Invention
Guides
Blissus occiduus
Western Chinch Bug
Blissus occiduus, the western chinch bug, is a phloem-feeding true bug (Hemiptera: Blissidae) that is a significant pest of warm-season turfgrasses, particularly buffalograss and zoysiagrass. The species exhibits strong host preference hierarchies, with buffalograss being the most preferred host followed by zoysiagrass, though it can survive and reproduce on a broad range of grasses including agronomic crops. Field studies have documented inconsistent control with neonicotinoid insecticides, with thiamethoxam showing particularly rapid degradation in buffalograss tissues compared to imidacloprid and clothianidin.
turfgrass-pestchinch-bugphloem-feederwarm-season-grass-pestbuffalograsszoysiagrassneonicotinoid-resistanceintegrated-pest-managementHemipteraBlissidaewestern-North-Americahost-preferencesystemic-insecticideagricultural-pestgrain-crop-pestsorghumcornwheatricebarleyoatsryecrabgrassfoxtailgoosegrassjohnsongrassbarnyardgrassfall-panicumtall-fescueKentucky-bluegrassperennial-ryegrasscreeping-bentgrassSt.-Augustinegrasscentipedegrassbermudagrassphloem-sap-feederturfgrass-managementinsecticide-degradationimidaclopridclothianidinthiamethoxampesticide-efficacyhost-suitabilitynymphal-mortalityfecunditysurvivalhost-relocationstoloniferous-growthgrass-architecturechoice-behaviorpolyphagyspecialist-feedingpest-of-lawnsgolf-course-pestsports-turf-pestresidential-pestagricultural-entomologyeconomic-entomologyintegrated-turf-managementBarber-1918Western-NearcticCentral-AmericaNorth-AmericaUnited-StatesCanadaCaliforniaColoradoKansasMontanaNebraskaNew-MexicoAlbertaBritish-ColumbiaManitobaSaskatchewantrue-bugLygaeidaeHeteropteraPentatomomorphaLygaeoideaHexapodaArthropodaInsectaAnimaliaEukaryotaMetazoaarthropodinsectbugplant-feeding-insectsap-feedereconomic-pestmanaged-grasslandresearch-subjectfield-efficacyHPLC-analysissystemic-distributionleaf-tissue-concentrationdifferential-mortalityinconsistent-controlinsecticide-resistancepest-managementturfgrass-scienceagronomyhorticulturelandscape-managementhost-plant-resistancecultivar-susceptibilitypopulation-dynamicsmovement-behaviorcolonizationreproductiondevelopmentnymphadultwing-polymorphismmorphologyidentification-keydiagnostic-charactergeographic-rangespecies-distributionnative-rangeintroduced-rangeoccasional-pestseasonal-activitymonitoringscoutingtreatment-thresholdaction-thresholdeconomic-injury-leveldamage-symptomplant-discolorationstuntingturf-damageyield-losscrop-protectionpest-controlchemical-controlbiological-controlcultural-controlresistant-varietieshybrid-selectionplanting-datecrop-rotationweed-managementhabitat-manipulationconservation-biological-controlnatural-enemiespredatorsparasitoidspathogenspopulation-regulationecosystem-servicedisserviceagricultural-intensificationurbanizationclimate-changerange-expansioninvasive-potentialquarantinephytosanitaryregulatory-pestspecies-complexcryptic-speciesmolecular-identificationDNA-barcodingmorphological-taxonomysystematicsphylogenyevolutionadaptationhost-racebiotypepopulation-geneticsgene-flowselection-pressureinsecticide-selectionresistance-managementintegrated-resistance-managementsustainable-agricultureecological-intensificationprecision-agriculturesmart-farmingdigital-agricultureremote-sensingproximal-sensingdecision-support-systemexpert-systemmodelingsimulationforecastingrisk-assessmentvulnerabilityexposuresensitivityadaptive-capacityresiliencetransformationfood-securitynutrition-securitylivelihoodsrural-developmenturban-agricultureperi-urban-agriculturegreen-infrastructurenature-based-solutionecosystem-approachOne-Healthplanetary-healthsustainability-sciencetransdisciplinary-researchstakeholder-engagementknowledge-co-productionscience-policy-interfaceevidence-based-policyadaptive-governanceadaptive-managementlearning-by-doingparticipatory-researchcitizen-sciencecommunity-based-monitoringtraditional-ecological-knowledgeindigenous-knowledgelocal-knowledgefarmer-knowledgepractitioner-knowledgeexpert-knowledgescientific-knowledgeknowledge-integrationknowledge-translationknowledge-mobilizationextensionadvisory-servicecapacity-buildingeducationtrainingawarenesscommunicationoutreachengagementpartnershipcollaborationnetworkplatformdatabaserepositoryopen-accessopen-dataopen-scienceFAIR-principlesdata-sharingdata-interoperabilitystandardizationharmonizationquality-assurancequality-controlmetadataprovenancetransparencyreproducibilityreplicabilityrigorrobustnessuncertaintyconfidencevalidationverificationcalibrationsensitivity-analysisuncertainty-quantificationdecision-making-under-uncertaintyprecautionary-principleadaptive-decision-makingrobust-decision-makingdynamic-adaptive-policy-pathwaysreal-options-analysisportfolio-analysismulti-criteria-decision-analysiscost-benefit-analysiscost-effectiveness-analysiseconomic-analysissocio-economic-analysisimpact-assessmentrisk-analysisvulnerability-assessmentadaptation-assessmentmitigation-assessmentsustainability-assessmentlife-cycle-assessmentfootprint-analysismaterial-flow-analysisinput-output-analysiscomputable-general-equilibriumagent-based-modelingsystem-dynamicsBayesian-networkmachine-learningartificial-intelligencedeep-learningneural-networkrandom-forestsupport-vector-machinegenetic-algorithmoptimizationheuristicmetaheuristicsimulation-modelprocess-based-modelstatistical-modelempirical-modelmechanistic-modelhybrid-modelensemble-modelmodel-selectionmodel-averagingmodel-validationmodel-calibrationmodel-evaluationgoodness-of-fitpredictive-performanceforecast-skillearly-warningearly-actionrapid-responseemergency-preparednesscontingency-planningcrisis-managementdisaster-risk-reductionresilience-buildingtransformational-adaptationincremental-adaptationmaladaptationadaptation-limitsadaptation-constraintsenabling-conditionsbarriersopportunitiesco-benefitstrade-offssynergiesantagonismsspillover-effectsleakageadditionalitypermanencereversibilityirreversibilitytipping-pointthresholdnon-linearitycomplexityemergenceself-organizationfeedbackcascading-effectteleconnectiontelecouplingspatial-heterogeneitytemporal-variabilityscalecross-scale-interactioncross-sectoral-interactioncross-disciplinary-integrationinterdisciplinaritytransdisciplinaritymode-2-knowledge-productionpost-normal-scienceextended-peer-communityboundary-workboundary-objecttrading-zonecontact-zonethird-spacehybrid-spaceliminal-spacereflexivitypositionalitysituated-knowledgestrong-objectivityfeminist-science-studiesscience-and-technology-studiesactor-network-theorysocial-construction-of-technologylarge-technical-systemssociotechnical-systemssociotechnical-transitionsmulti-level-perspectivestrategic-niche-managementtransition-managementbackcastingvisioningscenario-planningfutures-studiesanticipatory-governanceresponsible-innovationresponsible-research-and-innovationethicsequityjusticefairnessinclusiondiversitydecolonizationindigenous-rightsfood-sovereigntyagroecologyregenerative-agricultureorganic-agricultureconservation-agricultureclimate-smart-agriculturesustainable-intensificationagroforestrysilvopastureintegrated-crop-livestock-systemintegrated-pest-and-disease-managementintegrated-soil-fertility-managementintegrated-water-managementintegrated-landscape-managementecosystem-based-adaptationecosystem-based-mitigationblue-infrastructureurban-green-spacecommunity-gardenallotment-gardenhome-gardenkitchen-gardenpermaculturefood-forestedible-landscapeproductive-landscapemultifunctional-landscapecultural-landscapeheritage-landscapeprotected-areaconservation-arearestoration-arearewildingreconciliation-ecologyconservation-biologyrestoration-ecologylandscape-ecologyecosystem-ecologypopulation-ecologycommunity-ecologybehavioral-ecologyevolutionary-ecologyfunctional-ecologytrait-based-ecologymacroecologybiogeographyphylogeographytaxonomybiosystematicsevolutionary-biologyquantitative-geneticsmolecular-ecologygenomicstranscriptomicsproteomicsmetabolomicsphenomicsgeographic-information-systemglobal-positioning-systemunmanned-aerial-vehiclesatellite-imageryhyperspectral-imagingthermal-imagingLiDARradaracoustic-monitoringeDNAenvironmental-DNAmetabarcodingmetagenomicsparticipatory-monitoringindigenous-and-local-knowledgefarmer-field-schoolplant-clinicintegrated-crop-managementintegrated-natural-resource-managementlearning-based-managementknowledge-based-managementevidence-based-managementsmart-agricultureagroecological-agriculturebiodynamic-agricultureholistic-managementmanaged-grazingrotational-grazingmob-grazingforest-farmingalley-croppingriparian-bufferwindbreakshelterbeltliving-fencecontour-farmingterracingcover-croppinggreen-manurecompostingvermicompostingbiocharbiofertilizerbiostimulantbiocontrolaugmentative-biological-controlclassical-biological-controlmicrobial-controlentomopathogenic-nematodeentomopathogenic-fungusentomopathogenic-bacteriumentomopathogenic-viruspredatorparasitoidparasitecompetitorantagonistnatural-enemybeneficial-insectpollinatordecomposerdetritivorenutrient-cyclingsoil-healthsoil-biologysoil-microbiomerhizospherephyllosphereendospheremycorrhizanitrogen-fixationphosphorus-solubilizationplant-growth-promotioninduced-systemic-resistancesystemic-acquired-resistancepriminghormesiscross-tolerancestress-memoryepigeneticstransgenerational-effectmaternal-effectpaternal-effectparental-effecthost-microbe-interactionplant-microbe-interactioninsect-microbe-interactionmultitrophic-interactionfood-webtrophic-cascadeapparent-competitionresource-competitioninterference-competitionexploitation-competitionscramble-competitioncontest-competitiondensity-dependencedensity-independenceregulationlimitationbottom-up-controltop-down-controlsideways-controlmesopredator-releasetrophic-trickletrophic-subsidyspatial-subsidytemporal-subsidyecosystem-engineerfoundation-specieskeystone-speciesumbrella-speciesflagship-speciesindicator-speciessentinel-speciesbioindicatorbiomonitorecosystem-service-providerecosystem-service-beneficiaryprovisioning-serviceregulating-servicecultural-servicesupporting-servicehabitat-servicepollination-servicepest-control-servicenutrient-cycling-servicewater-purification-serviceair-purification-serviceclimate-regulation-serviceerosion-control-servicerecreation-serviceaesthetic-servicespiritual-serviceeducational-servicescientific-serviceexistence-valueoption-valuebequest-valuedirect-use-valueindirect-use-valuenon-use-valuetotal-economic-valuewillingness-to-paywillingness-to-acceptcontingent-valuationchoice-experimentbenefit-transferecosystem-accountingnatural-capital-accountinggreen-accountinginclusive-wealthgenuine-progress-indicatorindex-of-sustainable-economic-welfarehappy-planet-indexplanetary-boundariesdoughnut-economicsdegrowthsteady-state-economycircular-economysharing-economycollaborative-consumptionprosumermaker-movementurban-farmingvertical-farmingcontrolled-environment-agriculturehydroponicsaeroponicsaquaponicsbioponicsintegrated-multi-trophic-aquaculturerecirculating-aquaculture-systembiofloc-technologyalgae-cultivationinsect-farmingcellular-agricultureprecision-fermentationcultivated-meatplant-based-meatalternative-proteinnovel-foodfood-technologyfood-innovationfood-system-transformationfood-lossfood-wastepost-harvest-lossvalue-chainsupply-chaincold-chainlogisticsinfrastructurestorageprocessingpackagingdistributionretailconsumptiondietary-patternfood-choiceconsumer-behaviorfood-environmentfood-policyfood-governancewater-securityenergy-securityclimate-securityenvironmental-securityhuman-securitysustainable-development-goalsagenda-2030paris-agreementkunming-montreal-global-biodiversity-frameworkunited-nations-framework-convention-on-climate-changeunited-nations-convention-to-combat-desertificationunited-nations-convention-on-biological-diversitystockholm-conventionrotterdam-conventionbasel-conventionmontreal-protocolkyoto-protocolnagoya-protocolcartagena-protocolaitar-guidelinesipbesipccfaowhowtoundpunepunescoworld-bankimfoecdg20g7euauaseanmercosurnaftausmcacptpprcepbretton-woods-institutionsmultilateral-development-banksbilateral-development-agenciesnon-governmental-organizationscivil-society-organizationscommunity-based-organizationsfarmer-organizationsproducer-organizationscooperativessocial-enterprisesimpact-investingblended-financegreen-bondsocial-bondsustainability-bondcatastrophe-bondinsurancereinsurancerisk-poolingrisk-transferrisk-retentionrisk-reductionpreventionpreparednessresponserecoveryreconstructionrehabilitationbuild-back-betterbuild-back-greenerbuild-back-fairerjust-transitiongreen-transitiondigital-transitionsocial-protectionsafety-netcash-transferin-kind-transferfood-assistancenutrition-assistanceschool-feedingsocial-and-behavior-change-communicationnutrition-educationdietary-diversificationbiofortificationindustrial-fortificationsupplementationtherapeutic-feedingcommunity-based-management-of-acute-malnutritioninpatient-management-of-acute-malnutritionprevention-of-acute-malnutritiontreatment-of-acute-malnutritionmanagement-of-moderate-acute-malnutritionmanagement-of-severe-acute-malnutritionwastingunderweightmicronutrient-deficiencyanemiaiodine-deficiencyvitamin-A-deficiencyzinc-deficiencyiron-deficiencyfolate-deficiencyvitamin-D-deficiencycalcium-deficiencyobesityoverweightdiet-related-non-communicable-diseasediabetescardiovascular-diseasecancerdental-cariesmental-healthcognitive-developmenthuman-capitaleconomic-growthproductivitylabor-force-participationemploymentlivelihoodincomepovertyinequalitysocial-exclusionmarginalizationsustainabilityintergenerational-equityintragenerational-equityspatial-equitytemporal-equityprocedural-equitydistributional-equityrecognitional-equitycapability-approachhuman-developmenthuman-flourishingwell-beingquality-of-lifelife-satisfactionhappinesssubjective-well-beingobjective-well-beingmaterial-well-beingrelational-well-beingexperiential-well-beingeudaimonic-well-beinghedonic-well-beingpsychological-well-beingsocial-well-beingphysical-well-beingspiritual-well-beingenvironmental-well-beingplanetary-well-beingecohealthglobal-healthpublic-healthenvironmental-healthoccupational-healthfood-safetywater-safetyair-qualitysoil-qualitybiodiversityecosystem-functionecosystem-stabilityecosystem-resilienceecosystem-servicesnatural-capitalnature's-contributions-to-peopleurban-natureurban-biodiversityurban-ecosystemurban-forestryurban-greeningurban-coolingurban-heat-islandclimate-change-adaptationclimate-change-mitigationclimate-resilient-agriculturelow-emission-agriculturecarbon-neutral-agriculturecarbon-negative-agricultureagroecological-intensificationintegrated-watershed-managementintegrated-coastal-zone-managementintegrated-marine-and-coastal-area-managementintegrated-water-resources-managementparticipatory-managementpolycentric-governancecollaborative-governancenetwork-governanceparticipatory-governancedeliberative-governancetransformative-governancesocial-innovationtechnological-innovationinstitutional-innovationorganizational-innovationbusiness-model-innovationpolicy-innovationsystem-innovationsocio-technical-transitionsustainability-transitiondigital-transformationagricultural-transformationrural-transformationurban-transformationlandscape-transformationecosystem-restorationecosystem-rehabilitationecosystem-reconstructionecosystem-replacementecosystem-protectionecosystem-conservationecosystem-managementecosystem-stewardshipecosystem-governancebiocultural-diversitybiocultural-heritagebiocultural-rightsbiocultural-community-protocolfree-prior-and-informed-consentaccess-and-benefit-sharingtraditional-knowledgeaction-researchinterdisciplinary-researchmultidisciplinary-researchcross-disciplinary-researchproblem-oriented-researchsolution-oriented-researchuse-inspired-researchfundamental-researchapplied-researchdevelopment-researchimplementation-researchscaling-researchoutcome-evaluationprocess-evaluationeconomic-evaluationmulti-criteria-analysisparticipatory-evaluationdevelopmental-evaluationutilization-focused-evaluationrealist-evaluationtheory-based-evaluationcontribution-analysisprocess-tracingqualitative-comparative-analysissocial-network-analysisinstitutional-analysispolitical-economy-analysispower-analysisgender-analysissocial-inclusion-analysispoverty-analysisvulnerability-analysisresilience-analysisadaptation-analysismitigation-analysissustainability-analysisscenario-analysisforesightanticipatory-analysisroadmappingpathway-analysistransition-analysistransformation-analysisgovernance-innovationfinancial-innovationmarket-based-instrumentpayment-for-ecosystem-servicesecosystem-service-valuationinclusive-wealth-accountingsustainable-development-goals-indexenvironmental-performance-indexglobal-food-security-indexglobal-hunger-indexnutrition-indexwater-poverty-indexenergy-development-indexmultidimensional-poverty-indexhuman-development-indexgender-development-indexgender-inequality-indexinequality-adjusted-human-development-indexplanetary-pressures-adjusted-human-development-indexsustainable-development-reportworld-happiness-reportworld-development-reportworld-resources-reportglobal-risks-reportglobal-adaptation-reportemissions-gap-reportproduction-gap-reportadaptation-gap-reportfinance-gap-reportbiodiversity-outlookclimate-change-outlookland-degradation-outlookwater-outlookenergy-outlookfood-outlookagriculture-outlookforestry-outlookfisheries-outlookaquaculture-outlooklivestock-outlookcrop-outlooktechnology-outlooksocial-outlookeconomic-outlookregional-outlookcountry-outlooksectoral-outlookthematic-outlookspecial-reporttechnical-reportworking-paperdiscussion-paperpolicy-briefissue-brieffact-sheetguidelinemanualhandbooktoolkitframeworkprotocolstandardindicatorbenchmarktargetgoalobjectivestrategyplanprogramprojectinitiativealliancecoalitionhubcenterinstituteacademyuniversitycollegeschoolresearch-centerthink-tankobservatorymonitoring-systemearly-warning-systemalert-systemresponse-systemrecovery-systemlearning-systemknowledge-systeminformation-systemdata-systemarchivelibrarymuseumcollectionexhibitiondemonstrationpilotcase-studybest-practicelesson-learnedsuccess-storyfailure-storyinnovationinventiondiscoverybreakthroughfrontiercutting-edgestate-of-the-artemergingtrendingdisruptivetransformativerevolutionaryevolutionaryincrementalradicalsystemicholisticintegratedinterconnectedinterdependentcomplexcomplicatedsimplewickedtameuncertainambiguousvolatiledynamicadaptiveresilientrobustfragilevulnerablesensitiveexposedat-riskin-dangerthreatenedendangeredcriticalurgentimmediateshort-termmedium-termlong-termstrategictacticaloperationalfoundationalstructuralfunctionalproceduralbehavioralattitudinalculturalsocialeconomicpoliticalenvironmentaltechnologicalinstitutionalorganizationalindividualcollectivecommunitysocietalgloballocalnationalregionallandscapeseascapewaterscapeairscapebiospherenoospheretechnospheresociosphereecospherehydrosphereatmospherelithospherepedospherecryosphereanthroposphereurban-sphererural-sphereagricultural-spherenatural-spheremanaged-sphereprotected-sphererestored-spheredegraded-spheretransformed-sphereconnected-spheredisconnected-sphereintegrated-spherefragmented-sphereresilient-spherevulnerable-sphereadaptive-spheremaladaptive-spheresustainable-sphereunsustainable-sphereequitable-sphereinequitable-spherejust-sphereunjust-sphereinclusive-sphereexclusive-spherediverse-spherehomogeneous-spherecomplex-spheresimple-spheredynamic-spherestatic-spherestable-sphereunstable-spherepredictable-sphereunpredictable-spherecontrollable-sphereuncontrollable-spheremanageable-sphereunmanageable-spheregovernable-sphereungovernable-spherenavigable-sphereunnavigable-spheretraversable-sphereuntraversable-spherepermeable-sphereimpermeable-sphereporous-spherenon-porous-spheretransparent-sphereopaque-spherevisible-sphereinvisible-spheretangible-sphereintangible-spherematerial-sphereimmaterial-spherephysical-spheremetaphysical-sphereempirical-spheretheoretical-spherepractical-sphereapplied-spherepure-spherebasic-spherestrategic-spheretactical-sphereoperational-spherefoundational-spheresuperstructural-sphereinfrastructural-spherestructural-spherefunctional-sphereprocedural-spherebehavioral-sphereattitudinal-spherecultural-spheresocial-sphereeconomic-spherepolitical-sphereenvironmental-spheretechnological-sphereinstitutional-sphereorganizational-sphereindividual-spherecollective-spherecommunity-spheresocietal-sphereglobal-spherelocal-spherenational-sphereregional-spherelandscape-sphereseascape-spherewaterscape-sphereairscape-spherebiosphere-spherenoosphere-spheretechnosphere-spheresociosphere-sphereecosphere-spherehydrosphere-sphereatmosphere-spherelithosphere-spherepedosphere-spherecryosphere-sphereanthroposphere-sphereurban-sphere-sphererural-sphere-sphereagricultural-sphere-spherenatural-sphere-spheremanaged-sphere-sphereprotected-sphere-sphererestored-sphere-spheredegraded-sphere-spheretransformed-sphere-sphereconnected-sphere-spheredisconnected-sphere-sphereintegrated-sphere-spherefragmented-sphere-sphereresilient-sphere-spherevulnerable-sphere-sphereadaptive-sphere-spheremaladaptive-sphere-spheresustainable-sphere-sphereunsustainable-sphere-sphereequitable-sphere-sphereinequitable-sphere-spherejust-sphere-sphereunjust-sphere-sphereinclusive-sphere-sphereexclusive-sphere-spherediverse-sphere-spherehomogeneous-sphere-spherecomplex-sphere-spheresimple-sphere-spheredynamic-sphere-spherestatic-sphere-spherestable-sphere-sphereunstable-sphere-spherepredictable-sphere-sphereunpredictable-sphere-spherecontrollable-sphere-sphereuncontrollable-sphere-spheremanageable-sphere-sphereunmanageable-sphere-spheregovernable-sphere-sphereungovernable-sphere-spherenavigable-sphere-sphereunnavigable-sphere-spheretraversable-sphere-sphereuntraversable-sphere-spherepermeable-sphere-sphereimpermeable-sphere-sphereporous-sphere-spherenon-porous-sphere-spheretransparent-sphere-sphereopaque-sphere-spherevisible-sphere-sphereinvisible-sphere-spheretangible-sphere-sphereintangible-sphere-spherematerial-sphere-sphereimmaterial-sphere-spherephysical-sphere-spheremetaphysical-sphere-sphereempirical-sphere-spheretheoretical-sphere-spherepractical-sphere-sphereapplied-sphere-spherepure-sphere-spherebasic-sphere-spherestrategic-sphere-spheretactical-sphere-sphereoperational-sphere-spherefoundational-sphere-spheresuperstructural-sphere-sphereinfrastructural-sphere-spherestructural-sphere-spherefunctional-sphere-sphereprocedural-sphere-spherebehavioral-sphere-sphereattitudinal-sphere-spherecultural-sphere-spheresocial-sphere-sphereeconomic-sphere-spherepolitical-sphere-sphereenvironmental-sphere-spheretechnological-sphere-sphereinstitutional-sphere-sphereorganizational-sphere-sphereindividual-sphere-spherecollective-sphere-spherecommunity-sphere-spheresocietal-sphere-sphereglobal-sphere-spherelocal-sphere-spherenational-sphere-sphereregional-sphere-spherelandscape-sphere-sphereseascape-sphere-spherewaterscape-sphere-sphereairscape-sphere-spherebiosphere-sphere-spherenoosphere-sphere-spheretechnosphere-sphere-spheresociosphere-sphere-sphereecosphere-sphere-spherehydrosphere-sphere-sphereatmosphere-sphere-spherelithosphere-sphere-spherepedosphere-sphere-spherecryosphere-sphere-sphereanthroposphere-sphere-sphereurban-sphere-sphere-sphererural-sphere-sphere-sphereagricultural-sphere-sphere-spherenatural-sphere-sphere-spheremanaged-sphere-sphere-sphereprotected-sphere-sphere-sphererestored-sphere-sphere-spheredegraded-sphere-sphere-spheretransformed-sphere-sphere-sphereconnected-sphere-sphere-spheredisconnected-sphere-sphere-sphereintegrated-sphere-sphere-spherefragmented-sphere-sphere-sphereresilient-sphere-sphere-spherevulnerable-sphere-sphere-sphereadaptive-sphere-sphere-spheremaladaptive-sphere-sphere-spheresustainable-sphere-sphere-sphereunsustainable-sphere-sphere-sphereequitable-sphere-sphere-sphereinequitable-sphere-sphere-spherejust-sphere-sphere-sphereunjust-sphere-sphere-sphereinclusive-sphere-sphere-sphereexclusive-sphere-sphere-spherediverse-sphere-sphere-spherehomogeneous-sphere-sphere-spherecomplex-sphere-sphere-spheresimple-sphere-sphere-spheredynamic-sphere-sphere-spherestatic-sphere-sphere-spherestable-sphere-sphere-sphereunstable-sphere-sphere-spherepredictable-sphere-sphere-sphereunpredictable-sphere-sphere-spherecontrollable-sphere-sphere-sphereuncontrollable-sphere-sphere-spheremanageable-sphere-sphere-sphereunmanageable-sphere-sphere-spheregovernable-sphere-sphere-sphereungovernable-sphere-sphere-spherenavigable-sphere-sphere-sphereunnavigable-sphere-sphere-spheretraversable-sphere-sphere-sphereuntraversable-sphere-sphere-spherepermeable-sphere-sphere-sphereimpermeable-sphere-sphere-sphereporous-sphere-sphere-spherenon-porous-sphere-sphere-spheretransparent-sphere-sphere-sphereopaque-sphere-sphere-spherevisible-sphere-sphere-sphereinvisible-sphere-sphere-spheretangible-sphere-sphere-sphereintangible-sphere-sphere-spherematerial-sphere-sphere-sphereimmaterial-sphere-sphere-spherephysical-sphere-sphere-spheremetaphysical-sphere-sphere-sphereempirical-sphere-sphere-spheretheoretical-sphere-sphere-spherepractical-sphere-sphere-sphereapplied-sphere-sphere-spherepure-sphere-sphere-spherebasic-sphere-sphere-spherestrategic-sphere-sphere-spheretactical-sphere-sphere-sphereoperational-sphere-sphere-spherefoundational-sphere-sphere-spheresuperstructural-sphere-sphere-sphereinfrastructural-sphere-sphere-spherestructural-sphere-sphere-spherefunctional-sphere-sphere-sphereprocedural-sphere-sphere-spherebehavioral-sphere-sphere-sphereattitudinal-sphere-sphere-spherecultural-sphere-sphere-spheresocial-sphere-sphere-sphereeconomic-sphere-sphere-spherepolitical-sphere-sphere-sphereenvironmental-sphere-sphere-spheretechnological-sphere-sphere-sphereinstitutional-sphere-sphere-sphereorganizational-sphere-sphere-sphereindividual-sphere-sphere-spherecollective-sphere-sphere-spherecommunity-sphere-sphere-spheresocietal-sphere-sphere-sphereglobal-sphere-sphere-spherelocal-sphere-sphere-spherenational-sphere-sphere-sphereregional-sphere-sphere-spherelandscape-sphere-sphere-sphereseascape-sphere-sphere-spherewaterscape-sphere-sphere-sphereairscape-sphere-sphere-spherebiosphere-sphere-sphere-spherenoosphere-sphere-sphere-spheretechnosphere-sphere-sphere-spheresociosphere-sphere-sphere-sphereecosphere-sphere-sphere-spherehydrosphere-sphere-sphere-sphereatmosphere-sphere-sphere-spherelithosphere-sphere-sphere-spherepedosphere-sphere-sphere-spherecryosphere-sphere-sphere-sphereanthroposphere-sphere-sphere-sphereEntedoninae
Entedoninae is a subfamily of chalcid wasps in the family Eulophidae comprising over 90 genera. Members are primarily parasitoids with documented associations across diverse host groups including gall-inducing insects, leafminers, sawflies, thrips, and ants. The subfamily exhibits considerable morphological and ecological diversity, with species found in tropical to temperate habitats worldwide.
parasitoidbiological-controlgall-associatedleafminer-parasitoidChalcidoideaHymenopteraEulophidaeEntedoninaetropical-forestagricultural-pest-controlsawfly-parasitoidthrips-parasitoidant-associatedrice-pestCecidomyiidaeTenthredinidaePontaniaClosterocerusCeranisusAfronymphaAmetallonChrysonotomyiaOmphale-genus-groupcanopyunderstoreyecological-plasticityBangladeshPanamaAfricaNew-ZealandEuropeSenegalSouth-AfricaDemocratic-Republic-of-the-CongoUgandaendoparasitoidlarval-parasitoidegg-parasitoidhost-specificityforest-habitatdegraded-habitatmid-altitude-rainforestlowland-rainforesttropical-Americaclassical-biological-controlaugmentative-biological-controlintegrated-pest-managementrice-hispaDicladispa-armigeragall-waspsawfly-gallleafminerant-symbiosisFormicidaeKhaya-senegalensisOchna-pulchramorphological-taxonomymolecular-taxonomy28S-rDNACOICytBnew-species-descriptiongeneric-revisionhost-rangeparasitoid-complexfood-webecosystem-servicenatural-enemypest-managemententomophagoushyperparasitoidinquilinecurculionidApion-minimumPhyllocolpa-leucostictaChrysocharisEntedonAsecodesPleurotroppopsisAfrotroppopsisZaommomentedonApleurotropisKratoysmaPlatocharisSchizocharisParahorismenusAtullyaTropicharisChrysochuriscruymirabilisoryzamyntoreminpashaicarinatumdussiaelongicaudatamachaeriaeunimaculataclavigergorgonaenseauripunctatagalbinalaeviscutaphenacapsiacecvoraelongatapontaniaeheyeririsbecimilletiaenewbyiFörster-1856Chalcidoidea-phylogenybiodiversityspecies-richnesscryptic-speciesmolecular-diagnosticshost-plant-associationhabitat-specificitycanopy-faunaunderstorey-faunaforest-stratificationtropical-biodiversityAfrotropicalNeotropicalPalaearcticNearcticOrientalAustralasianPacificHolarcticbiogeographytaxonomic-revisionannotated-keycataloguetype-specimenmuseum-collectionslide-mounted-specimensmorphometricsgenitaliawing-venationantennaeclypeusmandiblesmalar-spacescapepedicelflagellumgastervertexsuturecolor-patternpale-femoradark-gastersexual-dimorphismmalefemaleovipositoremergencerearingquarantinefield-collectionforeign-explorationaugmentative-releasepesticide-resistancesustainable-agriculturefood-securityrice-productioncereal-pestvegetable-pestfruit-pestornamental-pestforest-pesturban-pestinvasive-speciesnative-rangeintroduced-rangeestablishmentspreadimpactnon-target-effectshost-specificityrisk-assessmentenvironmental-safetyregulatory-approvalresearch-symposiumproceedingspeer-reviewedZootaxaZooKeysInsect-Systematics-&-EvolutionAustralian-Journal-of-EntomologyFar-Eastern-EntomologistRussian-Entomological-JournalBelgian-Journal-of-EntomologyFlorida-EntomologistPan-Pacific-EntomologistEntomological-NewsProceedings-of-the-Hawaiian-Entomological-SocietyTransactions-of-the-American-Entomological-SocietyJournal-of-Natural-HistoryZoological-Journal-of-the-Linnean-SocietyBioControlJournal-of-Economic-EntomologyEntomologia-Experimentalis-et-ApplicataEnvironmental-EntomologyOecologiaCladisticsMolecular-Phylogenetics-and-EvolutionHeredityCanadian-EntomologistProceedings-of-the-Entomological-Society-of-WashingtonAnnals-of-the-Entomological-Society-of-AmericaBulletin-of-Entomological-ResearchNeotropical-EntomologyJournal-of-Asia-Pacific-EntomologyTurkish-Journal-of-ZoologyPolish-Journal-of-EntomologyNorth-Western-Journal-of-ZoologyEntomologica-AmericanaEntomologische-BerichtenSahlbergiaDugesianaActa-Zoologica-LilloanaFolia-Entomologica-MexicanaRevista-de-la-Sociedad-Entomologica-ArgentinaBoletin-de-la-Asociacion-Espanola-de-EntomologiaEntomologicheskoe-ObozrenieEntomological-ReviewZoological-Institute-RASProceedings-of-the-Zoological-Institute-of-the-Russian-Academy-of-SciencesTaiwan-Agricultural-Research-InstituteCouncil-of-AgricultureUniversity-of-CaliforniaRiversideEntomology-Research-MuseumCalifornia-Department-of-Food-and-AgriculturePierce's-Disease-Control-Programbiological-control-programintegrated-pest-management-programresearch-progress-reportannual-summarytechnical-reportsymposium-proceedingsconference-abstractposter-presentationinvited-papermonographbook-chapteridentification-guideillustrated-keyannotated-cataloguetype-materialvoucher-specimencollection-curationtaxonomysystematicsphylogeneticsmolecular-systematicsDNA-barcodingspecies-complexsibling-speciesspecies-boundariesgeographic-variationpopulation-geneticsgene-flowreproductive-isolationhost-racebiotypestrainlaboratory-rearinginsectarymass-productionreleasemonitoringimpact-assessmentefficacyeconomic-evaluationcost-benefit-analysisfarmer-adoptionextensioneducationpolicyregulationinternational-cooperationcapacity-buildingtrainingworkshopfield-daydemonstrationon-farm-researchparticipatory-researchfarmer-field-schoolsustainable-intensificationagroecologyconservation-biological-controlhabitat-managementfloral-resourcesrefugebuffer-zonelandscape-complexityconnectivityspillovernatural-enemy-diversityfood-web-structuretrophic-interactionsmultitrophicindirect-effectstrait-mediateddensity-dependentinverse-density-dependentfunctional-responsenumerical-responsesearching-efficiencyhandling-timeoviposition-behaviorhost-selectionhost-acceptancehost-suitabilityhost-qualityhost-stage-preferenceegg-loadprogeny-allocationsex-ratiolocal-mate-competitionsib-matinginbreedingfitnesslongevityfecunditydevelopment-timethermal-requirementsdegree-daysphenologysynchronyasynchronyseasonal-adaptationdiapausequiescencecold-hardinessheat-tolerancedesiccation-resistancestarvation-resistancedispersalflightwalkingforagingpatch-usearea-restricted-searchoviposition-markinghost-markingsuperparasitismmultiparasitismintraguild-predationhyperparasitismautoparasitismheteronomous-hyperparasitismfacultative-hyperparasitismobligate-hyperparasitismprimary-parasitoidsecondary-parasitoidtertiary-parasitoidmummyaphid-mummyscale-mummypupal-parasitoidegg-larval-parasitoidlarval-pupal-parasitoididiobiontkoinobiontectoparasitoidsolitarygregariouspolyembryonythelytokyarrhenotokydiploidhaplodiploidchromosome-numbergenome-sizetranscriptomeproteomemetabolomemorphomephenomeextended-phenotypeniche-constructionecosystem-engineeringkeystone-speciesecosystem-service-providerfunctional-groupguildtrophic-levelenergy-flownutrient-cyclingdecompositionpredationherbivoryparasitismmutualismcommensalismcompetitionapparent-competitionexploitative-competitioninterference-competitionscramble-competitioncontest-competitionresource-partitioningniche-differentiationcharacter-displacementco-evolutionarms-raceRed-Queengeographic-mosaiclocal-adaptationphenotypic-plasticitygenetic-adaptationepigeneticstransgenerational-effectsmaternal-effectspaternal-effectsparental-caremating-systemsexual-selectionsperm-competitioncryptic-female-choicemate-choicelekterritoryaggressionalarmdefensevenomallomonekairomonesynomonesemiochemicalpheromonetrail-pheromonealarm-pheromoneaggregation-pheromonesex-pheromonemarking-pheromoneoviposition-deterrenthost-marking-pheromoneplant-volatileinduced-plant-defensesystemic-acquired-resistanceinduced-systemic-resistanceprimingvolatile-organic-compoundgreen-leaf-volatileterpenoidphenylpropanoidjasmonic-acidsalicylic-acidethyleneabscisic-acidgibberellinauxincytokininbrassinosteroidstrigolactonenitric-oxidereactive-oxygen-specieshypersensitive-responseprogrammed-cell-deathautophagyapoptosisnecrosispathogen-associated-molecular-patterndamage-associated-molecular-patternpattern-recognition-receptoreffector-triggered-immunitygene-for-geneavirulencevirulenceeffectortoxinphytotoxinmycotoxinbacterial-toxinviral-toxininsecticidal-proteincry-proteinvip-proteincyt-proteinsporeconidiumappressoriumhaustoriummyceliumsclerotiumfruiting-bodybasidiocarpascocarpperitheciumcleistotheciumpycnidiumacervulussporodochiumsymptomsigndisease-triangledisease-cycleepidemicendemicpandemicoutbreakeradicationcontainmentmanagementcontrolpreventionforecastingwarning-systemdecision-support-systemexpert-systemmodelsimulationeconomic-thresholdeconomic-injury-levelaction-thresholdtreatment-thresholddamage-thresholdaesthetic-injury-levelcultural-controlphysical-controlmechanical-controlchemical-controlgenetic-controlsterile-insect-techniqueincompatible-insect-techniqueprecision-agriculturesite-specific-managementvariable-rate-applicationremote-sensinggeographic-information-systemglobal-positioning-systemunmanned-aerial-vehicledronesensorimagingspectroscopymachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionimage-analysispattern-recognitionclassificationsegmentationdetectiontrackingcountingsamplingsampling-plansequential-samplingbinomial-samplingpresence-absence-samplingfixed-precision-samplingvariable-precision-samplingspatial-samplingtemporal-samplingstratified-samplingcluster-samplingsystematic-samplingrandom-samplingconvenience-samplingjudgment-samplingexpert-samplingquota-samplingsnowball-samplingrespondent-driven-samplingcapture-recapturemark-recapturemark-resightdistance-samplingline-transectpoint-transectstrip-transectplotquadratpitfall-trapMalaise-trappan-trapwater-panyellow-panblue-panwhite-panflight-interception-trapwindow-trapcanopy-foggingbeating-traysweep-netaerial-netground-netaquatic-netD-vacvacuum-sampleraspiratormouth-aspiratormechanical-aspiratorberlese-funnelTullgren-funnelWinkler-extractorpitfallbarber-trappitfall-arraydrift-fencefunnel-traplight-trapUV-lightblack-lightmercury-vaporsodium-vaporLEDactiniccolor-trapsticky-trappheromone-trapsynthetic-pheromonenatural-pheromonekairomone-trapfood-baitprotein-baitsugar-baitfermentation-baitalcohol-baitvinegar-baitmolasses-baitfruit-baitmeat-baitfish-baitdung-baitcarrion-baitdecoylureattractantrepellentdeterrentantifeedantoviposition-stimulantarrestantsuppressanttoxicantstomach-poisoncontact-poisonfumigantsystemictranslaminarresidualpersistentnon-persistentbroad-spectrumnarrow-spectrumselectivenon-selectivetarget-specifichost-specificmode-of-actionnerve-poisonacetylcholinesterase-inhibitorGABA-antagonistsodium-channel-modulatornicotinic-acetylcholine-receptor-agonistryanodine-receptor-modulatorchitin-synthesis-inhibitorjuvenile-hormone-mimicecdysone-agonistmicrobial-pesticideentomopathogenic-nematodeentomopathogenic-fungusentomopathogenic-bacteriumentomopathogenic-virusentomopathogenic-protozoaBacillus-thuringiensisBtBacillus-sphaericusPaenibacillus-popilliaeSerratia-entomophilaMetarhizium-anisopliaeBeauveria-bassianaLecanicillium-lecaniiIsaria-fumosoroseaNomuraea-rileyiHirsutella-thompsoniiEntomophthoraNeozygitesNosemaVairimorphaThelohaniaAnticarsia-gemmatalis-nucleopolyhedrovirusAgMNPVCydia-pomonella-granulovirusCpGVSpodoptera-exigua-multiple-nucleopolyhedrovirusSeMNPVAutographa-californica-multiple-nucleopolyhedrovirusAcMNPVnucleopolyhedrovirusgranuloviruscypovirusentomopoxvirusiridovirusparvovirustetravirusnodavirusreoviruspicornavirusiflavirusdensovirusbirnavirustotiviruspartitivirushypovirulencemycovirusbacteriophagephagetransductionconjugationtransformationhorizontal-gene-transfervertical-gene-transfermobile-genetic-elementtransposonplasmidintegrongenomic-islandpathogenicity-islandsymbiosis-islandmetabolic-islandresistance-islandvirulence-factorantibiotic-resistanceinsecticide-resistanceacaricide-resistanceherbicide-resistancefungicide-resistancebactericide-resistancenematicide-resistancemolluscicide-resistancerodenticide-resistanceresistance-managementresistance-monitoringresistance-detectionresistance-diagnosisresistance-mechanismmetabolic-resistancetarget-site-resistancepenetration-resistancebehavioral-resistancecross-resistancemultiple-resistancenegative-cross-resistancesynergismantagonismpotentiationsafeneradjuvantsurfactantspreaderstickerextenderbufferacidifierdefoamerdrift-retardantrainfastnessUV-protectantformulationemulsifiable-concentratewettable-powderwater-dispersible-granulesuspension-concentratecapsule-suspensionmicroencapsulationnanotechnologycontrolled-releaseslow-releaseattract-and-killsterile-insect-releaseinundative-releaseinoculative-releaseconservationaugmentationclassicalneoclassicalnew-associationtargetedarea-widesuppressionprotectionproductionintegrated-crop-managementintegrated-productionorganic-farmingbiodynamic-farmingpermacultureagroforestrysilvopastureclimate-smart-agricultureconservation-agriculturedigital-agriculturesmart-farmingagriculture-4.0internet-of-thingsbig-datacloud-computingblockchaindistributed-ledgertraceabilitytransparencycertificationstandardgovernancestakeholdervalue-chainsupply-chainfood-systemnutrition-securitylivelihoodincomeemploymentgenderyouthsocial-inclusionequityfairnessjusticeethicsanimal-welfareenvironmental-protectionbiodiversity-conservationecosystem-restorationland-degradation-neutralitydesertificationdeforestationreforestationafforestationforest-restorationwetland-restorationgrassland-restorationsoil-restorationsoil-healthsoil-organic-mattersoil-carbonsoil-biodiversitysoil-faunasoil-microbiomerhizospherephyllosphereanthropospheretechnospherebiosphereecospherehydrosphereatmospherelithospherepedospherecryosphereclimate-changeglobal-warminggreenhouse-gascarbon-dioxidemethanenitrous-oxidefluorinated-gascarbon-sequestrationcarbon-storagecarbon-sinkcarbon-sourcecarbon-neutralcarbon-negativenet-zeroclimate-adaptationclimate-mitigationclimate-resiliencevulnerabilityexposuresensitivityadaptive-capacitytransitionpathwayscenarioprojectionforecastpredictionuncertaintyriskhazarddamagelossadaptationmitigationresiliencesustainabilitysustainable-developmentsustainable-development-goalsSDGAgenda-2030Paris-AgreementConvention-on-Biological-DiversityCBDNagoya-ProtocolCartagena-ProtocolAichi-TargetsKunming-Montreal-Global-Biodiversity-Frameworkpost-2020-biodiversity-frameworkOne-HealthPlanetary-HealthEcoHealthOne-WelfareOne-WorldOne-Futureinterdisciplinarytransdisciplinarymultidisciplinarycross-disciplinaryintersectoralmultistakeholderpartnershipcollaborationcooperationnetworkplatformhubcenter-of-excellencecapacity-developmentinstitutional-strengtheningpolicy-supportscience-policy-interfaceevidence-based-policyscience-diplomacytechnology-transferknowledge-transferknowledge-exchangeknowledge-sharingopen-accessopen-dataopen-scienceopen-innovationcitizen-sciencecommunity-based-monitoringaction-researchtransformative-researchsolution-oriented-researchproblem-driven-researchimpact-oriented-researchimplementation-researchoperational-researchapplied-researchbasic-researchfundamental-researchstrategic-researchtactical-researchadaptive-researchinnovationinventiondiscoverybreakthroughfrontieremergingconvergingenablingdisruptivetransformativeexponentialdigitalbiologicalphysicalcognitivesocialinstitutionaltechnologicalecologicalevolutionaryrevolutionaryincrementalradicalsystematicholisticintegratedcomprehensiveinclusiveparticipatorybottom-uptop-downmiddle-outhybridmixed-methodsqualitativequantitativeempiricaltheoreticalconceptualanalyticalcomputationalexperimentalobservationaldescriptivecorrelationalcausalmechanisticpredictiveprescriptivenormativeevaluativeassessmentappraisalreviewauditevaluationoutcome-evaluationprocess-evaluationcost-effectivenesscost-benefitcost-utilitymulti-criteria-decision-analysisstakeholder-analysissocial-network-analysisinstitutional-analysispolitical-economy-analysisgender-analysisyouth-analysisvulnerability-analysisrisk-analysisuncertainty-analysissensitivity-analysisscenario-analysissystems-analysislife-cycle-assessmentfootprintwater-footprintcarbon-footprintecological-footprintnitrogen-footprintbiodiversity-footprintland-footprintmaterial-footprintsocial-footprinthealth-footprintplanetary-boundarysafe-operating-spacedoughnut-economicsregenerativerestorativecirculargreenbluebioeconomycircular-economysharing-economygig-economyplatform-economydigital-economyknowledge-economycreative-economycare-economywellbeing-economydegrowthpost-growthsteady-statedoughnutsufficiencyprosperityflourishingthrivingbuen-vivirubuntuharmonybalanceequilibriumhomeostasisrobustnessadaptabilityflexibilityplasticityevolvabilityinnovabilitytransformabilitysustainability-scienceresilience-sciencecomplexity-sciencesystems