded in North America and Oceania, with a notable first record from Mexico in 1998 where it was detected in association with honey bees (Apis mellifera). Like other Trogoderma species, it is likely associated with stored products or organic materials, though specific ecological details remain limited.
Tropidosteptes
ash plant bugs
Tropidosteptes is a genus of plant bugs (Miridae) containing at least 30 described species. The genus is best known from T. chapingoensis, the ash plant bug, which has been studied in detail for its life cycle and impact on urban ash trees. Species in this genus are associated with Fraxinus (ash) trees and can cause significant defoliation damage. The genus occurs in North America, with at least one species introduced to South America.
Tropisternus sublaevis
Tropisternus sublaevis is a species of water scavenger beetle in the family Hydrophilidae. The species was described by John Lawrence LeConte in 1855. It is distributed across western and central North America, with records from the United States and Mexico. The species belongs to the subgenus Tropisternus (Tropisternus) and has been subject to some taxonomic confusion, with a later homonym described by Blatchley in 1910.
Trupanea bisetosa
fruit fly
Trupanea bisetosa is a tephritid fruit fly whose larvae develop within sunflower heads. The species was originally described as Urellia bisetosa by Coquillett in 1899. It has been documented in southern California and Mexico, with confirmed host associations to wild sunflower (Helianthus spp.).
Turpilia
narrow-beaked katydid (for T. rostrata)
Turpilia is a genus of phaneropterine katydids in the family Tettigoniidae, established by Stål in 1874. The genus comprises nine described species distributed in the Caribbean, Florida, and parts of Mexico. Species in this genus are characterized by their placement in the tribe Turpiliini, a group within the subfamily Phaneropterinae. The genus includes the narrow-beaked katydid (T. rostrata), one of the few species with a documented common name.
Turpiliodes
Turpiliodes is a genus of katydids in the family Tettigoniidae, established by Hebard in 1932. It belongs to the tribe Turpiliini within the subfamily Phaneropterinae. The genus is endemic to Mexico, with records from the northeast, Gulf, and southwest regions. As of 2024, iNaturalist documents over 500 observations of this genus.
Tylosis jimenezii
Tylosis jimenezii is a species of longhorn beetle in the family Cerambycidae, first described by Dugès in 1879. It belongs to the tribe Trachyderini, a group of often large and strikingly colored cerambycids. The species is currently considered a synonym of Tylosis jimenezi, with records from both the United States and Mexico. Limited field observations suggest it may be associated with Malvaceae host plants in arid regions of the southwestern United States.
Tylosis maculatus
Spotted Tylosis
Tylosis maculatus is a species of longhorn beetle in the family Cerambycidae, described by John Lawrence LeConte in 1850. It belongs to the tribe Trachyderini, a group known for often striking coloration patterns. The species is recognized by its spotted pattern, as indicated by its specific epithet 'maculatus'. It occurs in North and Middle America, with records from the United States and Mexico.
Tylosis puncticollis
Tylosis puncticollis is a species of longhorned beetle (family Cerambycidae) described by Henry Walter Bates in 1885. It belongs to the tribe Trachyderini, a group of robust, often colorful cerambycids commonly known as trachyderines. The genus Tylosis is restricted to the Americas, with species distributed from the southwestern United States through Mexico. Like other members of its genus, T. puncticollis likely exhibits the characteristic elongated body form and long antennae typical of cerambycids, though specific morphological details distinguishing it from congeners require close examination.
Tyrtaeus rufus
Tyrtaeus rufus is a species of darkling beetle (Coleoptera: Tenebrionidae) described by Champion in 1913. The genus Tyrtaeus is a small group within the large family Tenebrionidae, which comprises primarily detritivorous and xerophilic beetles. This species has documented occurrence records in Colombia and Mexico, suggesting a Neotropical distribution pattern.
Ulus fimbriatus
Ulus fimbriatus is a species of darkling beetle in the family Tenebrionidae, described by Thomas L. Casey in 1890. The genus Ulus is a small group within this diverse beetle family. Published records indicate this species occurs in Mexico. Information on its biology and ecology remains limited in accessible literature.
Valenzuela perplexus
lizard barklouse
Valenzuela perplexus is a species of lizard barklouse in the family Caeciliusidae, a group of small, winged insects commonly associated with bark and foliage habitats. The species was described by Chapman in 1930 and is distributed across Central America and North America, with records from Mexico. Like other members of the genus Valenzuela, it is likely associated with dead leaf and bark microhabitats. The specific epithet "perplexus" suggests taxonomic complexity in its original description.
Valenzuela totonacus
Valenzuela totonacus is a species of barklouse in the family Caeciliusidae, described by Mockford in 1966. The species belongs to the order Psocodea, a group of small, often overlooked insects commonly known as barklice or booklice. It has been recorded from the southern United States through Mexico to Guatemala.
Vostox excavatus
Vostox excavatus is a species of earwig in the family Spongiphoridae, described from western Mexico in 1961. It belongs to a genus of small, delicate earwigs often found in arid and semi-arid environments. The species name 'excavatus' refers to a concave or hollowed feature, likely describing a diagnostic morphological character. Records indicate it occurs in Baja California Sur and Sinaloa.
Wormaldia arizonensis
Wormaldia arizonensis is a species of caddisfly in the family Philopotamidae, originally described by Ling in 1938. It belongs to the second largest genus in its family, with approximately 175 extant species worldwide. The species is known from the southwestern United States and Mexico. As with other philopotamid caddisflies, it is presumed to have aquatic larval stages and terrestrial adult stages, though specific details of its biology remain poorly documented.
Xanthocaecilius
lizard barklice
Xanthocaecilius is a genus of lizard barklice established by Mockford in 1989. The genus contains at least two described species: Xanthocaecilius quillayute (Chapman, 1930) and Xanthocaecilius sommermanae (Mockford, 1955). These insects belong to the order Psocodea, a group that includes barklice, booklice, and parasitic lice. The genus has been recorded from Mexico and is part of the family Paracaeciliidae (sometimes referenced as Caeciliusidae in older literature).
Xanthocampsomeris hesterae
Xanthocampsomeris hesterae is a scoliid wasp described by Rohwer in 1927. It is distributed from southern Mexico through Central America to northern South America, with records from Ecuador, Colombia, Costa Rica, Panama, Trinidad and Tobago, and Venezuela. The species belongs to a genus characterized by yellow coloration, distinguishing it from related scoliid genera. Like other scoliids, it is likely a parasitoid of scarab beetle larvae, though specific host records for this species are not documented.
Xenorhipis hidalgoensis
Xenorhipis hidalgoensis is a small metallic wood-boring beetle in the family Buprestidae, notable for extreme sexual dimorphism in antennal structure. Males possess highly modified flabellate (comb-like) antennae with expanded distal segments covered in olfactory sensillae, while females retain typical serrate antennae. The species was first described from Hidalgo County, Texas, and is among the least frequently encountered buprestids in North America.
Xeropsamobeus desertus
Xeropsamobeus desertus is a species of aphodiine dung beetle in the family Scarabaeidae. It is found in desert regions of southwestern North America and northwestern Mexico. The species was described by Van Dyke in 1918.
Xestocephalus tessellatus
Xestocephalus tessellatus is a species of leafhopper in the family Cicadellidae, described by Van Duzee in 1894. It belongs to the subfamily Aphrodinae and tribe Xestocephalini. The species has been documented in the southeastern United States and Mexico based on distribution records.
Xubida dentilineatella
Xubida dentilineatella is a small crambid moth described by Barnes and McDunnough in 1913. It occurs in Mexico and the southern United States, with confirmed records from Arizona. Adults are active during summer months, and larvae are specialized borers in Saccharum species.
Xyleborus volvulus
Xyleborus volvulus is a bark beetle in the family Curculionidae. It is native to tropical and subtropical regions and has been documented in North America, the Caribbean, Middle America, and Africa. The species is an ambrosia beetle that cultivates symbiotic fungi in tunnels bored into wood. It has been observed to carry Raffaelea lauricola, the pathogen causing laurel wilt disease, which has altered its status from a wood degrader to a potential pest of avocado and other lauraceous trees.
Xyloryctes thestalus
Western Rhinoceros Beetle
Xyloryctes thestalus is a species of rhinoceros beetle in the family Scarabaeidae, commonly known as the Western Rhinoceros Beetle. Males possess prominent horns on the head and pronotum, a characteristic feature of the Dynastinae subfamily. The species is nocturnal and strongly attracted to lights, often appearing in large numbers at ultraviolet and mercury vapor light setups. It occurs across the southwestern United States and Mexico, with two recognized subspecies: X. t. thestalus and X. t. borealis.
Xylotrechus albonotatus
Xylotrechus albonotatus is a species of longhorn beetle in the family Cerambycidae, described by Thomas Lincoln Casey Jr. in 1912. It belongs to the genus Xylotrechus, a diverse group of wood-boring beetles commonly known as tiger beetles or wasp beetles due to their frequent yellow and black coloration. The specific epithet "albonotatus" refers to white markings, suggesting distinctive pale patterning on the elytra or pronotum. Like other members of the tribe Clytini, adults are likely diurnal and active on host tree trunks.
Xyphon fulgidum
Xyphon fulgidum is a leafhopper species in the family Cicadellidae, first described from California in 1932. It belongs to the genus Xyphon, a group of relatively large, often brightly colored leafhoppers within the tribe Cicadellini. The species name "fulgidum" suggests a shiny or gleaming appearance. Records indicate presence in arid and semi-arid regions of western North America and Mexico.
Xysticus paiutus
Xysticus paiutus is a species of crab spider in the family Thomisidae, first described by Gertsch in 1933. Like other members of its genus, it is a ground-dwelling ambush predator. The species occurs in the southwestern United States and Mexico. Information on its biology and ecology remains limited.
Zadiprion rohweri
Pinyon Pine Sawfly
Zadiprion rohweri, commonly known as the Pinyon Pine Sawfly, is a species of conifer-feeding sawfly in the family Diprionidae. It is associated with pinyon pine (Pinus edulis and related species) in the southwestern United States and Mexico. The species was described by Middleton in 1931 and is one of several Zadiprion species specialized on pine hosts. Sawflies in this genus are known for gregarious larval feeding that can cause noticeable defoliation.
Zelotes pseustes
Zelotes pseustes is a species of ground spider in the family Gnaphosidae, first described by Chamberlin in 1922. It belongs to a large genus of active hunters that do not build webs to capture prey. The species is distributed across the United States and Mexico. Like other Zelotes species, it is a nocturnal predator that pursues prey on the ground or on low vegetation.
Zenodoxus mexicanus
Zenodoxus mexicanus is a clearwing moth (family Sesiidae) described by Beutenmüller in 1897. The genus Zenodoxus belongs to the subfamily Tinthiinae, a group of sesiid moths characterized by their wasp-mimicking appearance and diurnal activity patterns. This species occurs in the Nearctic and Neotropical regions, with the specific epithet suggesting a Mexican distribution. Clearwing moths in this family are typically associated with woody plants, with larvae often boring into stems or roots.
Zethus guerreroi
Zethus guerreroi is a species of potter wasp in the subfamily Eumeninae, described by Zavattari in 1913. As a member of the genus Zethus, it belongs to a diverse group of solitary wasps characterized by their distinctive nest-building behavior using mud. The species is known from limited observations, with records primarily from Mexico.
Zikanapis elegans
Zikanapis elegans is a species of plasterer bee in the family Colletidae, originally described as Caupolicana elegans by Timberlake in 1965. It belongs to a genus of solitary bees found in the southwestern United States and Mexico. Like other colletid bees, it likely nests in the ground and lines its brood cells with a cellophane-like secretion. The species is poorly known, with limited observational records.
Zyginama queretarensis
Zyginama cf. queretarensis is a leafhopper in the family Cicadellidae, provisionally identified as the species Z. queretarensis. Leafhoppers in this genus are small, active insects associated with vegetation. The 'cf.' designation indicates uncertainty in species-level identification, suggesting morphological similarity to Z. queretarensis without definitive confirmation.
Zyginama tricolor
Zyginama tricolor is a species of leafhopper in the family Cicadellidae, subfamily Typhlocybinae, tribe Erythroneurini. First described by Beamer in 1929, this species belongs to a genus of small, often colorful leafhoppers. The species epithet 'tricolor' suggests a three-colored coloration pattern. Like other typhlocybine leafhoppers, it likely feeds on plant vascular tissue.
Zygogramma signatipennis
Zygogramma signatipennis is a leaf beetle in the family Chrysomelidae found in Mexico. The species has been documented feeding on acahual plants (Tithonia tubaeformis, Asteraceae), causing moderate to severe defoliation damage specifically to this host. Research suggests it shows greater feeding preference for plants in the vegetative stage and has been proposed as a potential biological control agent for management of T. tubaeformis as a weed. The species was originally described by Stål in 1859.