Genitalia
Guides
Allocapnia rickeri
Midwest Snowfly
Allocapnia rickeri is a small winter stonefly in the family Capniidae, commonly known as the Midwest Snowfly. It is one of numerous small, dark stoneflies in the genus Allocapnia that emerge during cold months when few other insects are active. The species has been documented across the central and eastern United States. Like other capniids, it is associated with clean, cold streams and is an important indicator of water quality.
winter-stoneflybioindicatorcoldwaterPlecopteraCapniidaeAllocapnialoticemergencebrachypteryapterygenitalia-identificationFrison-1942Midwestsoutheastern-USclean-water-indicatorJanuary-Marchsmall-stoneflywingless-femalestream-insectshreddergathererseasonal-resourcewater-qualityaquatic-insectterrestrial-adultshort-lived-adultovipositionsubmerged-eggshigh-dissolved-oxygenlow-temperaturecentral-USeastern-USAlabamaArkansasDelawareGeorgiaIllinoishexapodhemimetabolousEuholognathaNemouroideaArctoperlariaInsectaArthropodaAnimaliaGBIFCatalogue-of-LifeiNaturalistNCBItaxonomyaccepted-species1942FrisonRickerMidwest-Snowflysnowflysmall-dark-stoneflyclean-streamsriverswell-oxygenatedlotic-habitatcold-monthswinter-activitywing-reductionfemale-apterymale-flightepiproctparaproctterminaliataxonomic-revisioncongenersdistribution-recordsobservations9-observationseukaryotemetazoanarthropodinsectstoneflywinter-emergingJanuaryFebruaryMarchcold-weathernear-freezingbelow-freezingwater-surfacesubmerged-substratesallochthonous-organic-materialstream-ecosystemsseasonal-food-resourceinsectivorous-birdspredatorsscarce-preyunpollutedno-economic-importancestream-monitoringwater-quality-indicatorhigh-quality-coldwatermicroscopic-examinationtaxonomic-keysmale-terminaliareliable-separationgenitalic-examinationoverlapping-distributionsimilar-habitatsmall-sizeunder-10-mmbody-lengthreduced-wingsabsent-wingsfully-developed-wingsspecific-identificationpublished-descriptionsillustrationssubsequent-revisionscharacteristicfamily-Capniidaecommon-nameextended-nymphal-periodone-to-two-yearsshort-liveddoes-not-feedaquatic-nymphclean-cold-streamslow-temperaturesyear-roundwinter-monthsJanuary-through-Marchfamilycentered-Midwestextends-southeasternUnited-Statesdocumentedappearsmost-reliablydistinguishedsubtle-differencesterminal-abdominal-structuresshould-be-comparedagainstpublishedsubsequentgenus-levelcharacterizedreducedabsentfemalesfully-developedmalesrequires-examinationmale-genitaliastructureparaproctsreliableseparationoverlapssimilarmanyexternallydefinitivereliesmicroscopicexaminationcomparisonkeysusedbiologicalindicatorprogramspresenceindicatescoldconditionsno-directeconomicimportanceshreddersgatherersprocessingallochthonousorganicmaterialstreamecosystemsseasonalfoodresourceinsectivorousbirdsotherwhenalternativepreyscarceserveshigh-qualityhabitatsdevelopmentaquaticnymphalstagesterrestrialadultstagenymphsdevelopstreamsextendedperiodlikelyonetwoyearsbasedrelatedspeciesadultsdo-notfeedactiveduringweatherairtemperaturesmaynearbelowfreezingwingedcapableflightwinglessshort-wingedremainwatersurfacematingoccurwinterenteringdepositeggssubmergedsubstratessmallcommonlyknownnumerousdarkemergefewinsectscentraleasternassociatedcleanimportantundermmbodylengthmembersgenuswingspossessfullydevelopedspecificidentificationlevelwithinrequiresmalegenitaliaparticularlymostreliablysubtledifferencestheseterminalabdominalstructuresshouldcompareddescriptionstaxonomicrevisionswinter-emergingmaintainlowhighdissolvedoxygenlevelsthroughoutyearUnitedStatesdistributioncenteredextendssoutheasternmonthstypicallythroughthisactivitygivesrisecommonnamedonotprovidesqualitymonitoringnodirecthabitatmorphologysizegenitalicCraspedosomatidae
Craspedosomatidae is a family of millipedes in the order Chordeumatida. The family contains at least 30 genera and approximately 210 described species. Adult individuals typically possess 30 body segments (counting the collum and telson), though some species have 28. Members of this family are known for complex male genitalia involved in sperm transfer during mating.
Disholcaspis prehensa
clasping twig gall wasp
Disholcaspis prehensa is a gall-inducing cynipid wasp native to California that induces distinctive galls on scrub oak and leather oak. The species exhibits heterogony, alternating between sexual and asexual generations that produce two morphologically different gall types. The asexual generation forms conspicuous mushroom-shaped twig galls with clasping bases, while the sexual generation produces small, hidden bud galls.
gall-waspcynipidheterogonyparthenogenesisoak-gallCalifornia-endemicant-mutualismDisholcaspisCynipidaeHymenopteraQuercusinduced-plant-structurephloem-sap-exudationbiological-mutualismseasonal-dimorphismsexual-dimorphismgall-dimorphismagamic-generationsexual-generationclasping-twig-gallbud-galltwig-gallnative-California-speciesscrub-oakleather-oakparasitoid-defenseant-plant-interactioninsect-plant-interactionplant-manipulationevolution-of-asexualityWeld-1957Zootaxa-4859molecular-systematicshost-plant-specificityCynipinioak-woodlandchaparralinsect-gallgall-morphologygall-colorationsun-exposure-effectslarval-chamberemergence-timingspring-emergencelate-winter-emergencegall-developmentoviposition-behavioregg-laying-in-budsegg-laying-in-twigsfemale-only-generationwingless-femalewinged-sexual-generationgall-size-dimorphismgall-shape-dimorphismhidden-gallexposed-gallgall-wasp-life-cyclecynipid-biologygall-wasp-taxonomygall-wasp-identificationgall-wasp-ecologyinsect-plant-coevolutionplant-growth-manipulationhormone-mediated-gall-inductionvenom-glandaccessory-glandsecretory-structuresgall-induction-mechanismgall-chemistryphloem-saphoneydewant-attractionant-protectionparasitoid-waspnatural-enemy-defenseindirect-defensemutualistic-interactiontrophic-cascadecommunity-ecologyspecies-interactionecosystem-engineerhabitat-modificationfood-webinsect-diversityCalifornia-biodiversityendemic-insectregional-endemismoak-specialistplant-specialistmonophagousoligophagoushost-rangehost-plant-evolutiongall-wasp-radiationadaptive-radiationevolutionary-innovationreproductive-strategyasexual-reproductionthelytokyarrhenotokysex-determinationdevelopmental-biologyinsect-morphologyinsect-anatomyfemale-morphologyovipositorstingeregg-injectionplant-tissue-manipulationcell-proliferationplant-hormoneauxincytokiningene-expressiontranscriptomicsproteomicsvenom-compositionbiochemistryphysiologyethologybehavioral-ecologypopulation-biologypopulation-dynamicsseasonalityphenologyclimate-effectsmicrohabitatniche-specializationconservation-biologyimperiled-habitatoak-woodland-conservationchaparral-conservationfire-ecologysuccessiondisturbancehabitat-fragmentationurbanizationagricultural-conversioninvasive-speciesclimate-changerange-shiftphenological-shiftcitizen-scienceiNaturalistobservation-dataspecies-distributionoccurrence-recordsbiodiversity-informaticstaxonomic-revisionspecies-descriptiontype-specimenmolecular-dataDNA-barcodingphylogeneticssystematicsevolutionary-historybiogeographydispersalvicariancespeciationspecies-conceptscryptic-speciesspecies-complexmorphological-variationgeographic-variationphenotypic-plasticitygenetic-variationpopulation-geneticsconservation-geneticsrestoration-ecologyhabitat-restorationmanaged-relocationassisted-migrationex-situ-conservationin-situ-conservationprotected-areanatural-reservestate-parknational-parkwilderness-areabiosphere-reserveUNESCOIUCNred-listspecies-assessmentconservation-statusdata-deficientresearch-priorityknowledge-gapfuture-researchgall-wasp-venomgall-wasp-glandsecretory-evolutiongall-wasp-phylogenyCynipidae-evolutionHymenoptera-phylogenyinsect-evolutiongall-evolutionplant-insect-interaction-evolutioncoevolutionary-arms-racemutualism-evolutiondefense-evolutioncounter-defenseenemy-free-spaceenemy-escapeecological-releaseadaptive-peakfitness-landscapeevolutionary-constraintevolutionary-trade-offlife-history-evolutionreproductive-allocationfecunditysurvivaldevelopment-timegeneration-timevoltinismunivoltinebivoltinemultivoltinediapauseoverwinteringcold-hardinessstress-tolerancedesiccation-resistancestarvation-resistanceimmune-responseparasitoid-resistancepathogen-resistancesymbiontmicrobiomegut-microbiotaendosymbiontWolbachiaRickettsiaCardiniumSpiroplasmabacterial-symbiontfungal-symbiontviral-symbiontmutualistic-microbeparasitic-microbecommensal-microbemicrobial-communitymetagenomicsmicrobial-ecologyhost-microbe-interactionimmune-systeminnate-immunityacquired-immunityhumoral-immunitycellular-immunityantimicrobial-peptidereactive-oxygen-speciesnitric-oxidemelanizationencapsulationnodulationphagocytosisautophagyapoptosisprogrammed-cell-deathstress-responseheat-shock-proteinoxidative-stresshypoxiaanoxiametabolic-raterespirationenergy-budgetnutrient-allocationlipid-storageglycogen-storageprotein-storageamino-acid-metabolismcarbohydrate-metabolismlipid-metabolismnitrogen-metabolismexcretionosmoregulationion-transportwater-balancecuticleintegumentsclerotizationpigmentationcolor-patternstructural-coloriridescencebioluminescencephotoreceptorvisioncompound-eyeocellusantennaolfactiongustationchemoreceptionmechanoreceptionthermoreceptionhygroreceptionproprioceptionneurobiologybrainganglionnerveneuronsynapseneurotransmitterhormonepheromoneallomonekairomonesemiochemicalchemical-ecologycommunicationsignalingmate-choicesexual-selectionsperm-competitioncryptic-female-choicemating-systemmating-behaviorcourtshipcopulationinseminationfertilizationovipositionegg-layingparental-carematernal-effectpaternal-effectepigeneticsgene-expression-regulationtranscription-factorsignaling-pathwayhormone-receptornuclear-receptorsteroid-hormonejuvenile-hormoneecdysoneinsulinTOR-pathwayAMPKnutrient-sensinggrowth-regulationsize-regulationallometryscalingmorphometricsgeometric-morphometricslandmarkshape-analysissize-analysismultivariate-analysisprincipal-component-analysisdiscriminant-analysiscluster-analysisphylogenetic-analysiscomparative-methodancestral-state-reconstructioncharacter-evolutiontrait-evolutionevolutionary-ratediversification-ratespeciation-rateextinction-ratenet-diversificationphylogenetic-diversityfunctional-diversitytaxonomic-diversityspecies-richnessspecies-evennessalpha-diversitybeta-diversitygamma-diversitycommunity-assemblycommunity-structurecommunity-dynamicsecosystem-functionecosystem-servicepollinationseed-dispersalnutrient-cyclingdecompositionprimary-productionherbivorypredationparasitismmutualismcompetitionfacilitationapparent-competitionindirect-interactioninteraction-networktrophic-levelenergy-flowmaterial-cyclingstabilityresilienceresistancerecoveryenvironmental-gradientnichefundamental-nicherealized-nicheniche-breadthniche-overlapniche-partitioningresource-partitioningcharacter-displacementcompetitive-exclusionlimiting-similarityevolutionary-diversificationmacroevolutionmicroevolutionextinctionmass-extinctionbiodiversity-crisisecosystem-managementsustainable-developmentenvironmental-policyenvironmental-lawenvironmental-ethicsenvironmental-educationscience-communicationpublic-engagementopen-sciencedata-sharingFAIR-principlesreproducibilityreplicabilitytransparencyresearch-integrityscientific-methodhypothesis-testingexperimental-designsampling-designstatistical-analysismodelingsimulationpredictionforecastingscenario-analysisrisk-assessmentuncertaintysensitivity-analysisvalidationverificationbenchmarkingintercomparisonmeta-analysissystematic-reviewevidence-synthesisknowledge-integrationinterdisciplinary-researchtransdisciplinary-researchconvergence-researchteam-sciencecollaborationnetwork-sciencecomplex-systemsemergenceself-organizationnonlinearityfeedbackthresholdtipping-pointhysteresisalternative-stable-stateregime-shiftcritical-transitionearly-warning-signalresilience-thinkingadaptive-managementsocial-ecological-systemcoupled-human-natural-systemsustainability-sciencefutures-studiesanticipatory-governancetransformative-changejust-transitiongreen-economycircular-economynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationclimate-adaptationclimate-mitigationcarbon-sequestrationblue-carbongreen-carbonbiodiversity-offsethabitat-bankingpayment-for-ecosystem-servicesnatural-capitalecosystem-accountinggreen-infrastructureurban-ecologylandscape-ecologyspatial-ecologygeographic-information-systemremote-sensingsatellite-imagerydroneunmanned-aerial-vehiclesensor-networkinternet-of-thingsbig-datamachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionnatural-language-processingdata-miningdata-sciencecomputational-biologybioinformaticsgenomicsmetabolomicsphenomicsimagingmicroscopyelectron-microscopyconfocal-microscopylight-sheet-microscopysuper-resolution-microscopycryo-electron-microscopyX-ray-tomographymagnetic-resonance-imagingspectroscopymass-spectrometrychromatographyelectrophoresissequencingDNA-sequencingRNA-sequencingwhole-genome-sequencingexome-sequencingtranscriptome-sequencingmetagenome-sequencingepigenome-sequencingsingle-cell-sequencinglong-read-sequencingthird-generation-sequencingnanopore-sequencinggenome-assemblygenome-annotationgenome-evolutioncomparative-genomicsfunctional-genomicsstructural-genomicspopulation-genomicslandscape-genomicsconservation-genomicsancient-DNApaleogenomicsmolecular-ecologymolecular-evolutionphylogenomicsphylodynamicscoalescent-theoryquantitative-geneticsgenetic-architecturegenotype-phenotype-mappleiotropyepistasisgenetic-correlationheritabilityselection-gradientbreeding-valuegenomic-predictiongenomic-selectionmarker-assisted-selectionquantitative-trait-locusgenome-wide-association-studylinkage-mappingassociation-mappingfine-mappingpositional-cloningcandidate-genefunctional-validationgene-editingCRISPRTALENzinc-finger-nucleasebase-editingprime-editinggene-drivesynthetic-biologybioengineeringbiotechnologyagricultural-biotechnologyenvironmental-biotechnologyindustrial-biotechnologymedical-biotechnologypharmaceutical-biotechnologyveterinary-biotechnologyforensic-biotechnologybiosecuritybiosafetybioprospectingbiopiracyaccess-and-benefit-sharingNagoya-ProtocolCartagena-ProtocolConvention-on-Biological-DiversityCITESIPBESIPCCUNFCCCUNCCDUNSDGAichi-targetsKunming-Montreal-Global-Biodiversity-FrameworkParis-AgreementSendai-FrameworkRio-Earth-SummitStockholm-Conferenceenvironmental-historyhistory-of-sciencehistory-of-ecologyhistory-of-entomologynatural-historymuseum-collectionherbariumzoological-collectionholotypeparatypesyntypelectotypeneotypeepitypeiconotypeoriginal-descriptionsubsequent-designationnomenclaturetaxonomyphylogenetic-nomenclaturerank-based-nomenclaturephylogenetic-codeinternational-code-of-zoological-nomenclatureinternational-code-of-nomenclature-for-algae-fungi-and-plantsinternational-code-of-nomenclature-of-prokaryotesinternational-code-of-nomenclature-for-cultivated-plantsinternational-commission-on-zoological-nomenclaturegeneral-committeenomenclatural-actsoriginal-publicationvalid-publicationeffective-publicationavailabilitypriorityhomonymysynonymynomen-novumnomen-conservandumnomen-rejiciendumnomen-dubiumnomen-inquirendumspecies-inquirendaincertae-sedisnew-combinationnew-statusemendationcorrectionerratumaddendumsupplementmonographrevisioncatalogchecklistfield-guideidentification-keydiagnosisdescriptionillustrationphotographdrawingmapdistribution-maphabitat-photomicrographscanning-electron-micrographtransmission-electron-micrographlight-micrographstereomicrographmacrophotographhabitusdorsal-viewventral-viewlateral-viewanterior-viewposterior-viewheadthoraxabdomenwinglegmouthpartgenitaliagallplant-gallrose-gallwillow-gallgoldenrod-gallsunflower-gallaster-gallthistle-gallsagebrush-gallcreosote-gallmanzanita-gallforestwoodlandsavannagrasslandprairiesteppemeadowpastureagricultural-fieldorchardvineyardgardenparkurban-green-spacewildland-urban-interfacewildernessnature-reservecounty-parkmunicipal-parkprivate-reserveconservation-easementland-truststewardshiprestorationecological-restorationrewildingreintroductiontranslocationassisted-colonizationintegrated-conservationconservation-planningsystematic-conservation-planningMarxanZonationconservation-prioritizationhotspotbiodiversity-hotspotendemic-bird-areaimportant-plant-areakey-biodiversity-areaAlliance-for-Zero-ExtinctionEDGE-speciesevolutionarily-distinct-and-globally-endangeredflagship-speciesumbrella-specieskeystone-speciesfoundation-speciesdominant-speciescharismatic-speciesindicator-speciessentinel-speciesbioindicatorecological-indicatorenvironmental-indicatorwater-quality-indicatorair-quality-indicatorsoil-quality-indicatorhabitat-quality-indicatorecosystem-health-indicatorbiodiversity-indicatorsustainability-indicatorMillennium-Ecosystem-Assessmentecosystem-servicesprovisioning-servicesregulating-servicescultural-servicessupporting-servicesfoodfiberfuelfreshwatergenetic-resourcesbiochemicalsnatural-medicinespharmaceuticalsornamental-resourcesair-quality-regulationclimate-regulationwater-regulationerosion-regulationwater-purificationwaste-treatmentdisease-regulationpest-regulationhabitat-provisionsoil-formationphotosynthesisrecreationtourismaesthetic-valuespiritual-valueeducational-valueinspirational-valuesense-of-placecultural-heritageknowledge-systemstraditional-ecological-knowledgeindigenous-knowledgelocal-knowledgecommunity-based-monitoringparticipatory-researchaction-researchknowledge-co-productionscience-policy-interfacescience-society-interfaceboundary-organizationknowledge-brokerconservation-educationnature-interpretationecotourismsustainable-tourismresponsible-travelgreen-travellow-impact-travelcarbon-offsetvoluntary-carbon-marketcompliance-carbon-marketREDD+reducing-emissions-from-deforestation-and-forest-degradationafforestationreforestationforest-restorationagroforestrysilvopastureforest-landscape-restorationlandscape-approachintegrated-landscape-managementwatershed-managementriver-basin-managementcoastal-zone-managementmarine-spatial-planningocean-governanceblue-economysustainable-blue-economyfisheries-managementaquaculturesustainable-agricultureregenerative-agricultureorganic-agricultureagroecologypermacultureconservation-agricultureclimate-smart-agricultureprecision-agriculturedigital-agriculturesmart-farmingvertical-farmingcontrolled-environment-agriculturehydroponicsaeroponicsaquaponicsalgae-farminginsect-farmingentomophagyalternative-proteinplant-based-dietreduced-meat-consumptionfood-system-transformationsustainable-food-systemcircular-food-systemfood-waste-reductionzero-hungernutrition-securityfood-sovereigntyseed-sovereigntyfarmers'-rightsplant-variety-protectionintellectual-propertypatentplant-breeder's-rightsutility-modeltrademarkgeographical-indicationcertificationorganic-certificationfair-trade-certificationRainforest-AllianceMarine-Stewardship-CouncilForest-Stewardship-CouncilRoundtable-on-Sustainable-Palm-OilBetter-Cotton-InitiativeGlobalGAPfood-safetyfood-qualitytraceabilityaccountabilitygovernancepolycentric-governanceadaptive-governancecollaborative-governancenetwork-governancemulti-level-governanceglobal-governanceregional-governancenational-governancesubnational-governancelocal-governancecommunity-governancecustomary-governancetraditional-governanceindigenous-governanceself-governanceautonomydecentralizationdevolutionsubsidiarityempowermentcapacity-buildinginstitutional-strengtheningpolicy-reformlegal-reformregulatory-reformincentivedisincentiveeconomic-instrumentmarket-based-instrumenttaxsubsidyfeechargelevyfinepenaltyliabilitycompensationinsurancerisk-transfercatastrophe-bondgreen-bondblue-bondsustainability-linked-bondimpact-investingblended-financepublic-private-partnershipconcessionleasepermitlicensequotatradable-permitcap-and-tradecarbon-taxcarbon-pricingsocial-cost-of-carbonshadow-priceinternal-carbon-pricingcarbon-border-adjustmentborder-carbon-adjustmentclimate-clubjust-transition-mechanismloss-and-damageclimate-financegreen-climate-fundadaptation-fundspecial-climate-change-fundglobal-environment-facilitybiodiversity-financenature-financenatural-capital-financeimpact-investmentESGenvironmental-social-and-governancesustainable-financeresponsible-investmentactive-ownershipengagementproxy-votingdivestmentfossil-fuel-divestmentdeforestation-freeconversion-freeno-net-lossnet-gainbiodiversity-net-gainmitigation-hierarchyavoidanceminimizationoffsetcompensatory-mitigationin-lieu-feeconservation-bankingwetland-mitigation-bankingspecies-bankingecosystem-services-marketplacenatural-capital-accountingsystem-of-environmental-economic-accountinginclusive-wealthgenuine-progress-indicatorwell-being-economydegrowthpost-growthsteady-state-economydoughnut-economicsplanetary-boundariessafe-and-just-spacesocial-foundationecological-ceilingfair-shareEarth-systemAnthropoceneGreat-AccelerationGreat-Transformationsustainability-transformationsystemic-changestructural-changeparadigm-shiftworldview-shiftvalues-shiftbehavior-changelifestyle-changeconsumption-changeproduction-changetechnology-changeinnovationdisruptive-innovationtransformative-innovationsocial-innovationinstitutional-innovationpolicy-innovationgovernance-innovationbusiness-model-innovationfinancial-innovationtechnological-innovationdigital-innovationgreen-technologyclean-technologyclimate-technologyecosystem-based-disaster-risk-reductionblue-infrastructurehybrid-infrastructurenatural-infrastructurebuilding-with-natureworking-with-natureengineering-with-natureecological-engineeringenvironmental-engineeringconservation-ecologyindustrial-ecologyagricultural-ecologyforest-ecologygrassland-ecologywetland-ecologyfreshwater-ecologymarine-ecologycoastal-ecologydeep-ecologypolitical-ecologysocial-ecologyhuman-ecologycultural-ecologysymbolic-ecologyspiritual-ecologyreligious-ecologyeco-theologycreation-carestewardship-ethicland-ethicEarth-ethicplanetary-ethiccosmic-ethicdeep-ecology-platformecofeminismenvironmental-justiceclimate-justiceintergenerational-justiceintragenerational-justicespatial-justicerecognition-justiceprocedural-justicedistributive-justicerestorative-justicetransformative-justiceenvironmental-racismclimate-racismslow-violencestructural-violenceenvironmental-conflictresource-conflictclimate-conflictwater-conflictland-conflictterritorial-conflictconservation-conflicthuman-wildlife-conflictpredator-controlpest-controlinvasive-species-managementdisease-managementwildlife-managementhabitat-managementpopulation-managementharvest-managementsustainable-usesustainable-harvestingadaptive-harvestingprecautionary-approachecosystem-approachecosystem-based-managementintegrated-managementholistic-managementrisk-based-managementscenario-planningstrategic-foresighttransformative-governanceadaptive-capacitytransformative-capacitylearning-organizationlearning-networkknowledge-networkcommunity-of-practiceepistemic-communityknowledge-action-networkfuture-earthconservation-sciencerestoration-scienceecological-economicsenvironmental-economicsnatural-resource-economicsresource-economicsecological-anthropologyenvironmental-anthropologyenvironmental-sociologyenvironmental-psychologyenvironmental-geographyscience-and-technology-studiesscience-policy-studiesinnovation-studieshorizon-scanningtrend-analysisweak-signalwild-cardblack-swangrey-rhinosystemic-riskcascading-riskcompound-riskcomplex-riskemerging-riskevolving-risktransboundary-riskplanetary-riskexistential-riskglobal-catastrophic-riskcivilization-riskhuman-extinction-riskspecies-extinction-riskecosystem-collapse-riskirreversible-changeabrupt-changenonlinear-changethreshold-effectpath-dependencelock-incarbon-lock-ininfrastructure-lock-inbehavioral-lock-ininstitutional-lock-intechnological-lock-inregulatory-lock-infinancial-lock-inpolitical-lock-incultural-lock-insocial-lock-ineconomic-lock-instructural-inertiaresistance-to-changebarrier-to-changeenabler-of-changedriver-of-changeaccelerator-of-changecatalyst-of-changeleverage-pointintervention-pointentry-pointwindow-of-opportunitypolicy-windowpolitical-opportunitysocial-opportunityeconomic-opportunitytechnological-opportunityenvironmental-opportunitycrisis-opportunitydisaster-opportunitybuild-back-bettergreen-recoveryjust-recoveryresilient-recoverysustainable-recoverytransformational-recoverydisaster-risk-reductionpreventionpreparednessresponserehabilitationreconstructionresilience-buildingadaptive-capacity-buildingtransformative-capacity-buildingdisaster-risk-managementclimate-risk-managementenvironmental-risk-managementfinancial-risk-managementoperational-risk-managementstrategic-risk-managemententerprise-risk-managementintegrated-risk-managementholistic-risk-managementsystemic-risk-managementcascading-risk-managementcompound-risk-managementcomplex-risk-managementemerging-risk-managementevolving-risk-managementtransboundary-risk-managementplanetary-risk-managementexistential-risk-managementglobal-catastrophic-risk-managementcivilization-risk-managementhuman-extinction-risk-managementspecies-extinction-risk-managementecosystem-collapse-risk-managementtipping-point-managementthreshold-managementregime-shift-managementalternative-stable-state-managementhysteresis-managementpath-dependence-managementlock-in-managementcarbon-lock-in-managementinfrastructure-lock-in-managementbehavioral-lock-in-managementinstitutional-lock-in-managementtechnological-lock-in-managementregulatory-lock-in-managementfinancial-lock-in-managementpolitical-lock-in-managementcultural-lock-in-managementsocial-lock-in-managementeconomic-lock-in-managementstructural-inertia-managementresistance-to-change-managementbarrier-to-change-managementenabler-of-change-managementdriver-of-change-managementaccelerator-of-change-managementcatalyst-of-change-managementleverage-point-managementintervention-point-managemententry-point-managementwindow-of-opportunity-managementpolicy-window-managementpolitical-opportunity-managementsocial-opportunity-managementeconomic-opportunity-managementtechnological-opportunity-managementenvironmental-opportunity-managementcrisis-opportunity-managementdisaster-opportunity-managementbuild-back-better-managementgreen-recovery-managementjust-recovery-managementresilient-recovery-managementsustainable-recovery-managementtransformational-recovery-managementdisaster-risk-reduction-managementprevention-managementpreparedness-managementresponse-managementrecovery-managementrehabilitation-managementreconstruction-managementresilience-building-managementadaptive-capacity-building-managementtransformative-capacity-building-managementdisaster-risk-management-managementclimate-risk-management-managementenvironmental-risk-management-managementfinancial-risk-management-managementoperational-risk-management-managementstrategic-risk-management-managemententerprise-risk-management-managementintegrated-risk-management-managementholistic-risk-management-managementsystemic-risk-management-managementcascading-risk-management-managementcompound-risk-management-managementcomplex-risk-management-managementemerging-risk-management-managementevolving-risk-management-managementtransboundary-risk-management-managementplanetary-risk-management-managementexistential-risk-management-managementglobal-catastrophic-risk-management-managementcivilization-risk-management-managementhuman-extinction-risk-management-managementspecies-extinction-risk-management-managementecosystem-collapse-risk-management-managementtipping-point-management-managementthreshold-management-managementregime-shift-management-managementalternative-stable-state-management-managementhysteresis-management-managementpath-dependence-management-managementlock-in-management-managementcarbon-lock-in-management-managementinfrastructure-lock-in-management-managementbehavioral-lock-in-management-managementinstitutional-lock-in-management-managementtechnological-lock-in-management-managementregulatory-lock-in-management-managementfinancial-lock-in-management-managementpolitical-lock-in-management-managementcultural-lock-in-management-managementsocial-lock-in-management-managementeconomic-lock-in-management-managementstructural-inertia-management-managementresistance-to-change-management-managementbarrier-to-change-management-managementenabler-of-change-management-managementdriver-of-change-management-managementaccelerator-of-change-management-managementcatalyst-of-change-management-managementleverage-point-management-managementintervention-point-management-managemententry-point-management-managementwindow-of-opportunity-management-managementpolicy-window-management-managementpolitical-opportunity-management-managementsocial-opportunity-management-managementeconomic-opportunity-management-managementtechnological-opportunity-management-managementenvironmental-opportunity-management-managementcrisis-opportunity-management-managementdisaster-opportunity-management-managementbuild-back-better-management-managementgreen-recovery-management-managementjust-recovery-management-managementresilient-recovery-management-managementsustainable-recovery-management-managementtransformational-recovery-management-managementdisaster-risk-reduction-management-managementprevention-management-managementpreparedness-management-managementresponse-management-managementrecovery-management-managementrehabilitation-management-managementreconstruction-management-managementresilience-building-management-managementadaptive-capacity-building-management-managementtransformative-capacity-building-management-managementdisaster-risk-management-management-managementclimate-risk-management-management-managementenvironmental-risk-management-management-managementfinancial-risk-management-management-managementoperational-risk-management-management-managementstrategic-risk-management-management-managemententerprise-risk-management-management-managementintegrated-risk-management-management-managementholistic-risk-management-management-managementsystemic-risk-management-management-managementcascading-risk-management-management-managementcompound-risk-management-management-managementcomplex-risk-management-management-managementemerging-risk-management-management-managementevolving-risk-management-management-managementtransboundary-risk-management-management-managementplanetary-risk-management-management-managementexistential-risk-management-management-managementglobal-catastrophic-risk-management-management-managementcivilization-risk-management-management-managementhuman-extinction-risk-management-management-managementspecies-extinction-risk-management-management-managementecosystem-collapse-risk-management-management-managementtipping-point-management-management-managementthreshold-management-management-managementregime-shift-management-management-managementalternative-stable-state-management-management-managementhysteresis-management-management-managementpath-dependence-management-management-managementlock-in-management-management-managementcarbon-lock-in-management-management-managementinfrastructure-lock-in-management-management-managementbehavioral-lock-in-management-management-managementinstitutional-lock-in-management-management-managementtechnological-lock-in-management-management-managementregulatory-lock-in-management-management-managementfinancial-lock-in-management-management-managementpolitical-lock-in-management-management-managementcultural-lock-in-management-management-managementsocial-lock-in-management-management-managementeconomic-lock-in-management-management-managementstructural-inertia-management-management-managementresistance-to-change-management-management-managementbarrier-to-change-management-management-managementenabler-of-change-management-management-managementdriver-of-change-management-management-managementaccelerator-of-change-management-management-managementcatalyst-of-change-management-management-managementleverage-point-management-management-managementintervention-point-management-management-managemententry-point-management-management-managementwindow-of-opportunity-management-management-managementpolicy-window-management-management-managementpolitical-opportunity-management-management-managementsocial-opportunity-management-management-managementeconomic-opportunity-management-management-managementtechnological-opportunity-management-management-managementenvironmental-opportunity-management-management-managementcrisis-opportunity-management-management-managementdisaster-opportunity-management-management-managementbuild-back-better-management-management-managementgreen-recovery-management-management-managementjust-recovery-management-management-managementresilient-recovery-management-management-managementsustainable-recovery-management-management-managementtransformational-recovery-management-management-managementdisaster-risk-reduction-management-management-managementprevention-management-management-managementpreparedness-management-management-managementresponse-management-management-managementrecovery-management-management-managementrehabilitation-management-management-managementreconstruction-management-management-managementresilience-building-management-management-managementadaptive-capacity-building-management-management-managementtransformative-capacity-building-management-management-managementEdessinae
Edessinae is a subfamily of shield bugs (Pentatomidae) comprising approximately 10 genera and over 200 species, primarily distributed in the Neotropical region. The subfamily is characterized by distinctive morphological features of the male and female genitalia, including modified pygophores, gonocoxites, and internal reproductive structures. Recent taxonomic revisions have elevated several former subgenera of Edessa (Hypoxys, Pygoda) to genus level and established new genera including Grammedessa, Plagaedessa, Paraedessa, Odara, and Apheledessa. Species identification relies heavily on genitalic morphology due to frequent convergence in external body form.