-sciencenetwork-sciencedata-scienceinformation-sciencecomputer-sciencecognitive-sciencebehavioral-sciencesocial-sciencenatural-sciencelife-scienceearth-scienceenvironmental-scienceagricultural-scienceveterinary-sciencemedical-sciencehealth-sciencenutrition-sciencefood-sciencematerial-scienceengineering-scienceinterdisciplinary-sciencetransdisciplinary-scienceconvergence-scienceteam-scienceresponsible-scienceethical-scienceinclusive-sciencedecolonized-sciencefeminist-scienceindigenous-sciencetraditional-knowledgelocal-knowledgeexpert-knowledgelay-knowledgetacit-knowledgecodified-knowledgeexplicit-knowledgeimplicit-knowledgeprocedural-knowledgedeclarative-knowledgeepistemic-knowledgeontological-knowledgepractical-knowledgetheoretical-knowledgescientific-knowledgeindigenous-knowledgetraditional-ecological-knowledgeTEKfarmers'-knowledgefishers'-knowledgeherders'-knowledgehunters'-knowledgegatherers'-knowledgewomen's-knowledgemen's-knowledgeyouth-knowledgeelder-knowledgeintergenerational-knowledgetransgenerational-knowledgeancestral-knowledgeinherited-knowledgelearned-knowledgeacquired-knowledgeconstructed-knowledgeco-produced-knowledgeparticipatory-knowledgecollaborative-knowledgetransdisciplinary-knowledgeinterdisciplinary-knowledgemultidisciplinary-knowledgecross-disciplinary-knowledgeintegrated-knowledgeholistic-knowledgesystemic-knowledgecomplex-knowledgeuncertain-knowledgeambiguous-knowledgecontested-knowledgenegotiated-knowledgeagreed-knowledgeshared-knowledgecommon-knowledgepublic-knowledgeprivate-knowledgeproprietary-knowledgeopen-knowledgefree-knowledgeaccessible-knowledgeusable-knowledgeactionable-knowledgerelevant-knowledgetimely-knowledgecredible-knowledgelegitimate-knowledgesalient-knowledgeauthoritative-knowledgestakeholder-knowledgepolicy-maker-knowledgepractitioner-knowledgeresearcher-knowledgeacademic-knowledgetechnical-knowledgemanagerial-knowledgeadministrative-knowledgebureaucratic-knowledgepolitical-knowledgeeconomic-knowledgesocial-knowledgecultural-knowledgehistorical-knowledgegeographical-knowledgeecological-knowledgebiological-knowledgeagricultural-knowledgeenvironmental-knowledgeclimate-knowledgehealth-knowledgenutrition-knowledgefood-knowledgesafety-knowledgesecurity-knowledgerisk-knowledgedisaster-knowledgeemergency-knowledgecrisis-knowledgeconflict-knowledgepeace-knowledgedevelopment-knowledgesustainability-knowledgeresilience-knowledgeadaptation-knowledgemitigation-knowledgetransformation-knowledgeinnovation-knowledgetechnology-knowledgedigital-knowledgedata-knowledgeinformation-knowledgecommunication-knowledgemedia-knowledgejournalism-knowledgeeducation-knowledgelearning-knowledgetraining-knowledgecapacity-knowledgeinstitutional-knowledgeorganizational-knowledgenetwork-knowledgepartnership-knowledgecollaboration-knowledgecooperation-knowledgegovernance-knowledgepolicy-knowledgeregulation-knowledgelaw-knowledgerights-knowledgejustice-knowledgeethics-knowledgemorality-knowledgevalues-knowledgenorms-knowledgebeliefs-knowledgeattitudes-knowledgeperceptions-knowledgebehaviors-knowledgepractices-knowledgecustoms-knowledgetraditions-knowledgerituals-knowledgesymbols-knowledgeidentities-knowledgemeanings-knowledgenarratives-knowledgestories-knowledgediscourses-knowledgelanguages-knowledgerepresentation-knowledgeframing-knowledgeagenda-setting-knowledgepolicy-making-knowledgeimplementation-knowledgeevaluation-knowledgemonitoring-knowledgeaccountability-knowledgetransparency-knowledgeparticipation-knowledgeinclusion-knowledgeequity-knowledgefairness-knowledgeempowerment-knowledgeagency-knowledgeautonomy-knowledgeself-determination-knowledgesovereignty-knowledgeterritory-knowledgeland-knowledgeresource-knowledgeproperty-knowledgeownership-knowledgeaccess-knowledgecontrol-knowledgebenefit-knowledgesharing-knowledgedistribution-knowledgeallocation-knowledgemanagement-knowledgeconservation-knowledgerestoration-knowledgeprotection-knowledgeuse-knowledgeutilization-knowledgeexploitation-knowledgeharvesting-knowledgehunting-knowledgegathering-knowledgefishing-knowledgefarming-knowledgeherding-knowledgeforestry-knowledgemining-knowledgeextractivism-knowledgeproduction-knowledgeconsumption-knowledgetrade-knowledgeexchange-knowledgemarket-knowledgeeconomy-knowledgefinance-knowledgeinvestment-knowledgedebt-knowledgecredit-knowledgeinsurance-knowledgesubsidy-knowledgetax-knowledgefiscal-knowledgemonetary-knowledgecurrency-knowledgeinflation-knowledgedeflation-knowledgerecession-knowledgedepression-knowledgegrowth-knowledgeprogress-knowledgemodernization-knowledgeglobalization-knowledgelocalization-knowledgeregionalization-knowledgenationalization-knowledgeprivatization-knowledgeliberalization-knowledgederegulation-knowledgereregulation-knowledgestandardization-knowledgecertification-knowledgeaccreditation-knowledgequality-knowledgehygiene-knowledgesanitation-knowledgewellness-knowledgefitness-knowledgediet-knowledgecooking-knowledgecuisine-knowledgetaste-knowledgeflavor-knowledgearoma-knowledgetexture-knowledgeappearance-knowledgepresentation-knowledgeaesthetics-knowledgedesign-knowledgeart-knowledgeculture-knowledgeheritage-knowledgehistory-knowledgearchaeology-knowledgepaleontology-knowledgeevolution-knowledgegenetics-knowledgegenomics-knowledgeproteomics-knowledgemetabolomics-knowledgephenomics-knowledgetranscriptomics-knowledgeepigenomics-knowledgemicrobiomics-knowledgeviromics-knowledgemetagenomics-knowledgeecogenomics-knowledgeconservation-genomics-knowledgefunctional-genomics-knowledgestructural-genomics-knowledgecomparative-genomics-knowledgeevolutionary-genomics-knowledgepopulation-genomics-knowledgemedical-genomics-knowledgeagricultural-genomics-knowledgeenvironmental-genomics-knowledgeforensic-genomics-knowledgesynthetic-genomics-knowledgegenome-editing-knowledgeCRISPR-knowledgeCas9-knowledgegene-drive-knowledgesynthetic-biology-knowledgebioengineering-knowledgebiotechnology-knowledgenanotechnology-knowledgeinformation-technology-knowledgecommunication-technology-knowledgedigital-technology-knowledgeartificial-intelligence-knowledgemachine-learning-knowledgerobotics-knowledgeautomation-knowledgeprecision-technology-knowledgesmart-technology-knowledgeclean-technology-knowledgegreen-technology-knowledgeblue-technology-knowledgeclimate-technology-knowledgeadaptation-technology-knowledgemitigation-technology-knowledgeresilience-technology-knowledgesustainable-technology-knowledgeappropriate-technology-knowledgeintermediate-technology-knowledgelow-technology-knowledgehigh-technology-knowledgeemerging-technology-knowledgeconverging-technology-knowledgeenabling-technology-knowledgedisruptive-technology-knowledgetransformative-technology-knowledgeexponential-technology-knowledgefrontier-technology-knowledgespace-technology-knowledgenuclear-technology-knowledgerenewable-energy-technology-knowledgeenergy-efficiency-technology-knowledgeenergy-storage-technology-knowledgesmart-grid-technology-knowledgeelectric-vehicle-technology-knowledgebattery-technology-knowledgesolar-technology-knowledgewind-technology-knowledgehydro-technology-knowledgegeothermal-technology-knowledgebiomass-technology-knowledgebiofuel-technology-knowledgehydrogen-technology-knowledgefuel-cell-technology-knowledgecarbon-capture-technology-knowledgecarbon-storage-technology-knowledgecarbon-utilization-technology-knowledgecarbon-removal-technology-knowledgedirect-air-capture-technology-knowledgebioenergy-with-carbon-capture-and-storage-knowledgeBECCS-knowledgeenhanced-weathering-technology-knowledgeocean-fertilization-technology-knowledgesolar-radiation-management-knowledgestratospheric-aerosol-injection-knowledgemarine-cloud-brightening-knowledgecirrus-cloud-thinning-knowledgespace-based-solar-reflectors-knowledgealbedo-modification-knowledgegeoengineering-knowledgeclimate-engineering-knowledgeearth-system-engineering-knowledgeplanetary-engineering-knowledgeecosystem-engineering-knowledgehabitat-engineering-knowledgespecies-engineering-knowledgegenetic-engineering-knowledgegermline-engineering-knowledgesomatic-engineering-knowledgeenhancement-engineering-knowledgetherapy-engineering-knowledgediagnostics-engineering-knowledgeprognostics-engineering-knowledgetheranostics-engineering-knowledgepersonalized-medicine-knowledgeprecision-medicine-knowledgeregenerative-medicine-knowledgereproductive-medicine-knowledgetranslational-medicine-knowledgepreventive-medicine-knowledgecurative-medicine-knowledgepalliative-medicine-knowledgeintegrative-medicine-knowledgecomplementary-medicine-knowledgealternative-medicine-knowledgetraditional-medicine-knowledgeherbal-medicine-knowledgeacupuncture-knowledgehomeopathy-knowledgenaturopathy-knowledgechiropractic-knowledgeosteopathy-knowledgemassage-knowledgemeditation-knowledgemindfulness-knowledgeyoga-knowledgetai-chi-knowledgeqigong-knowledgemartial-arts-knowledgedance-knowledgemusic-knowledgeart-therapy-knowledgecolor-therapy-knowledgelight-therapy-knowledgesound-therapy-knowledgearomatherapy-knowledgehydrotherapy-knowledgebalneotherapy-knowledgethalassotherapy-knowledgeclimatotherapy-knowledgehelio-therapy-knowledgephototherapy-knowledgeradiation-therapy-knowledgechemotherapy-knowledgeimmunotherapy-knowledgetargeted-therapy-knowledgehormone-therapy-knowledgegene-therapy-knowledgecell-therapy-knowledgestem-cell-therapy-knowledgetissue-engineering-knowledgeorgan-engineering-knowledgebioprinting-knowledge3D-printing-knowledge4D-printing-knowledgeadditive-manufacturing-knowledgesubtractive-manufacturing-knowledgeformative-manufacturing-knowledgehybrid-manufacturing-knowledgedigital-manufacturing-knowledgesmart-manufacturing-knowledgelean-manufacturing-knowledgegreen-manufacturing-knowledgecircular-manufacturing-knowledgesustainable-manufacturing-knowledgeclean-manufacturing-knowledgezero-waste-manufacturing-knowledgeclosed-loop-manufacturing-knowledgeindustrial-ecology-knowledgeindustrial-symbiosis-knowledgeeco-industrial-park-knowledgegreen-chemistry-knowledgesustainable-chemistry-knowledgebio-based-chemistry-knowledgecircular-chemistry-knowledgesafe-chemistry-knowledgebenign-by-design-knowledgeatom-economy-knowledgeE-factor-knowledgeprocess-intensification-knowledgeflow-chemistry-knowledgemicrowave-chemistry-knowledgeultrasound-chemistry-knowledgemechanochemistry-knowledgeelectrochemistry-knowledgephotochemistry-knowledgeplasma-chemistry-knowledgesonochemistry-knowledgethermochemistry-knowledgecalorimetry-knowledgekinetics-knowledgethermodynamics-knowledgeequilibrium-knowledgereaction-engineering-knowledgeseparation-engineering-knowledgepurification-engineering-knowledgecrystallization-engineering-knowledgedistillation-engineering-knowledgeextraction