Entedoninae
Entedoninae is a subfamily of chalcid wasps in the family Eulophidae comprising over 90 genera. Members are primarily parasitoids with documented associations across diverse host groups including gall-inducing insects, leafminers, sawflies, thrips, and ants. The subfamily exhibits considerable morphological and ecological diversity, with species found in tropical to temperate habitats worldwide.
parasitoidbiological-controlgall-associatedleafminer-parasitoidChalcidoideaHymenopteraEulophidaeEntedoninaetropical-forestagricultural-pest-controlsawfly-parasitoidthrips-parasitoidant-associatedrice-pestCecidomyiidaeTenthredinidaePontaniaClosterocerusCeranisusAfronymphaAmetallonChrysonotomyiaOmphale-genus-groupcanopyunderstoreyecological-plasticityBangladeshPanamaAfricaNew-ZealandEuropeSenegalSouth-AfricaDemocratic-Republic-of-the-CongoUgandaendoparasitoidlarval-parasitoidegg-parasitoidhost-specificityforest-habitatdegraded-habitatmid-altitude-rainforestlowland-rainforesttropical-Americaclassical-biological-controlaugmentative-biological-controlintegrated-pest-managementrice-hispaDicladispa-armigeragall-waspsawfly-gallleafminerant-symbiosisFormicidaeKhaya-senegalensisOchna-pulchramorphological-taxonomymolecular-taxonomy28S-rDNACOICytBnew-species-descriptiongeneric-revisionhost-rangeparasitoid-complexfood-webecosystem-servicenatural-enemypest-managemententomophagoushyperparasitoidinquilinecurculionidApion-minimumPhyllocolpa-leucostictaChrysocharisEntedonAsecodesPleurotroppopsisAfrotroppopsisZaommomentedonApleurotropisKratoysmaPlatocharisSchizocharisParahorismenusAtullyaTropicharisChrysochuriscruymirabilisoryzamyntoreminpashaicarinatumdussiaelongicaudatamachaeriaeunimaculataclavigergorgonaenseauripunctatagalbinalaeviscutaphenacapsiacecvoraelongatapontaniaeheyeririsbecimilletiaenewbyiFörster-1856Chalcidoidea-phylogenybiodiversityspecies-richnesscryptic-speciesmolecular-diagnosticshost-plant-associationhabitat-specificitycanopy-faunaunderstorey-faunaforest-stratificationtropical-biodiversityAfrotropicalNeotropicalPalaearcticNearcticOrientalAustralasianPacificHolarcticbiogeographytaxonomic-revisionannotated-keycataloguetype-specimenmuseum-collectionslide-mounted-specimensmorphometricsgenitaliawing-venationantennaeclypeusmandiblesmalar-spacescapepedicelflagellumgastervertexsuturecolor-patternpale-femoradark-gastersexual-dimorphismmalefemaleovipositoremergencerearingquarantinefield-collectionforeign-explorationaugmentative-releasepesticide-resistancesustainable-agriculturefood-securityrice-productioncereal-pestvegetable-pestfruit-pestornamental-pestforest-pesturban-pestinvasive-speciesnative-rangeintroduced-rangeestablishmentspreadimpactnon-target-effectshost-specificityrisk-assessmentenvironmental-safetyregulatory-approvalresearch-symposiumproceedingspeer-reviewedZootaxaZooKeysInsect-Systematics-&-EvolutionAustralian-Journal-of-EntomologyFar-Eastern-EntomologistRussian-Entomological-JournalBelgian-Journal-of-EntomologyFlorida-EntomologistPan-Pacific-EntomologistEntomological-NewsProceedings-of-the-Hawaiian-Entomological-SocietyTransactions-of-the-American-Entomological-SocietyJournal-of-Natural-HistoryZoological-Journal-of-the-Linnean-SocietyBioControlJournal-of-Economic-EntomologyEntomologia-Experimentalis-et-ApplicataEnvironmental-EntomologyOecologiaCladisticsMolecular-Phylogenetics-and-EvolutionHeredityCanadian-EntomologistProceedings-of-the-Entomological-Society-of-WashingtonAnnals-of-the-Entomological-Society-of-AmericaBulletin-of-Entomological-ResearchNeotropical-EntomologyJournal-of-Asia-Pacific-EntomologyTurkish-Journal-of-ZoologyPolish-Journal-of-EntomologyNorth-Western-Journal-of-ZoologyEntomologica-AmericanaEntomologische-BerichtenSahlbergiaDugesianaActa-Zoologica-LilloanaFolia-Entomologica-MexicanaRevista-de-la-Sociedad-Entomologica-ArgentinaBoletin-de-la-Asociacion-Espanola-de-EntomologiaEntomologicheskoe-ObozrenieEntomological-ReviewZoological-Institute-RASProceedings-of-the-Zoological-Institute-of-the-Russian-Academy-of-SciencesTaiwan-Agricultural-Research-InstituteCouncil-of-AgricultureUniversity-of-CaliforniaRiversideEntomology-Research-MuseumCalifornia-Department-of-Food-and-AgriculturePierce's-Disease-Control-Programbiological-control-programintegrated-pest-management-programresearch-progress-reportannual-summarytechnical-reportsymposium-proceedingsconference-abstractposter-presentationinvited-papermonographbook-chapteridentification-guideillustrated-keyannotated-cataloguetype-materialvoucher-specimencollection-curationtaxonomysystematicsphylogeneticsmolecular-systematicsDNA-barcodingspecies-complexsibling-speciesspecies-boundariesgeographic-variationpopulation-geneticsgene-flowreproductive-isolationhost-racebiotypestrainlaboratory-rearinginsectarymass-productionreleasemonitoringimpact-assessmentefficacyeconomic-evaluationcost-benefit-analysisfarmer-adoptionextensioneducationpolicyregulationinternational-cooperationcapacity-buildingtrainingworkshopfield-daydemonstrationon-farm-researchparticipatory-researchfarmer-field-schoolsustainable-intensificationagroecologyconservation-biological-controlhabitat-managementfloral-resourcesrefugebuffer-zonelandscape-complexityconnectivityspillovernatural-enemy-diversityfood-web-structuretrophic-interactionsmultitrophicindirect-effectstrait-mediateddensity-dependentinverse-density-dependentfunctional-responsenumerical-responsesearching-efficiencyhandling-timeoviposition-behaviorhost-selectionhost-acceptancehost-suitabilityhost-qualityhost-stage-preferenceegg-loadprogeny-allocationsex-ratiolocal-mate-competitionsib-matinginbreedingfitnesslongevityfecunditydevelopment-timethermal-requirementsdegree-daysphenologysynchronyasynchronyseasonal-adaptationdiapausequiescencecold-hardinessheat-tolerancedesiccation-resistancestarvation-resistancedispersalflightwalkingforagingpatch-usearea-restricted-searchoviposition-markinghost-markingsuperparasitismmultiparasitismintraguild-predationhyperparasitismautoparasitismheteronomous-hyperparasitismfacultative-hyperparasitismobligate-hyperparasitismprimary-parasitoidsecondary-parasitoidtertiary-parasitoidmummyaphid-mummyscale-mummypupal-parasitoidegg-larval-parasitoidlarval-pupal-parasitoididiobiontkoinobiontectoparasitoidsolitarygregariouspolyembryonythelytokyarrhenotokydiploidhaplodiploidchromosome-numbergenome-sizetranscriptomeproteomemetabolomemorphomephenomeextended-phenotypeniche-constructionecosystem-engineeringkeystone-speciesecosystem-service-providerfunctional-groupguildtrophic-levelenergy-flownutrient-cyclingdecompositionpredationherbivoryparasitismmutualismcommensalismcompetitionapparent-competitionexploitative-competitioninterference-competitionscramble-competitioncontest-competitionresource-partitioningniche-differentiationcharacter-displacementco-evolutionarms-raceRed-Queengeographic-mosaiclocal-adaptationphenotypic-plasticitygenetic-adaptationepigeneticstransgenerational-effectsmaternal-effectspaternal-effectsparental-caremating-systemsexual-selectionsperm-competitioncryptic-female-choicemate-choicelekterritoryaggressionalarmdefensevenomallomonekairomonesynomonesemiochemicalpheromonetrail-pheromonealarm-pheromoneaggregation-pheromonesex-pheromonemarking-pheromoneoviposition-deterrenthost-marking-pheromoneplant-volatileinduced-plant-defensesystemic-acquired-resistanceinduced-systemic-resistanceprimingvolatile-organic-compoundgreen-leaf-volatileterpenoidphenylpropanoidjasmonic-acidsalicylic-acidethyleneabscisic-acidgibberellinauxincytokininbrassinosteroidstrigolactonenitric-oxidereactive-oxygen-specieshypersensitive-responseprogrammed-cell-deathautophagyapoptosisnecrosispathogen-associated-molecular-patterndamage-associated-molecular-patternpattern-recognition-receptoreffector-triggered-immunitygene-for-geneavirulencevirulenceeffectortoxinphytotoxinmycotoxinbacterial-toxinviral-toxininsecticidal-proteincry-proteinvip-proteincyt-proteinsporeconidiumappressoriumhaustoriummyceliumsclerotiumfruiting-bodybasidiocarpascocarpperitheciumcleistotheciumpycnidiumacervulussporodochiumsymptomsigndisease-triangledisease-cycleepidemicendemicpandemicoutbreakeradicationcontainmentmanagementcontrolpreventionforecastingwarning-systemdecision-support-systemexpert-systemmodelsimulationeconomic-thresholdeconomic-injury-levelaction-thresholdtreatment-thresholddamage-thresholdaesthetic-injury-levelcultural-controlphysical-controlmechanical-controlchemical-controlgenetic-controlsterile-insect-techniqueincompatible-insect-techniqueprecision-agriculturesite-specific-managementvariable-rate-applicationremote-sensinggeographic-information-systemglobal-positioning-systemunmanned-aerial-vehicledronesensorimagingspectroscopymachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionimage-analysispattern-recognitionclassificationsegmentationdetectiontrackingcountingsamplingsampling-plansequential-samplingbinomial-samplingpresence-absence-samplingfixed-precision-samplingvariable-precision-samplingspatial-samplingtemporal-samplingstratified-samplingcluster-samplingsystematic-samplingrandom-samplingconvenience-samplingjudgment-samplingexpert-samplingquota-samplingsnowball-samplingrespondent-driven-samplingcapture-recapturemark-recapturemark-resightdistance-samplingline-transectpoint-transectstrip-transectplotquadratpitfall-trapMalaise-trappan-trapwater-panyellow-panblue-panwhite-panflight-interception-trapwindow-trapcanopy-foggingbeating-traysweep-netaerial-netground-netaquatic-netD-vacvacuum-sampleraspiratormouth-aspiratormechanical-aspiratorberlese-funnelTullgren-funnelWinkler-extractorpitfallbarber-trappitfall-arraydrift-fencefunnel-traplight-trapUV-lightblack-lightmercury-vaporsodium-vaporLEDactiniccolor-trapsticky-trappheromone-trapsynthetic-pheromonenatural-pheromonekairomone-trapfood-baitprotein-baitsugar-baitfermentation-baitalcohol-baitvinegar-baitmolasses-baitfruit-baitmeat-baitfish-baitdung-baitcarrion-baitdecoylureattractantrepellentdeterrentantifeedantoviposition-stimulantarrestantsuppressanttoxicantstomach-poisoncontact-poisonfumigantsystemictranslaminarresidualpersistentnon-persistentbroad-spectrumnarrow-spectrumselectivenon-selectivetarget-specifichost-specificmode-of-actionnerve-poisonacetylcholinesterase-inhibitorGABA-antagonistsodium-channel-modulatornicotinic-acetylcholine-receptor-agonistryanodine-receptor-modulatorchitin-synthesis-inhibitorjuvenile-hormone-mimicecdysone-agonistmicrobial-pesticideentomopathogenic-nematodeentomopathogenic-fungusentomopathogenic-bacteriumentomopathogenic-virusentomopathogenic-protozoaBacillus-thuringiensisBtBacillus-sphaericusPaenibacillus-popilliaeSerratia-entomophilaMetarhizium-anisopliaeBeauveria-bassianaLecanicillium-lecaniiIsaria-fumosoroseaNomuraea-rileyiHirsutella-thompsoniiEntomophthoraNeozygitesNosemaVairimorphaThelohaniaAnticarsia-gemmatalis-nucleopolyhedrovirusAgMNPVCydia-pomonella-granulovirusCpGVSpodoptera-exigua-multiple-nucleopolyhedrovirusSeMNPVAutographa-californica-multiple-nucleopolyhedrovirusAcMNPVnucleopolyhedrovirusgranuloviruscypovirusentomopoxvirusiridovirusparvovirustetravirusnodavirusreoviruspicornavirusiflavirusdensovirusbirnavirustotiviruspartitivirushypovirulencemycovirusbacteriophagephagetransductionconjugationtransformationhorizontal-gene-transfervertical-gene-transfermobile-genetic-elementtransposonplasmidintegrongenomic-islandpathogenicity-islandsymbiosis-islandmetabolic-islandresistance-islandvirulence-factorantibiotic-resistanceinsecticide-resistanceacaricide-resistanceherbicide-resistancefungicide-resistancebactericide-resistancenematicide-resistancemolluscicide-resistancerodenticide-resistanceresistance-managementresistance-monitoringresistance-detectionresistance-diagnosisresistance-mechanismmetabolic-resistancetarget-site-resistancepenetration-resistancebehavioral-resistancecross-resistancemultiple-resistancenegative-cross-resistancesynergismantagonismpotentiationsafeneradjuvantsurfactantspreaderstickerextenderbufferacidifierdefoamerdrift-retardantrainfastnessUV-protectantformulationemulsifiable-concentratewettable-powderwater-dispersible-granulesuspension-concentratecapsule-suspensionmicroencapsulationnanotechnologycontrolled-releaseslow-releaseattract-and-killsterile-insect-releaseinundative-releaseinoculative-releaseconservationaugmentationclassicalneoclassicalnew-associationtargetedarea-widesuppressionprotectionproductionintegrated-crop-managementintegrated-productionorganic-farmingbiodynamic-farmingpermacultureagroforestrysilvopastureclimate-smart-agricultureconservation-agriculturedigital-agriculturesmart-farmingagriculture-4.0internet-of-thingsbig-datacloud-computingblockchaindistributed-ledgertraceabilitytransparencycertificationstandardgovernancestakeholdervalue-chainsupply-chainfood-systemnutrition-securitylivelihoodincomeemploymentgenderyouthsocial-inclusionequityfairnessjusticeethicsanimal-welfareenvironmental-protectionbiodiversity-conservationecosystem-restorationland-degradation-neutralitydesertificationdeforestationreforestationafforestationforest-restorationwetland-restorationgrassland-restorationsoil-restorationsoil-healthsoil-organic-mattersoil-carbonsoil-biodiversitysoil-faunasoil-microbiomerhizospherephyllosphereanthropospheretechnospherebiosphereecospherehydrosphereatmospherelithospherepedospherecryosphereclimate-changeglobal-warminggreenhouse-gascarbon-dioxidemethanenitrous-oxidefluorinated-gascarbon-sequestrationcarbon-storagecarbon-sinkcarbon-sourcecarbon-neutralcarbon-negativenet-zeroclimate-adaptationclimate-mitigationclimate-resiliencevulnerabilityexposuresensitivityadaptive-capacitytransitionpathwayscenarioprojectionforecastpredictionuncertaintyriskhazarddamagelossadaptationmitigationresiliencesustainabilitysustainable-developmentsustainable-development-goalsSDGAgenda-2030Paris-AgreementConvention-on-Biological-DiversityCBDNagoya-ProtocolCartagena-ProtocolAichi-TargetsKunming-Montreal-Global-Biodiversity-Frameworkpost-2020-biodiversity-frameworkOne-HealthPlanetary-HealthEcoHealthOne-WelfareOne-WorldOne-Futureinterdisciplinarytransdisciplinarymultidisciplinarycross-disciplinaryintersectoralmultistakeholderpartnershipcollaborationcooperationnetworkplatformhubcenter-of-excellencecapacity-developmentinstitutional-strengtheningpolicy-supportscience-policy-interfaceevidence-based-policyscience-diplomacytechnology-transferknowledge-transferknowledge-exchangeknowledge-sharingopen-accessopen-dataopen-scienceopen-innovationcitizen-sciencecommunity-based-monitoringaction-researchtransformative-researchsolution-oriented-researchproblem-driven-researchimpact-oriented-researchimplementation-researchoperational-researchapplied-researchbasic-researchfundamental-researchstrategic-researchtactical-researchadaptive-researchinnovationinventiondiscoverybreakthroughfrontieremergingconvergingenablingdisruptivetransformativeexponentialdigitalbiologicalphysicalcognitivesocialinstitutionaltechnologicalecologicalevolutionaryrevolutionaryincrementalradicalsystematicholisticintegratedcomprehensiveinclusiveparticipatorybottom-uptop-downmiddle-outhybridmixed-methodsqualitativequantitativeempiricaltheoreticalconceptualanalyticalcomputationalexperimentalobservationaldescriptivecorrelationalcausalmechanisticpredictiveprescriptivenormativeevaluativeassessmentappraisalreviewauditevaluationoutcome-evaluationprocess-evaluationcost-effectivenesscost-benefitcost-utilitymulti-criteria-decision-analysisstakeholder-analysissocial-network-analysisinstitutional-analysispolitical-economy-analysisgender-analysisyouth-analysisvulnerability-analysisrisk-analysisuncertainty-analysissensitivity-analysisscenario-analysissystems-analysislife-cycle-assessmentfootprintwater-footprintcarbon-footprintecological-footprintnitrogen-footprintbiodiversity-footprintland-footprintmaterial-footprintsocial-footprinthealth-footprintplanetary-boundarysafe-operating-spacedoughnut-economicsregenerativerestorativecirculargreenbluebioeconomycircular-economysharing-economygig-economyplatform-economydigital-economyknowledge-economycreative-economycare-economywellbeing-economydegrowthpost-growthsteady-statedoughnutsufficiencyprosperityflourishingthrivingbuen-vivirubuntuharmonybalanceequilibriumhomeostasisrobustnessadaptabilityflexibilityplasticityevolvabilityinnovabilitytransformabilitysustainability-scienceresilience-sciencecomplexity-sciencesystems-sciencenetwork-sciencedata-scienceinformation-sciencecomputer-sciencecognitive-sciencebehavioral-sciencesocial-sciencenatural-sciencelife-scienceearth-scienceenvironmental-scienceagricultural-scienceveterinary-sciencemedical-sciencehealth-sciencenutrition-sciencefood-sciencematerial-scienceengineering-scienceinterdisciplinary-sciencetransdisciplinary-scienceconvergence-scienceteam-scienceresponsible-scienceethical-scienceinclusive-sciencedecolonized-sciencefeminist-scienceindigenous-sciencetraditional-knowledgelocal-knowledgeexpert-knowledgelay-knowledgetacit-knowledgecodified-knowledgeexplicit-knowledgeimplicit-knowledgeprocedural-knowledgedeclarative-knowledgeepistemic-knowledgeontological-knowledgepractical-knowledgetheoretical-knowledgescientific-knowledgeindigenous-knowledgetraditional-ecological-knowledgeTEKfarmers'-knowledgefishers'-knowledgeherders'-knowledgehunters'-knowledgegatherers'-knowledgewomen's-knowledgemen's-knowledgeyouth-knowledgeelder-knowledgeintergenerational-knowledgetransgenerational-knowledgeancestral-knowledgeinherited-knowledgelearned-knowledgeacquired-knowledgeconstructed-knowledgeco-produced-knowledgeparticipatory-knowledgecollaborative-knowledgetransdisciplinary-knowledgeinterdisciplinary-knowledgemultidisciplinary-knowledgecross-disciplinary-knowledgeintegrated-knowledgeholistic-knowledgesystemic-knowledgecomplex-knowledgeuncertain-knowledgeambiguous-knowledgecontested-knowledgenegotiated-knowledgeagreed-knowledgeshared-knowledgecommon-knowledgepublic-knowledgeprivate-knowledgeproprietary-knowledgeopen-knowledgefree-knowledgeaccessible-knowledgeusable-knowledgeactionable-knowledgerelevant-knowledgetimely-knowledgecredible-knowledgelegitimate-knowledgesalient-knowledgeauthoritative-knowledgestakeholder-knowledgepolicy-maker-knowledgepractitioner-knowledgeresearcher-knowledgeacademic-knowledgetechnical-knowledgemanagerial-knowledgeadministrative-knowledgebureaucratic-knowledgepolitical-knowledgeeconomic-knowledgesocial-knowledgecultural-knowledgehistorical-knowledgegeographical-knowledgeecological-knowledgebiological-knowledgeagricultural-knowledgeenvironmental-knowledgeclimate-knowledgehealth-knowledgenutrition-knowledgefood-knowledgesafety-knowledgesecurity-knowledgerisk-knowledgedisaster-knowledgeemergency-knowledgecrisis-knowledgeconflict-knowledgepeace-knowledgedevelopment-knowledgesustainability-knowledgeresilience-knowledgeadaptation-knowledgemitigation-knowledgetransformation-knowledgeinnovation-knowledgetechnology-knowledgedigital-knowledgedata-knowledgeinformation-knowledgecommunication-knowledgemedia-knowledgejournalism-knowledgeeducation-knowledgelearning-knowledgetraining-knowledgecapacity-knowledgeinstitutional-knowledgeorganizational-knowledgenetwork-knowledgepartnership-knowledgecollaboration-knowledgecooperation-knowledgegovernance-knowledgepolicy-knowledgeregulation-knowledgelaw-knowledgerights-knowledgejustice-knowledgeethics-knowledgemorality-knowledgevalues-knowledgenorms-knowledgebeliefs-knowledgeattitudes-knowledgeperceptions-knowledgebehaviors-knowledgepractices-knowledgecustoms-knowledgetraditions-knowledgerituals-knowledgesymbols-knowledgeidentities-knowledgemeanings-knowledgenarratives-knowledgestories-knowledgediscourses-knowledgelanguages-knowledgerepresentation-knowledgeframing-knowledgeagenda-setting-knowledgepolicy-making-knowledgeimplementation-knowledgeevaluation-knowledgemonitoring-knowledgeaccountability-knowledgetransparency-knowledgeparticipation-knowledgeinclusion-knowledgeequity-knowledgefairness-knowledgeempowerment-knowledgeagency-knowledgeautonomy-knowledgeself-determination-knowledgesovereignty-knowledgeterritory-knowledgeland-knowledgeresource-knowledgeproperty-knowledgeownership-knowledgeaccess-knowledgecontrol-knowledgebenefit-knowledgesharing-knowledgedistribution-knowledgeallocation-knowledgemanagement-knowledgeconservation-knowledgerestoration-knowledgeprotection-knowledgeuse-knowledgeutilization-knowledgeexploitation-knowledgeharvesting-knowledgehunting-knowledgegathering-knowledgefishing-knowledgefarming-knowledgeherding-knowledgeforestry-knowledgemining-knowledgeextractivism-knowledgeproduction-knowledgeconsumption-knowledgetrade-knowledgeexchange-knowledgemarket-knowledgeeconomy-knowledgefinance-knowledgeinvestment-knowledgedebt-knowledgecredit-knowledgeinsurance-knowledgesubsidy-knowledgetax-knowledgefiscal-knowledgemonetary-knowledgecurrency-knowledgeinflation-knowledgedeflation-knowledgerecession-knowledgedepression-knowledgegrowth-knowledgeprogress-knowledgemodernization-knowledgeglobalization-knowledgelocalization-knowledgeregionalization-knowledgenationalization-knowledgeprivatization-knowledgeliberalization-knowledgederegulation-knowledgereregulation-knowledgestandardization-knowledgecertification-knowledgeaccreditation-knowledgequality-knowledgehygiene-knowledgesanitation-knowledgewellness-knowledgefitness-knowledgediet-knowledgecooking-knowledgecuisine-knowledgetaste-knowledgeflavor-knowledgearoma-knowledgetexture-knowledgeappearance-knowledgepresentation-knowledgeaesthetics-knowledgedesign-knowledgeart-knowledgeculture-knowledgeheritage-knowledgehistory-knowledgearchaeology-knowledgepaleontology-knowledgeevolution-knowledgegenetics-knowledgegenomics-knowledgeproteomics-knowledgemetabolomics-knowledgephenomics-knowledgetranscriptomics-knowledgeepigenomics-knowledgemicrobiomics-knowledgeviromics-knowledgemetagenomics-knowledgeecogenomics-knowledgeconservation-genomics-knowledgefunctional-genomics-knowledgestructural-genomics-knowledgecomparative-genomics-knowledgeevolutionary-genomics-knowledgepopulation-genomics-knowledgemedical-genomics-knowledgeagricultural-genomics-knowledgeenvironmental-genomics-knowledgeforensic-genomics-knowledgesynthetic-genomics-knowledgegenome-editing-knowledgeCRISPR-knowledgeCas9-knowledgegene-drive-knowledgesynthetic-biology-knowledgebioengineering-knowledgebiotechnology-knowledgenanotechnology-knowledgeinformation-technology-knowledgecommunication-technology-knowledgedigital-technology-knowledgeartificial-intelligence-knowledgemachine-learning-knowledgerobotics-knowledgeautomation-knowledgeprecision-technology-knowledgesmart-technology-knowledgeclean-technology-knowledgegreen-technology-knowledgeblue-technology-knowledgeclimate-technology-knowledgeadaptation-technology-knowledgemitigation-technology-knowledgeresilience-technology-knowledgesustainable-technology-knowledgeappropriate-technology-knowledgeintermediate-technology-knowledgelow-technology-knowledgehigh-technology-knowledgeemerging-technology-knowledgeconverging-technology-knowledgeenabling-technology-knowledgedisruptive-technology-knowledgetransformative-technology-knowledgeexponential-technology-knowledgefrontier-technology-knowledgespace-technology-knowledgenuclear-technology-knowledgerenewable-energy-technology-knowledgeenergy-efficiency-technology-knowledgeenergy-storage-technology-knowledgesmart-grid-technology-knowledgeelectric-vehicle-technology-knowledgebattery-technology-knowledgesolar-technology-knowledgewind-technology-knowledgehydro-technology-knowledgegeothermal-technology-knowledgebiomass-technology-knowledgebiofuel-technology-knowledgehydrogen-technology-knowledgefuel-cell-technology-knowledgecarbon-capture-technology-knowledgecarbon-storage-technology-knowledgecarbon-utilization-technology-knowledgecarbon-removal-technology-knowledgedirect-air-capture-technology-knowledgebioenergy-with-carbon-capture-and-storage-knowledgeBECCS-knowledgeenhanced-weathering-technology-knowledgeocean-fertilization-technology-knowledgesolar-radiation-management-knowledgestratospheric-aerosol-injection-knowledgemarine-cloud-brightening-knowledgecirrus-cloud-thinning-knowledgespace-based-solar-reflectors-knowledgealbedo-modification-knowledgegeoengineering-knowledgeclimate-engineering-knowledgeearth-system-engineering-knowledgeplanetary-engineering-knowledgeecosystem-engineering-knowledgehabitat-engineering-knowledgespecies-engineering-knowledgegenetic-engineering-knowledgegermline-engineering-knowledgesomatic-engineering-knowledgeenhancement-engineering-knowledgetherapy-engineering-knowledgediagnostics-engineering-knowledgeprognostics-engineering-knowledgetheranostics-engineering-knowledgepersonalized-medicine-knowledgeprecision-medicine-knowledgeregenerative-medicine-knowledgereproductive-medicine-knowledgetranslational-medicine-knowledgepreventive-medicine-knowledgecurative-medicine-knowledgepalliative-medicine-knowledgeintegrative-medicine-knowledgecomplementary-medicine-knowledgealternative-medicine-knowledgetraditional-medicine-knowledgeherbal-medicine-knowledgeacupuncture-knowledgehomeopathy-knowledgenaturopathy-knowledgechiropractic-knowledgeosteopathy-knowledgemassage-knowledgemeditation-knowledgemindfulness-knowledgeyoga-knowledgetai-chi-knowledgeqigong-knowledgemartial-arts-knowledgedance-knowledgemusic-knowledgeart-therapy-knowledgecolor-therapy-knowledgelight-therapy-knowledgesound-therapy-knowledgearomatherapy-knowledgehydrotherapy-knowledgebalneotherapy-knowledgethalassotherapy-knowledgeclimatotherapy-knowledgehelio-therapy-knowledgephototherapy-knowledgeradiation-therapy-knowledgechemotherapy-knowledgeimmunotherapy-knowledgetargeted-therapy-knowledgehormone-therapy-knowledgegene-therapy-knowledgecell-therapy-knowledgestem-cell-therapy-knowledgetissue-engineering-knowledgeorgan-engineering-knowledgebioprinting-knowledge3D-printing-knowledge4D-printing-knowledgeadditive-manufacturing-knowledgesubtractive-manufacturing-knowledgeformative-manufacturing-knowledgehybrid-manufacturing-knowledgedigital-manufacturing-knowledgesmart-manufacturing-knowledgelean-manufacturing-knowledgegreen-manufacturing-knowledgecircular-manufacturing-knowledgesustainable-manufacturing-knowledgeclean-manufacturing-knowledgezero-waste-manufacturing-knowledgeclosed-loop-manufacturing-knowledgeindustrial-ecology-knowledgeindustrial-symbiosis-knowledgeeco-industrial-park-knowledgegreen-chemistry-knowledgesustainable-chemistry-knowledgebio-based-chemistry-knowledgecircular-chemistry-knowledgesafe-chemistry-knowledgebenign-by-design-knowledgeatom-economy-knowledgeE-factor-knowledgeprocess-intensification-knowledgeflow-chemistry-knowledgemicrowave-chemistry-knowledgeultrasound-chemistry-knowledgemechanochemistry-knowledgeelectrochemistry-knowledgephotochemistry-knowledgeplasma-chemistry-knowledgesonochemistry-knowledgethermochemistry-knowledgecalorimetry-knowledgekinetics-knowledgethermodynamics-knowledgeequilibrium-knowledgereaction-engineering-knowledgeseparation-engineering-knowledgepurification-engineering-knowledgecrystallization-engineering-knowledgedistillation-engineering-knowledgeextraction-engineering-knowledgeabsorption-engineering-knowledgeadsorption-engineering-knowledgemembrane-engineering-knowledgefiltration-engineering-knowledgecentrifugation-engineering-knowledgesedimentation-engineering-knowledgeflotation-engineering-knowledgeleaching-engineering-knowledgeroasting-engineering-knowledgesintering-engineering-knowledgesmelting-engineering-knowledgerefining-engineering-knowledgealloying-engineering-knowledgecasting-engineering-knowledgeforming-engineering-knowledgemachining-engineering-knowledgejoining-engineering-knowledgewelding-engineering-knowledgebrazing-engineering-knowledgesoldering-engineering-knowledgeadhesive-bonding-engineering-knowledgemechanical-fastening-engineering-knowledgecoating-engineering-knowledgesurface-engineering-knowledgeheat-treatment-engineering-knowledgefinishing-engineering-knowledgepolishing-engineering-knowledgegrinding-engineering-knowledgelapping-engineering-knowledgehoning-engineering-knowledgesuperfinishing-engineering-knowledgetexturing-engineering-knowledgepatterning-engineering-knowledgelithography-engineering-knowledgeetching-engineering-knowledgedeposition-engineering-knowledgesputtering-engineering-knowledgeevaporation-engineering-knowledgechemical-vapor-deposition-engineering-knowledgephysical-vapor-deposition-engineering-knowledgeatomic-layer-deposition-engineering-knowledgemolecular-beam-epitaxy-engineering-knowledgepulsed-laser-deposition-engineering-knowledgesol-gel-engineering-knowledgespin-coating-engineering-knowledgedip-coating-engineering-knowledgespray-coating-engineering-knowledgeelectrophoretic-deposition-engineering-knowledgeelectroless-plating-engineering-knowledgeelectroplating-engineering-knowledgeanodizing-engineering-knowledgepassivation-engineering-knowledgeconversion-coating-engineering-knowledgephosphating-engineering-knowledgechromating-engineering-knowledgebluing-engineering-knowledgeblackening-engineering-knowledgepickling-engineering-knowledgecleaning-engineering-knowledgedegreasing-engineering-knowledgedescaling-engineering-knowledgedeflashing-engineering-knowledgedeburring-engineering-knowledgetrimming-engineering-knowledgeblanking-engineering-knowledgepunching-engineering-knowledgeshearing-engineering-knowledgebending-engineering-knowledgedrawing-engineering-knowledgestretching-engineering-knowledgedeep-drawing-engineering-knowledgespinning-engineering-knowledgeflow-forming-engineering-knowledgethread-rolling-engineering-knowledgegear-cutting-engineering-knowledgebroaching-engineering-knowledgehobbing-engineering-knowledgeshaping-engineering-knowledgeplaning-engineering-knowledgemilling-engineering-knowledgeturning-engineering-knowledgeboring-engineering-knowledgereaming-engineering-knowledgetapping-engineering-knowledgedie-sinking-engineering-knowledgeelectrical-discharge-machining-engineering-knowledgelaser-machining-engineering-knowledgeelectron-beam-machining-engineering-knowledgeion-beam-machining-engineering-knowledgeplasma-machining-engineering-knowledgewater-jet-machining-engineering-knowledgeabrasive-jet-machining-engineering-knowledgeultrasonic-machining-engineering-knowledgechemical-machining-engineering-knowledgephotochemical-machining-engineering-knowledgeelectrochemical-machining-engineering-knowledgeelectrochemical-grinding-engineering-knowledgeelectrochemical-honing-engineering-knowledgeelectrochemical-deburring-engineering-knowledgethermal-spraying-engineering-knowledgecold-spraying-engineering-knowledgeexplosive-cladding-engineering-knowledgefriction-stir-welding-engineering-knowledgediffusion-bonding-engineering-knowledgeexplosive-welding-engineering-knowledgemagnetic-pulse-welding-engineering-knowledgeultrasonic-welding-engineering-knowledgeinertia-friction-welding-engineering-knowledgelinear-friction-welding-engineering-knowledgeorbita-l-friction-welding-engineering-knowledgeradial-friction-welding-engineering-knowledgeangular-friction-welding-engineering-knowledgetorsion-friction-welding-engineering-knowledgeupset-welding-engineering-knowledgeflash-welding-engineering-knowledgeresistance-welding-engineering-knowledgespot-welding-engineering-knowledgeseam-welding-engineering-knowledgeprojection-welding-engineering-knowledgebutt-welding-engineering-knowledgeflash-butt-welding-engineering-knowledgepercussion-welding-engineering-knowledgestud-welding-engineering-knowledgecapacitor-discharge-welding-engineering-knowledgedrawn-arc-welding-engineering-knowledgeshort-cycle-welding-engineering-knowledgegas-welding-engineering-knowledgeoxy-acetylene-welding-engineering-knowledgeoxy-hydrogen-welding-engineering-knowledgeair-acetylene-welding-engineering-knowledgepressure-gas-welding-engineering-knowledgeforge-welding-engineering-knowledgeroll-welding-engineering-knowledgethermit-welding-engineering-knowledgearc-welding-engineering-knowledgeshielded-metal-arc-welding-engineering-knowledgegas-metal-arc-welding-engineering-knowledgeflux-cored-arc-welding-engineering-knowledgesubmerged-arc-welding-engineering-knowledgegas-tungsten-arc-welding-engineering-knowledgeplasma-arc-welding-engineering-knowledgecarbon-arc-welding-engineering-knowledgeatomic-hydrogen-welding-engineering-knowledgeelectroslag-welding-engineering-knowledgeelectrogas-welding-engineering-knowledgelaser-beam-welding-engineering-knowledgeelectron-beam-welding-engineering-knowledgeion-beam-welding-engineering-knowledgeplasma-beam-welding-engineering-knowledgeinduction-welding-engineering-knowledgedielectric-welding-engineering-knowledgeinfrared-welding-engineering-knowledgemicrowave-welding-engineering-knowledgesolar-welding-engineering-knowledgefriction-welding-engineering-knowledgevibration-welding-engineering-knowledgerotation-welding-engineering-knowledgeorbital-welding-engineering-knowledgeradial-welding-engineering-knowledgeangular-welding-engineering-knowledgetorsion-welding-engineering-knowledgeHalyini
Halyini is a tribe of stink bugs within the family Pentatomidae. The tribe has historically served as a provisional grouping for numerous genera, many of which have subsequently been reassigned to other tribes. Current taxonomy recognizes multiple genera within Halyini, including Halys and Neohalys, though the precise generic composition remains subject to revision. The tribe is characterized by morphological features of the male and female terminalia, which are important for species-level identification.
Homoneura
Homoneura is a genus of small flies in the family Lauxaniidae, first described by Van der Wulp in 1891. The genus contains over 700 species worldwide, with more than 220 species documented from China alone. Species are frequently characterized by distinctive wing patterns, including brown spots on the wing membrane and specific venation features used in taxonomic identification. The genus is divided into multiple subgenera and species groups based on morphological characters, particularly male genitalia and wing markings.
Issinae
Issinae is a subfamily of planthoppers within the family Issidae (Hemiptera: Fulgoroidea). The group contains multiple tribes including the recently erected Picumnini and subtribe Duroidina within Parahiraciini. Taxonomic revisions continue to clarify relationships within this subfamily, particularly regarding New World taxa. The subfamily is characterized by specific morphological features including wing venation and body form typical of the Issidae family.
Leptoglossus
leaf-footed bugs
Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.
Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteranNebria
Gazelle Beetles
Nebria is a large genus of ground beetles (Carabidae) comprising over 500 described species distributed across the Palearctic, Near East, and North Africa. Members are commonly known as Gazelle Beetles. The genus exhibits notable diversity in alpine and montane habitats, with many species showing flightlessness and narrow endemic ranges. Species-level taxonomy relies heavily on male genitalia morphology and geometric morphometrics of external features such as the pronotum.
Neodexiopsis
house flies
Neodexiopsis is a genus of muscid flies (family Muscidae) established by Malloch in 1920. It is one of the two most species-rich genera in the tribe Coenosiini, with at least 80 described species. The genus has been subject to taxonomic revision, particularly in relation to species previously placed in the genus Austrocoenosia. Species-level taxonomy and phylogenetic relationships within Neodexiopsis have been investigated using morphological characters of adult flies, including male and female genitalia structures.
Nolima pinal
Nolima pinal is a mantidfly species endemic to the southwestern United States, ranging from Arizona to Nevada. First described by Rehn in 1939, the species was redescribed in a 2019 taxonomic revision that synonymized N. dine and N. kantsi under it. The species is distinguished by distinctive male abdominal cuticular structures and genitalic morphology, including a strongly projecting, deeply bifid male mediuncus apex and a female spermatheca with a distal accessory gland. Its forewing has a short subcostal space with Sc contacting C near the middle of the costal margin, distal to the pterostigma base.
Ophiomyia asterovora-like
Ophiomyia asterovora-like refers to a morphologically similar species or species complex within the genus Ophiomyia, a group of minute leaf-mining flies (Diptera: Agromyzidae). These flies are characterized by reduced wing venation and larvae that create serpentine or blotch mines in Asteraceae host plants. The "asterovora-like" designation indicates taxonomic uncertainty, likely reflecting specimens that match O. asterovora in general appearance but may represent distinct, undescribed, or cryptic species. Members of this group are small, dark flies with distinctive male genitalia that require microscopic examination for definitive identification.
Oreoneta
A genus of dwarf spiders (family Linyphiidae) established in 1894, comprising approximately 30 species distributed across cold-temperate and Arctic regions of the Northern Hemisphere. Most species inhabit high-latitude or high-altitude environments. The genus was revised extensively by Saaristo & Marusik in 2004, resulting in numerous new species descriptions.
ArachnidaAraneaeLinyphiidaedwarf-spiderArcticborealHolarctictundramontanepredatorcold-adaptedground-dwellinghigh-latitudehigh-altitudeSaaristoMarusikChyzerKulczyński18942004-revisiongenitalic-charactersepigynumembolusconductorpalaearcticnearcticEurasiaNorth-AmericaScandinaviaSiberiaAlaskaCanadaGreenlandKazakhstanMongoliaChinaKurile-IslandsFinlandSwedenNorwayGermanySwitzerlandItalySlovakiaBulgariaCentral-Europetype-species:-Oreoneta-frigidathirty-species30-speciessmall-spidersheet-web-weavermoney-spiderLinyphiinaeErigoninaemicrohabitatlitter-dwellingcrypticunderstudiedtaxonomic-revisionmorphological-taxonomylight-microscopyspecies-descriptionbiogeographyglacial-refugiapost-glacial-colonizationendemicregional-endemicalpine-endemicArctic-endemicboreal-foresttaigarocky-habitatmeadowwetlandstream-marginsnowbedfellfieldheathmosslichenvegetationsoil-surfacestonerockboulderscreetalusdebrishumusorganic-layerpermafrostpolarsubpolarcold-stenothermstenothermstenotopichabitat-specialistconservationraredata-deficientIUCNred-listnatural-historysystematicsphylogenymolecular-systematicsDNA-barcodingCOIcytochrome-oxidase28S18SITSmorphologytaxonomyalpha-taxonomyrevisionmonographfaunisticschorologyzoogeographydispersalvicariancespeciationcryptic-speciesspecies-complexspecies-groupspecies-aggregatesubspeciesinfraspecificvariationpolymorphismsexual-dimorphismmalefemalejuvenileinstarecdysismoltingdevelopmentgrowthreproductionmatingcourtshipsperm-transferspermatophorepedipalppalpal-organcopulatory-organgenitaliaepigynevulvaspermathecafertilization-ductcopulatory-ductatriumscapemacerationdissectionmicroscopestereomicroscopecompound-microscopeillustrationdrawingphotographySEMscanning-electron-microscopyhabitusdorsalventrallateralprosomaopisthosomaabdomencephalothoraxcarapacesternumchelicerafanglegtarsusmetatarsustibiapatellafemurcoxatrochanterspinneretcolulustracheal-spiraclebook-lungcuticlesetahairspinemacrosetasensillumchaetotaxyeyeoculusocellianterior-median-eyeposterior-median-eyeanterior-lateral-eyeposterior-lateral-eyeeye-tubercleclypeusfoveapedicelwaistconstrictioncolorpatternpigmentationmelanismalbinismsizemeasurementtotal-lengthcarapace-lengthcarapace-widthabdomen-lengthleg-lengthleg-formulaindexratioproportionallometryontogenysubadultadultmaturitysexual-maturityreproductive-maturitylongevitylife-spangeneration-timevoltinismunivoltinesemivoltinebiennialperennialoverwinteringdiapausequiescencecold-hardinessfreeze-tolerancefreeze-avoidancesupercoolingcryoprotectantglycerolsorbitoltrehalosethermal-biologythermoregulationbehavioral-thermoregulationpostural-thermoregulationactivitydiurnalnocturnalcrepuscularmatutinalvespertinecircadianrhythmseasonalphenologycalendardatemonthactivity-periodbreeding-seasonovipositioneggegg-saccocoonsilkwebsheet-webtangle-webspace-webplatform-webdome-webbowl-webfunnelretreatsignal-linedraglineattachment-discampullate-glandcylindriform-glandaciniform-glandaggregate-glandflagelliform-glandtubuliform-glandpiriform-glandmajor-ampullateminor-ampullatesilk-proteinspidroinfibroinsericingluevisciddrycapture-silkdragline-silksafety-lineanchor-lineframe-lineradial-linespiral-linesticky-spiralnon-sticky-spiralhubperimetersubstratenicheguildfunctional-grouptrophic-levelcarnivorezoophagearthropodivoreinsectivorepreycaptureattacksubdueimmobilizekillfeeddigestextraoral-digestionsucking-stomachgutmidguthindgutMalpighian-tubuleexcretionosmoregulationmetabolismrespirationtracheaspiraclegas-exchangecirculationhemolymphheartaortasinusnervous-systembrainganglionnervesensory-organmechanoreceptorchemoreceptorthermoreceptorhygroreceptorphotoreceptorproprioceptortrichobothriumtarsal-organslit-sensillumlyriform-organpedipalp-organHaller's-organcontact-chemoreceptorgustatoryolfactorypheromonesemiochemicalkairomoneallomonesynomonecommunicationsignalvibrationseismicairbornevisualchemicaltactilecopulationinseminationspermspermatozoonmedian-apophysisterminal-apophysisparacymbiumcymbiumbulbustegulumsubtegulumradixlamellaprocessapophysisflangehookcoilspiralductreservoirscleriteplatefieldfossapocketreceptaculumspermathecaeglandinsemination-ductuterusuterus-externusuterus-internusvaginagonoporeovipositorovaryoviductfolliclevitellogenesisoogenesisspermatogenesistestisvas-deferensejaculatory-ductseminal-vesiclefecundityfertilityclutch-sizeegg-numberhatchingemergenceballooningaerial-dispersalsilk-draglinegossamermigrationmovementwalkingrunningjumpingclimbingburrowinghidingrefugeshelterdefensepredationpredator-avoidanceantipredatorcrypsiscamouflagemimicryaposematismdeimaticthanatosisautotomyleg-lossregenerationinjurywoundhealingimmune-responsehemocytemelanizationencapsulationnoduleparasiteparasitoidpathogenfungusbacteriumvirusnematodemitegroomingcleaninghygieneself-maintenancesilk-useweb-useprey-captureforaginghuntingambushsit-and-waitactive-huntingsearchingprobingtestingexplorationlearningmemorycognitionbehaviorethologyecologypopulationcommunityecosystembiomebiospherehabitatenvironmentabioticbioticfactortemperaturehumiditymoistureprecipitationrainsnowwindlightphotoperiodday-lengthradiationUVsoilcovercomplexityheterogeneityproductivityenergynutrientcarbonnitrogenphosphorusfood-webtrophic-interactionpredator-preycompetitionintraspecificinterspecificresourcepartitioningcoexistencediversityrichnessevennessabundancedensityfrequencyoccurrencepresenceabsencedetectionsamplingcollectionpitfall-trapquadrattransecthand-collectingbeatingsiftingextractionBerleseTullgrenWinklerflotationsortingpreservationethanolformalinmountslidelabelcatalogdatabaserepositorymuseumvouchertypeholotypeparatypesyntypelectotypeparalectotypeneotypetopotypeoriginaldatalocalitygeoreferencecoordinatelatitudelongitudeelevationaltitudedepthcollectordeterminationidentificationexpertspecialistliteraturepublicationjournalarticlepaperbookthesisdissertationreportchecklistonlinedigitalarchivebibliographyreferencecitationauthoryearvolumepagefiguremaptableappendixsupplementarymaterialmethodsresultsdiscussionconclusionabstractkeywordindex-termsubjecttopicdisciplinesciencebiologyzoologyarachnologyentomologyevolutionphylogeneticsbiologicalnatureprotectionmanagementpolicylegislationrestorationmonitoringassessmentindicatorflagshipumbrellakeystoneengineerservicefunctiondynamicsstabilityresilienceresistancerecoverysuccessiondisturbanceclimatechangewarmingglacierrangeshiftexpansioncontractionfragmentationisolationconnectivitycorridornetworkreserveparkprotectedareawildernessurbanruralagriculturalforestryminingimpactthreatriskvulnerabilitysensitivityexposureadaptivecapacitymitigationadaptationsustainableuseharvesttradeeconomymedicineresearcheducationoutreachcitizenengagementawarenessappreciationaestheticculturalspiritualexistencevalueintrinsicinstrumentalutilitariananthropocentricbiocentricecocentricethicphilosophyhistorydiscoveryexpeditionvoyagesurveyinventoryfaunabiotabiodiversitylifeearthplanetwildlifeanimalinvertebratearthropodcheliceratearachnidspideraraneomorphentelegynemicryphantidOreoneta2004frigidatype-speciesalpinefeedingtype-specimenclimate-changeprotected-areaSelenomorphini
Selenomorphini is a small tribe of leafhoppers in the family Cicadellidae, subfamily Iassinae. It was established by Evans in 1974 and currently comprises at least six genera including Pachyopsis, Scaroidana, Parapachyopsis, and Uhleriana. The tribe exhibits a disjunct biogeographic pattern, with species occurring in the New World and New Caledonia. Recent taxonomic work has focused on Brazilian fauna, describing new species and genera and providing detailed morphological redescriptions including first illustrations of female genitalia.
Tachyina
Tachyina is a subtribe of small ground beetles (Carabidae: Trechinae: Bembidiini) established by Motschulsky in 1862. Members include diminutive species typically measuring 2–3 mm in body length. The subtribe contains genera such as Tachyura, characterized by distinctive male genitalic morphology and specific puncture patterns on the elytra. Taxonomic revisions continue to clarify species boundaries and the availability of historical infrasubspecific names.
Toxocampinae
Toxocampinae is a subfamily of moths within the family Erebidae, superfamily Noctuoidea. The subfamily was previously classified as the tribe Toxocampini within the former subfamily Catocalinae, but phylogenetic analysis supports its recognition as a distinct subfamily outside the Erebinae (formerly Catocalinae). Males possess a primitive form of genital claspers resembling those found in some Noctuidae subfamilies. The subfamily includes approximately 200 species across six genera, with the genus Lygephila being among the most studied.