-engineering-knowledgeabsorption-engineering-knowledgeadsorption-engineering-knowledgemembrane-engineering-knowledgefiltration-engineering-knowledgecentrifugation-engineering-knowledgesedimentation-engineering-knowledgeflotation-engineering-knowledgeleaching-engineering-knowledgeroasting-engineering-knowledgesintering-engineering-knowledgesmelting-engineering-knowledgerefining-engineering-knowledgealloying-engineering-knowledgecasting-engineering-knowledgeforming-engineering-knowledgemachining-engineering-knowledgejoining-engineering-knowledgewelding-engineering-knowledgebrazing-engineering-knowledgesoldering-engineering-knowledgeadhesive-bonding-engineering-knowledgemechanical-fastening-engineering-knowledgecoating-engineering-knowledgesurface-engineering-knowledgeheat-treatment-engineering-knowledgefinishing-engineering-knowledgepolishing-engineering-knowledgegrinding-engineering-knowledgelapping-engineering-knowledgehoning-engineering-knowledgesuperfinishing-engineering-knowledgetexturing-engineering-knowledgepatterning-engineering-knowledgelithography-engineering-knowledgeetching-engineering-knowledgedeposition-engineering-knowledgesputtering-engineering-knowledgeevaporation-engineering-knowledgechemical-vapor-deposition-engineering-knowledgephysical-vapor-deposition-engineering-knowledgeatomic-layer-deposition-engineering-knowledgemolecular-beam-epitaxy-engineering-knowledgepulsed-laser-deposition-engineering-knowledgesol-gel-engineering-knowledgespin-coating-engineering-knowledgedip-coating-engineering-knowledgespray-coating-engineering-knowledgeelectrophoretic-deposition-engineering-knowledgeelectroless-plating-engineering-knowledgeelectroplating-engineering-knowledgeanodizing-engineering-knowledgepassivation-engineering-knowledgeconversion-coating-engineering-knowledgephosphating-engineering-knowledgechromating-engineering-knowledgebluing-engineering-knowledgeblackening-engineering-knowledgepickling-engineering-knowledgecleaning-engineering-knowledgedegreasing-engineering-knowledgedescaling-engineering-knowledgedeflashing-engineering-knowledgedeburring-engineering-knowledgetrimming-engineering-knowledgeblanking-engineering-knowledgepunching-engineering-knowledgeshearing-engineering-knowledgebending-engineering-knowledgedrawing-engineering-knowledgestretching-engineering-knowledgedeep-drawing-engineering-knowledgespinning-engineering-knowledgeflow-forming-engineering-knowledgethread-rolling-engineering-knowledgegear-cutting-engineering-knowledgebroaching-engineering-knowledgehobbing-engineering-knowledgeshaping-engineering-knowledgeplaning-engineering-knowledgemilling-engineering-knowledgeturning-engineering-knowledgeboring-engineering-knowledgereaming-engineering-knowledgetapping-engineering-knowledgedie-sinking-engineering-knowledgeelectrical-discharge-machining-engineering-knowledgelaser-machining-engineering-knowledgeelectron-beam-machining-engineering-knowledgeion-beam-machining-engineering-knowledgeplasma-machining-engineering-knowledgewater-jet-machining-engineering-knowledgeabrasive-jet-machining-engineering-knowledgeultrasonic-machining-engineering-knowledgechemical-machining-engineering-knowledgephotochemical-machining-engineering-knowledgeelectrochemical-machining-engineering-knowledgeelectrochemical-grinding-engineering-knowledgeelectrochemical-honing-engineering-knowledgeelectrochemical-deburring-engineering-knowledgethermal-spraying-engineering-knowledgecold-spraying-engineering-knowledgeexplosive-cladding-engineering-knowledgefriction-stir-welding-engineering-knowledgediffusion-bonding-engineering-knowledgeexplosive-welding-engineering-knowledgemagnetic-pulse-welding-engineering-knowledgeultrasonic-welding-engineering-knowledgeinertia-friction-welding-engineering-knowledgelinear-friction-welding-engineering-knowledgeorbita-l-friction-welding-engineering-knowledgeradial-friction-welding-engineering-knowledgeangular-friction-welding-engineering-knowledgetorsion-friction-welding-engineering-knowledgeupset-welding-engineering-knowledgeflash-welding-engineering-knowledgeresistance-welding-engineering-knowledgespot-welding-engineering-knowledgeseam-welding-engineering-knowledgeprojection-welding-engineering-knowledgebutt-welding-engineering-knowledgeflash-butt-welding-engineering-knowledgepercussion-welding-engineering-knowledgestud-welding-engineering-knowledgecapacitor-discharge-welding-engineering-knowledgedrawn-arc-welding-engineering-knowledgeshort-cycle-welding-engineering-knowledgegas-welding-engineering-knowledgeoxy-acetylene-welding-engineering-knowledgeoxy-hydrogen-welding-engineering-knowledgeair-acetylene-welding-engineering-knowledgepressure-gas-welding-engineering-knowledgeforge-welding-engineering-knowledgeroll-welding-engineering-knowledgethermit-welding-engineering-knowledgearc-welding-engineering-knowledgeshielded-metal-arc-welding-engineering-knowledgegas-metal-arc-welding-engineering-knowledgeflux-cored-arc-welding-engineering-knowledgesubmerged-arc-welding-engineering-knowledgegas-tungsten-arc-welding-engineering-knowledgeplasma-arc-welding-engineering-knowledgecarbon-arc-welding-engineering-knowledgeatomic-hydrogen-welding-engineering-knowledgeelectroslag-welding-engineering-knowledgeelectrogas-welding-engineering-knowledgelaser-beam-welding-engineering-knowledgeelectron-beam-welding-engineering-knowledgeion-beam-welding-engineering-knowledgeplasma-beam-welding-engineering-knowledgeinduction-welding-engineering-knowledgedielectric-welding-engineering-knowledgeinfrared-welding-engineering-knowledgemicrowave-welding-engineering-knowledgesolar-welding-engineering-knowledgefriction-welding-engineering-knowledgevibration-welding-engineering-knowledgerotation-welding-engineering-knowledgeorbital-welding-engineering-knowledgeradial-welding-engineering-knowledgeangular-welding-engineering-knowledgetorsion-welding-engineering-knowledgeEustala
humpbacked orb-weavers
Eustala is a genus of orb-weaver spiders in the family Araneidae, first described by Eugène Simon in 1895. As of November 2024, the genus contains 87 species distributed primarily across the Americas, from the United States through Central America to South America, with highest diversity in Brazil, Uruguay, and Argentina. Several species have been documented exhibiting specialized ecological relationships, including myrmecophily (living among ants) in Central American species that inhabit ant-defended acacia plants. The genus includes the well-known humpbacked orb-weaver, Eustala anastera, found across North and Central America.
Araneidaeorb-weaverspiderhumpbackedmyrmecophilyant-plant-mutualismNeotropicalNearcticEustala-anasteraEustala-oblongaEustala-illicitaweb-buildingpredatoracaciaPseudomyrmexPanamaBrazilGalápagosSimon-1895arachnologyentomologytropical-ecologycommensalismontogenyballooningoverwinteringjuvenilespider-wasp-preyCaliadurgus-hyalinatushost-parasitoid-interactionsthird-party-exploitationmutualism-exploitationcryptic-colorationnocturnal-foragingdiurnal-hiding-behaviorthorn-defenseorb-web-architecturesawtoothed-webpopulation-ecologysubstrate-selectionspatial-distributionspecies-diversityendemic-speciestaxonomic-revisionnomen-dubiumgenitalic-morphologymicroscopy-identificationtemperate-North-AmericaCentral-AmericaSouth-AmericaCaribbeanPacific-islandsconservation-biologyclimate-change-vulnerabilityphenology-disruptionwinter-activityspring-emergenceforest-understorydry-forestmoist-forestripariangrasslandscrubedge-habitatwoodlandparklandurban-adaptedgeneralist-predatorspecialist-predatorant-alate-predationherbivore-interceptionecosystem-servicebiological-controlnatural-historyfield-identificationcryptic-species-complexsexual-dimorphismwingless-female-mothsballooning-dispersalsilk-productionweb-ontogenyinstar-developmentoverwintering-strategycold-hardinessmetabolic-suppressiondiapausevoltinismunivoltinebivoltinemultivoltineseasonal-polyphenismcolor-morphpattern-polymorphismhabitat-specificityhost-plant-specificityant-colony-integrationalarm-pheromone-avoidancesting-avoidancepredator-avoidancebird-predationlizard-predationwasp-predationassassin-bug-predationstink-bug-predationdefensive-behaviorthanatosiscamouflagemasquerademimicryaggressive-mimicryforaging-ecologyprey-captureweb-maintenanceweb-repairsilk-recyclingenergeticsreproductive-outputfecundityegg-sac-constructionmaternal-caremale-searching-behaviormate-locationpheromone-communicationvibratory-communicationvisual-signalingterritorialityweb-site-fidelityweb-site-tenacitydispersal-behaviorcolonization-abilityrange-expansioninvasive-potentialnon-native-speciesintroduced-speciessynanthropicagricultural-landscapeorchardvineyardforest-plantationconservation-statusdata-deficientIUCNCITESprotected-areanational-parksoberaniachiribiquetegalapagosfloreanaecuadorperuboliviachileargentinauruguayparaguayvenezuelacolombiacosta-ricanicaraguahondurasguatemalabelizemexicousacanadacubahispaniolajamaicapuerto-ricotrinidadtobagobarbadoslesser-antillesgreater-antilleswest-indiescaribbean-basinamazon-basinorinocoparanapantanalcerradocaatingaatlantic-forestpampaschacoyungasvaldivianmagellanicfynbosnoneresearch-modeleducational-resourcecitizen-scienceinaturalistgbifcatalogue-of-lifencbiwikipediazootaxajournal-of-natural-historypsycheentomology-todaybug-ericaraneologychelicerate-biologyarthropod-ecologytropical-biologyneotropical-faunanearctic-faunaholarticpantropicalgondwananbiogeographyphylogeographymolecular-systematicsmorphological-taxonomyintegrative-taxonomyspecies-conceptcryptic-diversityundescribed-speciesnew-species-descriptionredescriptionneotype-designationlectotype-designationtype-localitytype-specimenmuseum-collectionvoucher-specimendna-barcodingcoiitsphylogenomicstranscriptomicsproteomicsmetabolomicsecological-genomicsadaptationlocal-adaptationphenotypic-plasticitycanalizationevolutionary-developmental-biologyevo-devobehavioral-ecologysensory-ecologyvisual-ecologychemical-ecologymechanoreceptionproprioceptionneuroethologyhunting-behaviorweb-building-behaviorconstruction-behaviortool-useextended-phenotypeniche-constructionecosystem-engineeringtrophic-cascadefood-webenergy-flownutrient-cyclingdecompositionpredator-prey-dynamicspopulation-dynamicsmetapopulationsource-sink-dynamicshabitat-fragmentationedge-effectscorridorsconnectivitylandscape-ecologymacroecologybiogeochemistryclimate-envelopespecies-distribution-modelingmaxentbioclimworldclimremote-sensinggisspatial-analysisgeostatisticsabundancedensitybiomassproductivitydiversity-indexrichnessevennessdominancerarityendemismbeta-diversitygamma-diversityalpha-diversityturnovernestednesscommunity-assemblyneutral-theoryniche-theorycompetitionfacilitationapparent-competitionindirect-effectsinteraction-networksmutualismparasitismpredationherbivorydetritivoryscavengingcannibalismintraspecific-competitioninterspecific-competitioncharacter-displacementresource-partitioningniche-differentiationcoexistencestabilityresilienceresistancerecoverysuccessiondisturbanceperturbationextinctioncolonizationinvasionestablishmentspreadimpactrisk-assessmentmanagementcontroleradicationrestorationreintroductionrewildingconservation-breedingex-situin-situprotected-area-networkgap-analysissystematic-conservation-planningprioritizationhotspotcoldspotmajorityminorityflagshipumbrellakeystonefoundationecosystem-engineerindicatorsentinelbioindicatorbiomonitorecosystem-healthenvironmental-qualitypollutionpesticideheavy-metalcontaminantbioaccumulationbiomagnificationtoxicologyriskhazardexposuredose-responseno-observed-effect-concentrationlowest-observed-effect-concentrationmedian-lethal-concentrationmedian-effective-concentrationsafety-factoruncertainty-factorprobabilistic-risk-assessmentlife-cycle-assessmentcarbon-footprintwater-footprintecological-footprintsustainabilitysustainable-developmentgreen-economycircular-economyecosystem-servicesnatural-capitalgreen-infrastructurenature-based-solutionsecological-restorationhabitat-restorationspecies-recoverypopulation-recoverygenetic-rescueoutbreeding-depressioninbreeding-depressiongenetic-diversityheterozygosityeffective-population-sizebottleneckfounder-effectgenetic-driftgene-flowisolation-by-distanceisolation-by-environmentlandscape-geneticsseascape-geneticsconservation-geneticsmolecular-ecologypopulation-geneticsquantitative-geneticsgenomicsepigeneticsreaction-normnorm-of-reactiongenotype-environment-interactionheritabilityselectionnatural-selectionsexual-selectionartificial-selectiondomesticationbreedingcultivarvarietylandracewild-relativecrop-wild-relativegenetic-resourcegermplasmseed-bankfrozen-zoocryopreservationassisted-reproductioncloninggenetic-engineeringsynthetic-biologygene-drivebiocontrolaugmentativeinundativeconservationclassicalnatural-enemyparasitoidpathogennematodefungusbacteriumvirusviroidprionmicrobiomeholobiontmetaorganismsymbiosisendosymbiosisectosymbiosisamensalismneutralismsymbiogenesishorizontal-gene-transfervirulencepathogenicityinfectivitytransmissibilityreservoirvectorhostdefinitive-hostintermediate-hostparatenic-hostaccidental-hostdead-end-hostzoonosisemerging-infectious-diseasepandemicepidemicendemicsporadicoutbreakclusterindex-casecontact-tracingquarantineisolationsocial-distancingmaskingvaccinationherd-immunityreproduction-numberbasic-reproduction-numbereffective-reproduction-numberdoubling-timegeneration-timeserial-intervalincubation-periodlatent-periodinfectious-periodclinical-periodpre-symptomaticasymptomaticpauci-symptomaticmildmoderateseverecriticalfatalcase-fatality-rateinfection-fatality-rateattack-ratesecondary-attack-rateexcess-mortalityyears-of-life-lostdisability-adjusted-life-yearquality-adjusted-life-yearburden-of-diseaseglobal-burden-of-diseaseone-healthplanetary-healthecohealthconservation-medicineveterinary-medicinehuman-medicinecomparative-medicinetranslational-medicineprecision-medicinepersonalized-medicinegenomic-medicineregenerative-medicinestem-celltissue-engineeringorganoidorgan-on-chipmicrophysiological-systemin-silicoin-vitroex-vivoin-vivoanimal-modelnon-human-primaterodentmouseratguinea-pigrabbitdogcatlivestockpoultryaquaculturefisherywild-capturemariculturealgacultureseaweed-farmingintegrated-multi-trophic-aquaculturerecirculating-aquaculture-systemaquaponicshydroponicsaeroponicsvertical-farmingcontrolled-environment-agricultureprecision-agriculturesmart-farmingdigital-agricultureagriculture-4.0internet-of-thingsartificial-intelligencemachine-learningdeep-learningneural-networkcomputer-visiondroneunmanned-aerial-vehiclesatellitegpsgnssgeographic-information-systemdecision-support-systemexpert-systemknowledge-based-systemontologysemantic-weblinked-dataopen-databig-datadata-miningdata-sciencedata-analyticspredictive-analyticsprescriptive-analyticsdescriptive-analyticsdiagnostic-analyticsbusiness-intelligenceartificial-intelligence-ethicsalgorithmic-biasfairnessaccountabilitytransparencyexplainabilityinterpretabilityprivacysecuritysafetyreliabilityrobustnessadaptabilityflexibilityscalabilityefficiencyeffectivenessefficacyperformanceprofitabilitycost-benefitcost-effectivenesseconomic-analysisfinancial-analysisinvestmentreturn-on-investmentnet-present-valueinternal-rate-of-returnpayback-periodbreak-evensensitivity-analysisscenario-analysismonte-carlo-simulationdecision-treereal-optionsgame-theorybehavioral-economicsnudgechoice-architecturedefaultframinganchoringavailability-heuristicrepresentativeness-heuristicaffect-heuristicconfirmation-biasavailability-biasanchoring-biasframing-biasloss-aversionendowment-effectstatus-quo-biassunk-cost-fallacyplanning-fallacyoptimism-biaspessimism-biasoverconfidenceunderconfidencedunning-kruger-effectimposter-syndromestereotypingprejudicediscriminationimplicit-biasexplicit-biasstructural-biassystemic-biasinstitutional-biasinterpersonal-biasintrapersonal-biasunconscious-biasconscious-biasaffinity-biassimilarity-biasin-group-biasout-group-biashalo-effecthorns-effectcontrast-effectrecency-effectprimacy-effectserial-position-effectmere-exposure-effectfamiliarity-principlepropinquity-effectsocial-proofauthorityscarcityreciprocitycommitmentconsistencylikingunityinfluencepersuasioncomplianceconformityobedienceempowermentagencyautonomyself-determinationmotivationintrinsic-motivationextrinsic-motivationself-efficacyself-esteemself-conceptself-identitysocial-identitycollective-identitycultural-identitynational-identitygender-identitysexual-orientationreligionspiritualityvaluesbeliefsattitudesnormscustomstraditionsritualsceremoniescelebrationsfestivalsholidayscommemorationsmemorialsmonumentsheritagelegacyhistoryhistoriographyarchaeologypaleontologyanthropologysociologypsychologycognitive-scienceneurosciencelinguisticsphilosophyethicsmoralityjusticeequityequalityinclusiondiversitybelongingrepresentationparticipationengagementcapacity-buildingskill-developmentknowledge-transfertechnology-transferinnovationinventiondiscoverycreativityimaginationcuriositywonderawebeautyelegancesimplicitycomplexitychaosorderpatternstructurefunctionformprocessdynamicsmechanismcausationcorrelationassociationrelationshipinteractionconnectionnetworksystememergenceself-organizationautopoiesishomeostasisallostasisstressacclimationacclimatizationplasticityfragilityvulnerabilitysensitivityuncertaintyignorancesurprisenoveltyserendipitychanceluckfortunedestinyfatekarmadharmataozenmindfulnessmeditationcontemplationreflectionintrospectionself-awarenessconsciousnesssubconsciousunconsciousdreamsleepcircadianbiological-clockchronobiologyseasonalityphenologymigrationdispersalnomadismsedentismhome-rangehabitat-useresource-selectionforaginghuntinggatheringfarmingherdinghunting-gatheringsubsistencelivelihoodeconomymarkettradeexchangebartercurrencymoneycapitalwealthpovertyinequalitydevelopmentgrowthprogresswell-beinghappinesslife-satisfactionquality-of-lifehuman-developmentsocial-developmenteconomic-developmentmillennium-development-goalssustainable-development-goalsparis-agreementkyoto-protocolmontreal-protocolbasel-conventionstockholm-conventionrotterdam-conventionunfccccbdcmsramsarworld-heritageman-and-biosphereipccipbesencyclopedia-of-lifewikidatawikimediacreative-commonsopen-accessopen-sciencefaire-dataresearch-data-managementdata-stewardshipdata-curationdigital-preservationlong-term-archivingrepositoryarchivelibrarymuseumherbariumcollectionspecimenvouchertypeholotypeparatypesyntypelectotypeneotypeepitypeisolectotypeisoneotypetopotypehomotypeallotypecotypegenotypephenotypeecotypechemotypemorphotypekaryotypeidiogramchromosomegenomeproteometranscriptomemetabolomelipidomeglycomeinteractomeconnectomeepigenomeviromemycobiomebacteriomearchaeomeeukaryomephytobiomerhizobiomeendobiomeectobiomeexo-biomeastrobiomeplanetary-biomeearth-systemclimate-systemocean-systemterrestrial-systemfreshwater-systematmospheric-systemcryospheric-systemanthropospheretechnospherenoospherebiospherehydrospherelithosphereatmospheremagnetosphereheliospherecosmosphereuniversemultiversedimensionspacetimespacetimerelativityquantum-mechanicsstring-theorym-theoryloop-quantum-gravitycosmologyastronomyastrophysicsplanetary-scienceearth-sciencegeologygeophysicsgeochemistrygeomorphologysoil-sciencepedologyedaphologyhydrologylimnologyoceanographymeteorologyclimatologypaleoclimatologystratigraphysedimentologymineralogypetrologyvolcanologyseismologytectonicsplate-tectonicscontinental-driftorogenyepeirogenyisostasyerosionweatheringdepositiontransportsedimentationlithificationdiagenesismetamorphismmeltingcrystallizationigneoussedimentarymetamorphicrock-cyclewater-cyclecarbon-cyclenitrogen-cyclephosphorus-cyclesulfur-cycleoxygen-cyclehydrogen-cyclebiogeochemical-cyclenutrient-cycletrophic-pyramidfood-chainecological-networkinteraction-webmutualistic-networkantagonistic-networkcompetition-networkfacilitation-networkecosystem-functionecosystem-processprovisioning-serviceregulating-servicecultural-servicesupporting-servicehabitat-servicerefugenurserycorridorstepping-stonebuffer-zonecore-areaperipherymatrixpatchlandscapeseascaperiverscapeskyscapesoundscapesmellscapetastescapetouchscapemindscapedreamscapememoryscapeheritagescapefuturescapepossibility-spacescenario-spacedecision-spacepolicy-spacegovernance-spaceinstitutional-spacesocial-spacecultural-spaceeconomic-spacepolitical-spacelegal-spaceethical-spacemoral-spacespiritual-spacesacred-spaceprofane-spaceliminal-spacetransitional-spacethresholdboundaryedgefrontiermargincentercorehinterlandheartlandhomelandmotherlandfatherlandnative-landancestral-landpromised-landwildernesspioneersettlercolonistimmigrantemigrantrefugeeasylum-seekerdisplaced-personstateless-personnomadtravelertouristpilgrimexploreradventurerdiscovererinventorinnovatorcreatormakerbuildercraftsmanartisanartistdesignerarchitectengineerscientistscholaracademicresearcherinvestigatordetectivejournalistreportercorrespondentchroniclerhistorianbiographermemoiristautobiographerdiaristletter-writerpoetnovelistplaywrightscreenwriteressayistcriticreviewereditorpublisherlibrarianarchivistcuratorconservatorrestorerpreservationistconservationistenvironmentalistecologistnaturalistbotanistzoologistentomologistarachnologistherpetologistichthyologistornithologistmammalogistprimatologistanthropologistarchaeologistpaleontologistgeologistgeographercartographersurveyornavigatorexpeditionvoyagejourneytraveltourtripvisitstayresidencehabitationdwellingshelterhomehousebuildingconstructionarchitecturedesignplanblueprintmodelprototypemock-updraftsketchdrawingpaintingsculptureinstallationexhibitiondisplaypresentationdemonstrationshowspectacleeventoccasionceremonyritualcelebrationfestivalfairbazaarcommercebusinessindustrymanufacturingproductionfabricationassemblyprocessingrefiningpurificationsynthesisanalysisseparationextractionidentificationcharacterizationquantificationmeasurementassessmentevaluationappraisalvaluationestimationcalculationcomputationsimulationmodelingpredictionforecastprojectionscenariooutlookprospectexpectationanticipationhopefearworryconcerncareattentionfocusconcentrationawarenessperceptionsensationfeelingemotionaffectmoodtemperamentpersonalitycharacterdispositionattitudeopinionbeliefconvictionfaithtrustconfidencereliancedependenceindependenceself-sufficiencyself-reliancehardinesstoughnessstrengthpowerforceenergyvigorvitalitylifehealthwellnessfitnesssoundnessintegritywholenesscompletenessperfectionexcellencequalitystandardcriterionbenchmarkyardstickmeasuregaugesignsignalsymptommarktokensymbolimageiconemblemlogobrandtrademarkcopyrightpatentintellectual-propertyproprietaryconfidentialsecretclassifiedrestrictedlimitedcontrolledregulatedmanagedgovernedadministeredoperatedmaintainedsustainedsupportedfundedfinancedresourcedstaffedequippedfurnishedsuppliedprovideddelivereddistributedallocatedassigneddesignatedappointedelectedselectedchosenpickedpreferredfavoredlikedlovedadoredcherishedtreasuredvaluedesteemedrespectedhonoredcelebratedcommemoratedrememberedrecalledrecollectedreminiscedreflectedcontemplatedmeditatedponderedconsideredweighedevaluatedjudgedassessedappraisedratedrankedgradedscoredmarkedpointednotedobservednoticedseenviewedlookedwatchedgazedstaredglancedpeekedpeeredscannedsurveyedexaminedinspectedscrutinizedstudiedinvestigatedresearchedanalyzedsynthesizedintegratedcompiledcomposedwrittenauthoredpenneddraftedcreatedproducedmadebuiltconstructedfabricatedmanufacturedassembledput-togetherset-upestablishedfoundedinstitutedorganizedarrangedorderedstructuredsystematizedmethodizedrationalizedstreamlinedoptimizedimprovedenhancedupgradedrefinedpolishedperfectedcompletedfinishedconcludedendedterminatedclosedshutsealedlockedsecuredprotectedguardeddefendedshieldedscreenedcoveredhiddenconcealedmaskedcloakedveiledshroudedwrappedenvelopedsurroundedencircledenclosedcontainedheldkeptretainedpreservedconservedsavedstoredstockpiledhoardedaccumulatedamassedgatheredcollectedaggregatedclusteredgroupedcategorizedsortedleveledtieredlayeredstratifiedhierarchizedpyramidedtreewebmeshgridarrayconfigurationlayoutschemeprogramprojectenterpriseventureundertakingendeavoreffortattempttrytesttrialexperimentinvestigationinquiryqueryquestionproblemissuemattersubjecttopicthememotifleitmotifthreadstrandlinesequenceseriesprogressioncontinuationextensionexpansionenlargementevolutionchangetransformationconversiontransitionshiftalterationmodificationadjustmentaccommodationreconciliationharmonizationsynchronizationcoordinationintegrationunificationcombinationmergerfusionblendmixturecompoundcompositealloyamalgamincorporationassimilationabsorptiondigestionmetabolismcatabolismanabolismequilibriumbalancesteadinessconstancypermanenceendurancepersistencecontinuitydurationlongevitylifespanlifetimeexistencebeingentityobjectthingitemarticlepiecepartportionsegmentsectiondivisioncomponentelementconstituentingredientfactoraspectfacetfeaturecharacteristicpropertyattributetraitindicationevidenceproofverificationvalidationconfirmationcorroborationsubstantiationauthenticationcertificationaccreditationlicensingpermittingauthorizingempoweringenablingallowinglettingtoleratingacceptingreceivingtakinggettingobtainingacquiringgainingearningwinningachievingattainingreachingarrivingcomingapproachingnearingclosingconvergingmeetingjoiningconnectinglinkingbindingtyingfasteningattachingaffixingappendingaddingsupplementingcomplementingcompletingfinishingperfectingconsummatingfulfillingsatisfyinggratifyingpleasingdelightingenjoyingrelishingsavoringappreciatingvaluingprizingtreasuringcherishingnurturingcultivatingfosteringpromotingadvancingfurtheringencouragingsupportingbackingassistingaidinghelpingservingattendingtendingcaringnursinghealingcuringtreatingremedyingcorrectingrectifyingrepairingfixingmendingrestoringrenewingrevivingresuscitatingreanimatingreawakeningrekindlingreignitingrelaunchingrestartingrebootingrefreshingrejuvenatingreinvigoratingreenergizingrechargingrefuelingreplenishingrestockingreplacingsubstitutingexchangingswappingtradingbarteringnegotiatingbargainingdealingtransactingcontractingagreeingconsentingapprovingendorsingsanctioningratifyingconfirmingvalidatingauthenticatingverifyingcheckingtestingexamininginspectingreviewingauditingmonitoringsupervisingoverseeingmanagingdirectingleadingguidingsteeringpilotingnavigatingdrivingpropellingpushingpullingdragginghaulingtowingcarryingbearingtransportingconveyingtransmittingsendingdispatchingshippingdeliveringdistributingdisseminatingspreadingbroadcastingpublishingissuingreleasinglaunchingintroducingpresentingshowingexhibitingdisplayingdemonstratingillustratingexemplifyingtypifyingrepresentingsymbolizingsignifyingmeaningdenotingconnotingimplyingsuggestingindicatingpointingreferringalludinghintingintimatinginsinuatinginferringdeducingconcludingreasoningthinkingcogitatingcerebratingponderingmusingreflectingcontemplatingmeditatingconcentratingfocusinglisteninghearingheedingnotingnoticingobservingwatchinglookingseeingviewingregardingconsideringweighingevaluatingassessingjudgingappraisingestimatingguessingspeculatinghypothesizingtheorizingpostulatingproposingrecommendingadvisingcounselingconsultingconferringdiscussingdebatingarguingdisputingcontestingchallengingopposingresistingdefyingconfrontingfacingencounteringexperiencingundergoingsufferingenduringwithstandingsurvivinglivingexistingsubsistingpersistingperseveringcontinuingremainingstayingabidingresidinginhabitingoccupyingpossessingowningholdingkeepingretainingmaintainingpreservingconservingprotectingguardingdefendingsecuringshelteringharboringentertainingwelcominggreetingsalutinghailingacclaimingapplaudingpraisingcommendinglaudingextollingcelebratinghonoringglorifyingexaltingmagnifyingamplifyingenlargingexpandingextendingstretchingdiffusingdispersingscatteringallocatingassigningallottingapportioningdividingpartitioningseparatingdetachingdisconnectingdisjoiningdisunitingdissociatingdisengagingwithdrawingretreatingrecedingretrogradingreversinginvertingturningrotatingrevolvingspinningtwirlingwhirlingswirlingcirclingorbitingloopingcoilingwindingtwistingbendingcurvingarchingvaultingbridgingspanningcrossingtraversingpassingmovinggoingtravelingjourneyingvoyagingsailingflyingglidingsoaringhoveringfloatingdriftingflowingstreamingpouringrushinggushingspurtingsprayingsplashingsplatteringspatteringunitingcombiningmergingfusingblendingmixingminglinginterminglingintermixingintegratingincorporatingassimilatingabsorbingdigestingmetabolizingtransformingconvertingtransmutingtransfiguringmetamorphosingevolvingdevelopinggrowingmaturingripeningagingdecliningdeterioratingdegeneratingdecayingrottingdecomposingdisintegratingcrumblingcollapsingfallingfailingdyingperishingexpiringdepartingleavingexitingretiringresigningabdicatingrelinquishingsurrenderingyieldingsubmittingsuccumbingcapitulatingacquiescingcomplyingconformingadaptingadjustingaccommodatingreconcilingharmonizingsynchronizingcoordinatingunifyingstandardizingnormalizingregularizingsystematizingmethodizingrationalizingstreamliningsimplifyingclarifyingelucidatingexplaininginterpretingtranslatingrenderingparaphrasingsummarizingabstractingcondensingcompressingshrinkingreducingdecreasingdiminishinglesseningloweringdroppingdescendingsinkingsubmergingdivingplungingplummetingcrashingcollidingimpactinghittingstrikingknockingtappingpattingtouchingsensingperceivingdetectingdiscoveringfindinglocatingpositioningplacingputtingsettinglayingstandingsittinglyingrestingrelaxingreposingsleepingdreamingimaginingfantasizingdaydreamingwoolgatheringprayingworshipingreveringveneratingadoringlovingnourishingfeedingeatingdrinkingconsumingingestingenergizingpoweringfuelingmotivatinginspiringstimulatingexcitingarousingawakeningalertingwarningcautioninginformingnotifyingtellingreportingannouncingdeclaringstatingassertingclaimingcontendingprovingrevealingdisclosingexposinguncoveringunmaskingunveilingopeningunlockingunsealingunfasteninguntyingunbindingunwrappingunpackingunloadingemptyingclearingcleaningwashingbathingshoweringrinsingsoakingsteepingimmersingdrowningsuffocatingchokingstranglingthrottlingsqueezingpressingcenteringaimingtargetingzeroingaligningtuningcalibratingbalancinglevelingequalizingstabilizingsteadymooringdockinglandingtouching-downalightingperchingroostingnestingdenningburrowingtunnelingdiggingexcavatingminingquarryingextractingremovingeliminatingeradicatingexterminatingdestroyingdemolishingruiningwreckingdamagingharminginjuringhurtingwoundingmaimingcripplinglamingdisablingincapacitatingparalyzingstunningshockingsurprisingastonishingamazingastoundingstaggeringstupefyingdazingbewilderingconfusingpuzzlingperplexingbafflingmystifyingenigmaticcrypticobscureabstrusereconditeesotericarcaneoccultmysteriousunknownunfamiliarstrangeoddpeculiarcuriousqueerweirdbizarrefantasticextraordinaryremarkablenotablenoteworthysignificantimportantmomentousconsequentialweightygraveseriouscrucialvitalessentialnecessaryrequiredneededwanteddesiredwishedhopedexpectedanticipatedawaitedlooked-forsearched-forsoughthuntedpursuedchasedtrackedtrailedfollowedshadowedstalkedcreptcrawledclimbedscaledascendedmountedroseliftedelevatedraisedhoistedheavedhauledpulledtuggeddraggeddrawnattractedluredenticedtemptedseducedcharmedenchantedfascinatedcaptivatedengrossedabsorbedimmersedinvolvedengagedoccupiedbusyactiveenergeticdynamicvigorousforcefulpowerfulstrongmightypotenteffectiveefficientproductivefruitfulfertilefecundprolificabundantplentifulamplesufficientadequateenoughsatisfactoryacceptabletolerablebearableendurablesustainablemaintainablemanageablecontrollablegovernablerulegovernreigndominatecommanddirectleadguidesteerpilotnavigatedrivepropelpushthrustshovepresssqueezecompresscondenseconcentrateaimpointtargetzeroalignadjusttunecalibratelevelequalizestandardizenormalizestabilizefixsecureanchormoordocklandtouch-downalightperchroostnestdenburrowtunneldigexcavateminequarryextractremoveeliminateeradicateexterminatedestroydemolishruinwreckdamageharminjurehurtwoundmaimcripplelamedisableincapacitateparalyzestunshockastonishamazeastoundstaggerstupefydazebewilderconfusepuzzleperplexbafflemystifyenigmaLeptoglossus
leaf-footed bugs
Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.
Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteran