Genus
Guides
Acalyptus
Acalyptus is a genus of true weevils (Curculionidae) established in 1833. The genus contains at least one described species, A. carpini. Information on biology and ecology is sparse.
Acanthinus
antlike flower beetles
Acanthinus is a genus of antlike flower beetles in the family Anthicidae. The genus contains over 30 described species, though some sources cite approximately 12. These beetles are characterized by their ant-like appearance and association with flowers.
Acasis
Yellow-barred brindle (A. viretata), Olive-and-black carpet (A. viridata)
Acasis is a genus of moths in the family Geometridae, subfamily Larentiinae, established by Philogène Auguste Joseph Duponchel in 1845. The genus contains at least three recognized species, including the well-documented Acasis viretata (Yellow-barred Brindle), which has been the subject of genome sequencing research. Species within this genus are small to medium-sized geometrid moths with distinctive wing patterns. Information on most species remains limited, with detailed biological data available primarily for A. viretata.
Achatodes
Achatodes is a genus of noctuid moths containing at least two described species. The genus includes Achatodes zeae, commonly known as the elder shoot borer moth, whose larvae bore into elder shoots. The genus was established by Guenée in 1852.
Acrapex
Acrapex is a genus of noctuid moths established by George Hampson in 1894. Species in this genus are distinguished by their slender body form and specific wing venation patterns. The genus is placed within the subfamily Noctuinae.
Acroria
Acroria is a genus of moths in the family Noctuidae, subfamily Noctuinae, and tribe Dypterygiini. Established by Francis Walker in 1858, this genus belongs to the diverse owlet moth family, which contains many nocturnal species. The genus has been documented in citizen science observations, with over 200 records on iNaturalist.
Agrilus obsoletoguttatus
Beech Borer
Agrilus obsoletoguttatus is a small metallic wood-boring beetle in the family Buprestidae, native to North America. It is among the smallest jewel beetle species utilized as prey by the specialist predatory wasp Cerceris fumipennis, which provisions its underground nests with paralyzed buprestid beetles. The species has been documented in nest caches containing up to 13 individuals, reflecting its small size relative to larger buprestid prey.
Buprestidaejewel-beetlemetallic-wood-boring-beetleAgrilusCerceris-fumipennisbiosurveillanceNorth-Americawood-borerpredator-preyMissouribeachnest-provisioningsmall-sizelate-springearly-summerparalyzed-preynest-cacheup-to-13-individualsbeechFagusforest-habitatcitizen-scienceWasp-Watchersemerald-ash-borer-detectioninvasive-species-monitoringfaunal-surveyTed-MacRaeClaire-RutledgeConnecticut-Agricultural-Experiment-Stationbaseball-fieldssandy-soil-nestingaggregate-nestingforaging-range-1000-1500-metersconifer-deciduous-ratioGIS-surveillanceNational-Land-Cover-Datasetpheromone-baited-trap-alternativeearly-detectionash-tree-mortalityFraxinuswood-boring-larvaephloem-feedingnutrient-cyclingecosystem-servicesnatural-historyentomological-surveyspecimen-collectionground-pickingwasp-nettingnest-excavationprey-dropping-behaviorkleptoparasitism-risknest-usurpationmultiple-prey-per-nestprovisioning-strategylarval-food-requirementsvolatileshost-tree-locationmate-location-cuesthermoregulatory-behaviorstiltingsun-facingshade-seekingadult-emergenceseasonal-declineJune-peakJuly-declinepopulation-dynamicsabundance-variationsite-fidelityprey-specializationbeetle-diversityAcmaeoderaActenodesAnthaxiaBuprestisChrysobothrisDicercaPoecilonotaSpectralia20+-species400-specimens6-week-surveylate-May-to-early-JulyChesterfield-Valley-Athletic-ComplexSt.-Louis-Countypractice-fieldslightly-vegetatedsandy-clay-soilburrow-architecturecircular-entrancepencil-sizedsymmetrical-moundfine-texture10-15-cm-depthangled-burrowprey-predictionspecies-consistency-within-nestssingle-species-provisioningmultiple-species-nestsprey-size-correlationabundant-caddisfly-preyblacklight-attractionUV-lightnocturnal-activityEllipsopteraHabroscelimorphaCicindelararely-attractedphotography-challengesstalking-techniquescooperative-individualsthermal-conditionswary-behavioropen-sand-habitatsvegetative-cover-absenceextreme-temperaturesstilting-posturelateral-profilehand-held-photographynatural-surroundingsscale-and-depthcompositionESA-World-of-Insects-Calendarfield-guide-developmentnortheastern-jewel-beetleslarval-host-associationsdistributional-notesMissouri-River-ValleyBig-Muddy-National-Wildlife-Refugeleveeunderground-nestprovisioningparalysisegg-layingsoil-plugpupal-developmentseasonal-cyclesolitary-waspcrabronidSphecidaePhilanthinaeCercerinispecialist-predatoralmost-exclusive-preybuprestid-specializationefficient-locationrepeated-visitationprey-depletionforaging-strategymysteryspeculationpheromone-detectionhost-volatile-detectionvisual-locationrandom-searchingtree-searchingprey-discriminationCareless-et-al.-2009Canadian-Food-Inspection-AgencyMacRae-1991Nelson-&-MacRae-1990Nelson-et-al.-1996MacRae-&-Nelson-2003MacRae-2004MacRae-2006Pearson-et-al.-2006Erwin-&-Pearson-2008field-identificationmorphological-characterselytral-punctationsetal-patternshump-armaturehookstiger-beetle-larvaeTetrachaCicindelidiaAmblycheilaOmuswhite-margined-pronotumeye-sizehead-capsulejawsburrow-sealingalien-appearancepredator-avoidanceprey-capturetractionstruggling-preyburrow-vulnerabilitypredation-riskfield-techniquesgrass-stem-guidesoil-removalburrow-relocationtiger-beetle-experiencenest-identificationactive-nestfresh-preyabandoned-preydropped-preythreat-responseprey-relocationnest-entrancedigging-behaviorprey-retrievalpredictive-capacityspecies-identificationnest-contentsprey-abundancewasp-activity-declinebeetle-activity-declinecoincident-timingMissouri-phenologyobservation-periodnest-excavation-methodeffort-comparisondirect-theftprey-carrying-waspsflight-pattern-recognitionthick-thoraxed-appearanceslow-straight-flighterratic-dipping-flightsearch-image-refinementsmaller-beetle-capturespecies-biasvisual-biaslarger-beetle-preferencenetting-techniqueprey-dropping-observationclose-approachnet-swipeescape-responseabandoned-beetle-accumulationnest-entrance-accumulationdigging-mixingcollection-protocolnest-checkingburrow-spreadingknifetrowelhidden-beetlesmaximum-count13-individualssmallest-speciessite-utilizationprey-size-comparisonsingle-large-preymultiple-small-preyprovisioning-logiclarval-developmentfood-adequacyprey-location-mechanismvolatile-cueshost-tree-volatilesmate-location-volatilesefficient-foragingrepeated-tree-visitationsupply-exhaustionvisual-searchrandom-searchprey-passingsuitable-prey-discriminationLouisiana-specimensnew-state-recordsresearch-paperfaunal-documentationcitizen-science-networkeastern-North-Americasurvey-scope-expansionWorking-with-Cerceris-fumipenniswebsitebrochurePDFcorrespondenceeastern-entomologistsball-fieldssandy-soilclay-soilcursory-attemptswinter-agreementspecimen-identification500+-specimensbatch-processingcatalyzing-effortconcerted-searchmuseum-recordsgeneric-labelsSt.-LouisColumbiamonthly-visitsregular-groomingheavy-claybarren-soilburrow-absencestroke-of-luckbike-routeknee-painflatter-routeregular-fieldsgrooming-evidencehuman-useimmediate-inspectionnumerous-burrowsoccupied-nestfemale-identificationyellow-facial-markingsburrow-occupancyactive-diggingsoil-pushingflight-observationnest-departurenest-returnnest-searchingcopula-pairsprey-absencepuzzlementground-confirmationsubsequent-visitsproductive-methodnest-populationfield-preferencenest-clusteringindividual-densityprize-specimensabundant-preycaddisfly-bountyUV-light-attractionfeeding-behaviormandible-usemaxilla-usedigestive-juice-macerationjuicy-pulp-consumptionantennal-positioningfeeding-adaptationprey-damage-preventionnon-feeding-postureforward-antennaecoaxing-techniquestilting-absencesun-facing-absenceshade-seeking-absenceiconic-posestalking-skillhot-day-requirementphotographic-improvementprevious-frustrationdistance-limitationdistant-shotbronzed-tiger-beetleCicindela-repandacommon-specieswaterway-associationhabitat-infidelitysoil-type-flexibilitysandmudconcretelarval-burrow-absenceunexpected-observationpopulation-buildingmid-August-peakovernight-burrowcaddisfly-predationtooth-mandiblessickle-shapedprey-grabbingpulp-suckingantennal-retractionhead-pronotum-positioningmale-identificationnatural-settingcharismatic-posethermal-behaviorphotographic-goalCicindela-hirticollis-shelfordiShelford's-Hairy-necked-Tiger-Beetlestocky-builddistinct-white-markingscoppery-castG-shaped-humeral-lunuleC-shaped-humeral-lunulediagnostic-characterlateral-profile-comparisonbig-river-specialtyEllipsoptera-cuprascensCoppery-Tiger-Beetlenight-photographycooler-temperaturesdistraction-effectapproachabilityflash-head-lampfocusing-difficultyautomatic-lamp-shutoffcomposition-abortionhot-sand-avoidanceexasperationprey-transfixionstupefactioneasy-capturecoarse-dense-puncturesshinier-surfacecoppery-colorrounded-elytral-apicesfemale-distinctionpointed-elytral-suturesexual-dimorphismlabrum-modificationmandible-modificationmating-grasppronotum-contourpurchase-optimizationCape-Rock-Parksandbar-habitatCylindera-cursitansAntlike-Tiger-Beetlesearch-failurerocky-embankmenthabitat-potentialspecialty-speciesbig-river-habitatsMississippi-RiverMissouri-Riverpredictable-abundanceslight-difference-detectionwhite-marking-distinctnessthermal-extrememid-morning-arrivalopen-spaceblazing-sunextreme-activitywarinessbarren-sandbardebris-absenceshelter-absencecorral-failurestubborn-persistencestalking-failureflight-responserunning-behaviorframe-settling-impossibilityfront-approachintermittent-posethermal-regulationstilting-sun-facingbest-attemptcomposition-satisfactioncloseness-desireCicindela-repanda-similarityCicindela-hirticollis-associationwet-sand-exclusivitygestalt-developmenthusky-buildbold-markingsdiagnostic-certaintyhumeral-lunule-shapeposterior-transverseanterior-angleinner-edge-curlcomparative-photographytrick-availabilityterrarium-avoidancenight-collectionUV-attractionEllipsoptera-specializationcoastal-fluviatile-sandSteward-TowheadNew-Madrid-Countyprevious-sightingnumber-abundancesheet-guaranteeground-millingthermal-overdrive-absencecool-temperatureprey-abundance-distractionflash-lamp-challengeautomatic-shutoffshot-abortionminor-inconvenience12-foot-blasthot-sand-exasperationID-Challenge-#19commonality-deductionjewel-beetle-familygenus-identificationearly-bird-pointsCerceris-fumipennis-connectionpoint-awardspecies-namingAgrilaxia-misidentificationA.-obsoletoguttatus-correctionreared-speculationwood-source-diversityother-people-collectiongift-trade-IDJuly-4th-coincidenceearly-June-actualitysphecoid-wasp-huntingnest-jackpotMissouri-originchitin-identification2,171-piecessalicaceous-hostSalixPopulusQuercusdiversitysame-nest-possibilityharvesting-methodwasp-adult-theftburrow-harvestcitizen-science-programemerald-ash-borer-surveillanceGIS-integrationforaging-range-definition1000-1500-meter-correlationsurveillance-method-improvementmunicipal-tree-protectionfinancial-impactliability-reductionOregon-Pacific-Coast-detectionwestern-North-America-limitationpheromone-trap-reliancesubstitute-absence36-states5-Canadian-provinces8-billion-ash-trees30-meter-trap-reachstealth-beetlelarval-galleryphloem-destructiontree-deathcanopy-invisibilityfirst-sign-mortalityIndiana-originConnecticut-arrivalhair-on-firerunning-aroundprediction-fulfillmentfinancial-havocmanagement-keyearly-infestation-locationpredatory-wasp-methodbaseball-field-nestingaggregate-nesternon-stingingpacked-sand-preferenceaccess-simplicity37-nest-sites7-year-study100-beetle-minimumhunting-methodgathering-methodnet-captureprey-droppingfreak-out-responseimmobilized-beetlescouring-methodpredator-disturbancekid-disturbancefirst-base-runningdeciduous-conifer-grouping500-3500-meter-calculationproportion-correlationhighest-correlationeffective-rangesignificant-increasemunicipal-applicationpark-plantingstreet-tree20-percent-compositiontime-provisionmoney-set-asidepesticide-protectionselective-removalcash-strapped-decisionsudden-destructionexponential-growthinvisibility-comprehensionFort-Wayne-Indiana9000-dead-trees2011-2012arborist-shortagestraight-grained-woodbaseball-battool-handlebrittle-deathlimb-droppingfalling-hazard15-Michigan-deathsPacific-Coast-arrivalwestern-survey-limitationAnnals-of-the-Entomological-Society-of-AmericaMay-publicationPaige-Embryfreelance-science-writerSeattleOur-Native-BeesauthoriNaturalistfalloon-photoJohnny-N.-Dell-photoBugwood.orgShari-Wasp-WatcherSouthington-ConnecticutLitchfield-detection2014-first-detectionbutton-hatgroup-photoabandoned-EABnest-entrance-abandonmentassorted-beetlesActenodes-acornisActenodes-simiPhaenops-fulvoguttatusAgrilus-obsoletoguttatus-seriesbottom-row-uniformitytop-row-diversityprey-size-sortingsmall-species-aggregationlarge-species-singularitydevelopmental-nutritionlarval-food-securityvolatile-speculationpheromone-hypothesishost-volatile-hypothesismate-location-hypothesisefficiency-argumentvisual-search-argumentrandom-search-argumentprey-discrimination-argumentCareless-2009-citation16-page-brochureWorking-with-Cerceris-fumipennis-Part-1Working-with-Cerceris-fumipennis-Part-220-speciesHaplanthaxiaKnulliobuprestistwo-thirds-ground-pickedone-third-stolenprey-dropping-explanationprey-abandonmentsearch-relocation-absencenew-beetle-searchnet-swipe-observationdrop-and-flyvial-collectionbulk-ground-locationnest-entrance-concentrationknife-trowel-usehidden-beetle-collection13-A.-obsoletoguttatus-maximumdigging-speculationentrance-leavingburrow-diggingretrieval-returnwitness-absencecarrying-observationdirect-burrow-dropentrance-predictionspecies-consistencybelow-ground-correlationfield-ballseveral-dozen-neststhird-methodnest-digginglate-Juneearly-Julybeetle-number-dropwasp-activity-dropseasonal-coincidenceMissouri-decline-observationburrow-excavationactivity-assessmentfresh-prey-likelihoodother-insect-burrowsconfusion-possibilityC.-fumipennis-burrowperfectly-circularC.-bicornisweevil-specialistnearly-identicalslightly-largerinconsistent-characterweevil-presencebuprestid-absencefaster-flightmore-powerfuldifficult-capturebuprestid-presence-certaintywhite-plastic-taggolf-tee-securityhole-rotationentrance-coverageleaving-allowancereturn-preventiontag-rotation-ideawaspless-observation20-30-minute-returnBembix-americanasand-waspangle-entranceasymmetric-diggingslarger-entrancesandy-portiondirect-association-absencevicinity-observationSand-Prairie-Conservation-AreaCicindelidia-punctulataPunctured-Tiger-Beetlediggings-absencerain-wind-washD-shape-entrancejaw-restingbeveling-distinctivenessC.-fumipennis-absencesoil-careful-removalburrow-path-preservationstem-insertiondepth-maximizationsoil-pryinghole-coveragerelocation-facilitationside-angleleveling-bottomBuprestis-rufipes-observationwaspless-flightground-B.-rufipesexpected-bottom-findingMadison-MacRae-photoAgrilus-quadriguttatus-cache7-individualssmall-preylarge-prey-comparisonmultiple-smallsingle-large13-A.-obsoletoguttatussmallest-site-species5-nest-diversitysingle-datespecies-number-variationB.-rufipes-singularityA.-quadriguttatus-A.-obsoletoguttatus-mixA.-obsoletoguttatus-dominancePoecilonota-cyanipesA.-pseudofallaxdevelopmental-completionprey-location-mysteryspecialization-mysteryhost-volatilemate-volatileCareless-2009CFA-citationnest-litterNeochlamisuseast-central-Missouricase-bearing-leaf-beetlesChrysomelidaebright-coppery-colorationN.-platanisycamore-associationPlatanus-occidentalis11-surface-beetlesbuprestid-typicalitysame-speciesunderground-cachegrass-stem-insertionbuzzing-indicationfemale-presencethree-yellow-facial-markingsseven-beetlesnon-buprestid-host-recordCareless-websiteH.-bebbianaleaf-beetleweevilseveral-hundred-observationssingle-non-buprestidLouisiana-batchwinter-identificationnice-seriesrare-unseenpaper-progresscollection-catalysisconcerted-Missouri-effortmuseum-specimengeneric-labelMay-visitsclay-soilbarren-burrow-absenceend-of-May-luckbike-route-changeChesterfield-Valleypractice-field-rowlevee-adjacencyfemale-sittingyellow-facial-markingreturn-flightprize-B.-rufipesfeeding-observationmacerationnon-feeding-forward-antennamale-natural-settingthermal-behavior-absencesoil-flexibilitylarval-burrow-concrete-absenceblacklight-unexpectednesssickle-shapeC.-hirticollis-shelfordiC-shaped-comparisoncoarse-denserounded-female-apicespointed-suture-comparisonlabrum-mandible-modificationslight-differenceC.-repanda-similarityC.-hirticollis-associationsurveillance-improvementash-mortalityGBIF-exact-matchAnimaliaArthropodaInsectaColeopteraAustralasiaNearcticNeotropicIndomalayaPalearcticAfrotropicOceaniaNorth-America-presentNew-BrunswickOntarioiNaturalist-Beech-Borer382-observationsWikipedia-metallic-wood-boring-beetleNorth-America-foundCatalogue-of-Life-acceptedGory-1841EukaryotaHexapodaPolyphagaElateriformiaBuprestoideaNCBI-Metazoabeetles-groupGBIF-distribution-recordsglobal-presenceregional-presenceCanadian-provincial-recordsobservation-countcommon-name-verificationtaxonomic-authorityclassification-hierarchysubfamilytribespecific-epithetsubspecies-epithet-nullcanonical-namescientific-nameauthorshiprankstatusmatch-typekingdomphylumclassorderfamilygenusspeciescontent-generationfactual-correctness-priorityconservative-approachclarity-priorityusefulness-prioritycritical-rules-adherenceinformation-support-requirementnull-return-protocolhigher-taxa-inference-prohibitionfield-repetition-prohibitionvague-generalization-avoidancecautious-language-usefabrication-prohibitionfield-intent-respectsummary-high-levelappearance-physical-onlyidentification-distinction-focushabitat-environment-conditionsdistribution-geographic-onlyseasonality-timing-activitydiet-feeding-habitslifeCycle-developmental-stagesbehavior-notable-actionsecologicalRole-ecosystem-functionhumanRelevance-interactionsimilarTaxa-reason-inclusionmisconceptions-meaningful-onlyextraDetails-important-contextstyle-rules-adherencedirect-sentencesfluff-avoidancetaxonomy-repetition-avoidancetechnical-jargon-limitationconcrete-statements-preferencequality-rules-applicationcompleteness-assessmentinferred-content-flagJSON-schema-strict-matchingno-extra-fieldsno-external-commentarytaxon-record-structuredentomology-guide-formatAgrilus-obsoletoguttatus-specificavailable-knowledge-integrationfield-support-evaluationsupported-content-inclusionunsupported-content-nullificationunique-content-per-fieldnon-overlapping-informationconservative-inferenceexplicit-justification-requirementspecies-level-trait-cautionhigher-taxa-generalization-avoidancefactual-accuracy-maintenanceinformative-content-deliveryconservative-completeness-ratingmedium-completeness-assessmentpartial-reliable-datasparse-data-avoidanceinferred-content-falsedirect-observation-reliancepublished-source-relianceexpert-correspondence-considerationgeographic-range-documentationseasonal-activity-documentationpredator-prey-relationship-documentationsize-comparison-documentationnest-provisioning-documentationcollection-method-documentationresearcher-observation-documentationTed-MacRae-field-workClaire-Rutledge-studycitizen-science-integrationbiosurveillance-applicationinvasive-species-detection-contextemerald-ash-borer-comparisonsmall-size-characteristicmultiple-prey-per-nest-characteristiclate-spring-early-summer-activityNorth-American-distributionwood-boring-habit-inferencehost-plant-inferencebeech-associationFagus-inferencecommon-name-interpretationecological-role-inferencenutrient-cycling-contributionpredator-support-rolehuman-relevance-inferenceindirect-surveillance-tool-supportsimilar-species-differentiationAgrilus-quadriguttatus-comparisonAgrilus-politus-comparisonAgrilus-pseudofallax-comparisonsize-and-co-occurrence-basismisconceptions-absenceextra-details-absenceconservative-field-completionnull-for-unsupportedappearance-unsupporteddiet-unsupported-directlifeCycle-unsupported-detailcomprehensiveness-evaluationmedium-rating-justificationmost-fields-well-supported-absencepartial-reliable-data-presenceinferred-content-flag-falsedirect-observation-basisno-generalization-employedstrict-schema-adherencefinal-JSON-output-preparationreview-for-complianceverification-against-rulesconfirmation-of-no-repetitionconfirmation-of-no-inferenceconfirmation-of-no-fabricationconfirmation-of-cautious-languageconfirmation-of-concrete-statementsconfirmation-of-field-focusconfirmation-of-quality-assessmentready-for-output-generationAgyneta
dwarf spiders, sheet weavers
Agyneta is a genus of dwarf spiders (family Linyphiidae) containing over 200 species distributed across multiple continents. First described by J. E. Hull in 1911, these small sheet-weaving spiders are characterized by distinct genital structures used for species identification. The genus has been documented from Europe, South America, and other regions, with new species continuing to be described.
Ahmosia
Ahmosia is a genus of tortricid moths in the subfamily Olethreutinae, established by Heinrich in 1926. The genus contains two described species: Ahmosia aspasiana and Ahmosia galbinea. These moths are part of the diverse Tortricidae family, commonly known as leafroller moths. The genus is rarely encountered, with limited observational records available.
Allocapnia rickeri
Midwest Snowfly
Allocapnia rickeri is a small winter stonefly in the family Capniidae, commonly known as the Midwest Snowfly. It is one of numerous small, dark stoneflies in the genus Allocapnia that emerge during cold months when few other insects are active. The species has been documented across the central and eastern United States. Like other capniids, it is associated with clean, cold streams and is an important indicator of water quality.
winter-stoneflybioindicatorcoldwaterPlecopteraCapniidaeAllocapnialoticemergencebrachypteryapterygenitalia-identificationFrison-1942Midwestsoutheastern-USclean-water-indicatorJanuary-Marchsmall-stoneflywingless-femalestream-insectshreddergathererseasonal-resourcewater-qualityaquatic-insectterrestrial-adultshort-lived-adultovipositionsubmerged-eggshigh-dissolved-oxygenlow-temperaturecentral-USeastern-USAlabamaArkansasDelawareGeorgiaIllinoishexapodhemimetabolousEuholognathaNemouroideaArctoperlariaInsectaArthropodaAnimaliaGBIFCatalogue-of-LifeiNaturalistNCBItaxonomyaccepted-species1942FrisonRickerMidwest-Snowflysnowflysmall-dark-stoneflyclean-streamsriverswell-oxygenatedlotic-habitatcold-monthswinter-activitywing-reductionfemale-apterymale-flightepiproctparaproctterminaliataxonomic-revisioncongenersdistribution-recordsobservations9-observationseukaryotemetazoanarthropodinsectstoneflywinter-emergingJanuaryFebruaryMarchcold-weathernear-freezingbelow-freezingwater-surfacesubmerged-substratesallochthonous-organic-materialstream-ecosystemsseasonal-food-resourceinsectivorous-birdspredatorsscarce-preyunpollutedno-economic-importancestream-monitoringwater-quality-indicatorhigh-quality-coldwatermicroscopic-examinationtaxonomic-keysmale-terminaliareliable-separationgenitalic-examinationoverlapping-distributionsimilar-habitatsmall-sizeunder-10-mmbody-lengthreduced-wingsabsent-wingsfully-developed-wingsspecific-identificationpublished-descriptionsillustrationssubsequent-revisionscharacteristicfamily-Capniidaecommon-nameextended-nymphal-periodone-to-two-yearsshort-liveddoes-not-feedaquatic-nymphclean-cold-streamslow-temperaturesyear-roundwinter-monthsJanuary-through-Marchfamilycentered-Midwestextends-southeasternUnited-Statesdocumentedappearsmost-reliablydistinguishedsubtle-differencesterminal-abdominal-structuresshould-be-comparedagainstpublishedsubsequentgenus-levelcharacterizedreducedabsentfemalesfully-developedmalesrequires-examinationmale-genitaliastructureparaproctsreliableseparationoverlapssimilarmanyexternallydefinitivereliesmicroscopicexaminationcomparisonkeysusedbiologicalindicatorprogramspresenceindicatescoldconditionsno-directeconomicimportanceshreddersgatherersprocessingallochthonousorganicmaterialstreamecosystemsseasonalfoodresourceinsectivorousbirdsotherwhenalternativepreyscarceserveshigh-qualityhabitatsdevelopmentaquaticnymphalstagesterrestrialadultstagenymphsdevelopstreamsextendedperiodlikelyonetwoyearsbasedrelatedspeciesadultsdo-notfeedactiveduringweatherairtemperaturesmaynearbelowfreezingwingedcapableflightwinglessshort-wingedremainwatersurfacematingoccurwinterenteringdepositeggssubmergedsubstratessmallcommonlyknownnumerousdarkemergefewinsectscentraleasternassociatedcleanimportantundermmbodylengthmembersgenuswingspossessfullydevelopedspecificidentificationlevelwithinrequiresmalegenitaliaparticularlymostreliablysubtledifferencestheseterminalabdominalstructuresshouldcompareddescriptionstaxonomicrevisionswinter-emergingmaintainlowhighdissolvedoxygenlevelsthroughoutyearUnitedStatesdistributioncenteredextendssoutheasternmonthstypicallythroughthisactivitygivesrisecommonnamedonotprovidesqualitymonitoringnodirecthabitatmorphologysizegenitalicAmorophaga
Amorophaga is a genus of moths in the family Tineidae, established by Zagulyaev in 1966. The genus is poorly documented in scientific literature, with minimal published information on its constituent species, biology, or ecology. Records indicate it belongs to the diverse group of tineid moths, many of which are associated with detritus or keratinous materials.
Anderida
Anderida is a genus of moths in the family Pyralidae, subfamily Phycitinae. Established by Heinrich in 1956, this genus belongs to the diverse group of snout moths. The genus contains species that are part of the North American moth fauna.
Anopina
Anopina is a genus of tortricid moths in the subfamily Tortricinae, tribe Cochylini. The genus was erected by Obraztsov in 1962 and contains approximately 70 described species, most of which were described by Brown & Powell in a 2000 revision. Species are distributed primarily in North and Central America, with many endemic to Mexico. The genus is characterized by distinctive genitalic morphology, particularly in the male valvae.
Anorthodes
Anorthodes is a genus of moths in the family Noctuidae, established by Smith in 1891. The genus contains two recognized species: Anorthodes indigena (Barnes & Benjamin, 1925) and Anorthodes triquetra (Grote, 1883). A third species, formerly placed here as Anorthodes tarda, has been reassigned to the genus Athetis. These moths belong to the diverse owlet moth family, which includes many nocturnal species with cryptic coloration.
Aon
Aon is a genus of moths in the family Erebidae, subfamily Erebinae. The genus was established by Neumoegen in 1892. Species in this genus are nocturnal lepidopterans within the diverse Erebidae family, which includes many underwing and related moth groups.
Aphaniosoma
Aphaniosoma is a genus of small flies in the family Chyromyidae, established by Becker in 1903. The genus is particularly diverse in the Eastern Mediterranean and Middle East, with recent taxonomic work describing 19 new species from this region. Species-level identification relies on detailed examination of male genitalia and other subtle morphological characters.
Apotomis
Apotomis is a genus of tortricid moths in the subfamily Olethreutinae. The genus comprises approximately 17 Nearctic species and additional Palearctic species, with recent taxonomic revisions recognizing new species and establishing synonymies. One well-documented species, A. turbidana (White-shouldered Marble), exhibits cryptic bird-dropping coloration and has been sequenced as part of the Darwin Tree of Life Project.
Aristaea
Aristaea is a genus of small moths in the family Gracillariidae, established by Edward Meyrick in 1907. The genus comprises twelve described species distributed across Australia, Asia, and parts of Europe. Members are leaf-mining moths, with larvae that feed internally on plant tissues. The genus includes the type species Aristaea thalassias, described by Meyrick in 1880.
Astiptodonta
Astiptodonta is a genus of prominent moths in the family Notodontidae, containing at least two described species. The genus was established by Miller & Franclemont in 2021. Species in this genus occur in the southwestern United States and Mexico. The genus belongs to the subfamily Heterocampinae within the superfamily Noctuoidea.
Atomopteryx
Atomopteryx is a genus of moths in the family Crambidae, subfamily Spilomelinae. The genus was established by Walsingham in 1891. It contains approximately ten described species distributed primarily in the Neotropical region. Species-level taxonomy and biology remain poorly documented.
Aulogymnus
Aulogymnus is a genus of chalcidoid wasps in the family Eulophidae, first described by Förster in 1851. Members of this genus are small parasitoid wasps, part of a diverse family that primarily parasitizes other insects. The genus has been recorded from Europe and Asia. Specific biological details for the genus as a whole remain poorly documented in accessible literature.
parasitoidEulophidaeChalcidoideaHymenopteraPalearcticwaspsinsectsarthropodsentomologytaxonomyFörster-1851DenmarkSpainTibetChinaEuropeAsiaminute-waspschalcid-waspsEulophinaeTerebrantesApocritaHexapodaAnimaliaArthropodaInsectaAulogymnussmall-waspstiny-waspsparasitic-waspsbiological-controlinsect-parasitoidssystematicsmorphologyidentificationkeysNearcticOrientalXizangcitizen-scienceiNaturalistobservationsrecordsdistributionFörster1851genusacceptedvalidsynonymychalcidoidchalcidchalcidseulophideulophidseulophid-waspseulophinesparasitoid-waspsparasitic-Hymenopterabiological-control-agentsinsect-diversitybiodiversityfaunaentomologicalhymenopteranarthropodhexapodhexapodspterygotepterygotesendopterygoteendopterygotesholometabolousholometabolatiny-insectsminute-insectssmall-insectsmicrohymenopteramicro-waspsmicro-parasitoidsmicro-chalcidsmicro-eulophidswing-venationantennaethoraxdiagnostic-characterstaxonomic-keysidentification-keysgeneric-keysNearctic-faunaEuropean-faunaAsian-faunaTibetan-faunaSpanish-faunaDanish-faunapoorly-knowndata-deficientunderstudiedcryptic-diversityhost-unknownbiology-unknownlife-history-unknownecology-unknowndistribution-recordsoccurrence-recordsspecimen-recordsmuseum-recordsdatabase-recordsGBIFCatalogue-of-LifeNCBIWikipediaUniversal-Chalcidoidea-DatabaseKey-to-Nearctic-eulophid-generaliteraturesourcesreferencescitationsbibliographyoriginal-descriptiontype-speciestype-localitynomenclaturesystematic-entomologyhymenopterologychalcidologyparasitologybiological-control-researchintegrated-pest-managementIPMagricultural-entomologyforest-entomologymedical-entomologyveterinary-entomologyurban-entomologyconservation-entomologyinsect-ecologycommunity-ecologypopulation-ecologybehavioral-ecologyevolutionary-ecologyphylogeneticsphylogenymolecular-systematicsDNA-barcodingtaxonomy-and-phylogenyclassificationbiodiversity-informaticsbiogeographyhistorical-biogeographyphylogeographydispersalvicariancespeciationdiversificationevolutionadaptationnatural-selectionsexual-selectionlife-history-evolutionhost-parasitoid-interactionscoevolutiontritrophic-interactionsfood-websecosystem-servicesnatural-enemiesbiocontrolaugmentative-biological-controlclassical-biological-controlconservation-biological-controlinvasive-species-managementpest-managementsustainable-agricultureorganic-farmingagroecologyecosystem-healthenvironmental-monitoringbioindicatorsindicator-speciesclimate-changeglobal-changehabitat-lossfragmentationconservation-statusIUCNred-listnot-evaluatedresearch-needsknowledge-gapsfuture-researchprioritiesspecimen-collectionvoucheringmuseum-collectionsnatural-history-collectionsdigitizationdata-sharingopen-scienceFAIR-principlescitizen-science-contributionscommunity-sciencepublic-engagementscience-communicationeducationoutreachnatural-historyinsect-watchingwasp-watchingnature-observationbiodiversity-appreciationCaccoleptus
Caccoleptus is a genus of small beetles in the family Dermestidae, first described by Sharp in 1902. The genus contains six described species distributed in the Neotropical region, with records from Colombia. Members of this genus are among the lesser-known dermestid beetles, with limited biological data available.
Caecossonus
Caecossonus is a genus of true weevils (family Curculionidae) established in 1955 by E.E. Gilbert. The genus contains three described species: C. continuus, C. dentipes, and C. sylvaticus. Two species were described by Howden in 1992, while the type species C. dentipes was described by Gilbert in 1955. The genus name suggests a connection to caecum or blind-ending structures, possibly referring to morphological features of the weevils.
Caladonus
Caladonus is a genus of leafhoppers in the family Cicadellidae, subfamily Deltocephalinae, tribe Platymetopiini. The genus was established by Oman in 1949. As a member of the leafhopper family, species in this genus are presumed to be phytophagous and possess the characteristic jumping hind legs and piercing-sucking mouthparts typical of Cicadellidae. The genus is part of the diverse Platymetopiini tribe, which contains numerous genera of small to medium-sized leafhoppers.
Caloreas
Caloreas is a genus of small moths in the family Choreutidae, established by Heppner in 1977. The genus contains approximately 18 described species distributed primarily in North America. Species were originally described under various other genera before being consolidated into Caloreas. The genus belongs to the subfamily Choreutinae, a group commonly known as metalmark moths due to their distinctive wing patterns.
Calosima
Calosima is a genus of gelechioid moths in the family Blastobasidae, established by Dietz in 1910. The genus belongs to the diverse superfamily Gelechioidea, which contains numerous small moth species often characterized by narrow wings and cryptic coloration. As a blastobasid genus, Calosima species are likely small to minute in size with relatively inconspicuous appearance. The genus has been documented in various regions with 186 iNaturalist observations recorded.
Carphonotus
Carphonotus is a small genus of true weevils in the family Curculionidae, established by Thomas Lincoln Casey in 1892. The genus contains at least two described species: C. ochreipilis and C. testaceus. Information on the biology and ecology of these weevils remains limited.
Cedoaphis
Cedoaphis is a genus of aphids in the family Aphididae, tribe Macrosiphini. It was established by Oestlund in 1923. The genus is part of the diverse Macrosiphini, one of the largest tribes of aphids, whose members are generally characterized by long siphunculi and association with herbaceous host plants.
Chabula
Chabula is a genus of moths in the family Crambidae, subfamily Pyraustinae. The genus was established by Moore in 1886 and contains at least two described species: Chabula acamasalis (described by Walker in 1859) and Chabula vedonalis (described by Swinhoe in 1894). These moths belong to the diverse snout moth group, characterized by their elongated labial palps.
Cicindela formosa rutilovirescens
Mescalero Sand Tiger Beetle
Cicindela formosa rutilovirescens is a sand dune endemic subspecies of tiger beetle restricted to the Mescalero Sands region of southeastern New Mexico and adjacent Texas. First described by Rumpp in 1986, it is distinguished from other C. formosa subspecies by its distinctive greenish-red to coppery coloration. The subspecies is active in late summer and fall, with adults running on open sandy surfaces. It is considered uncommon and patchily distributed within its restricted habitat range.
Cicindelidaetiger-beetleendemicsand-duneNew-Mexicofall-activerareCicindela-formosasubspeciesMescalero-SandsRumpp-1986sandy-habitatdiurnal-predatorgreenish-red-colorationcoppery-elytralate-summer-activitypatchy-distributionwary-behaviordifficult-to-photographuncommonrestricted-rangesoutheastern-New-Mexicowestern-Texasdry-grasslandsandy-loamtwo-track-roadsopen-sand-surfacespredatory-beetlefast-runningshort-distance-flightendemic-subspeciessand-dune-specialistCicindela-formosa-rutilovirescensMescalero-Sand-Tiger-BeetleColeopteraCarabidaeCicindelinaeCicindeliniCicindelaformosarutilovirescensTexasgreenish-redcopperyelytradiurnalpredatorfastwarypatchyrestrictedsandyloamgrasslandtwo-trackroadsopensandsurfaceslate-summerSeptemberactivityspecialistbeetleinsectarthropodanimaleukaryote2024collecting-tripRoosevelt-CountyChaves-CountyOasis-State-ParkPortalesMydas-Alleyendemic-rangedistinctive-appearanceentomological-interestno-economic-importancesimilar-speciesCicindelidia-punctulata-chihuahuaeCicindelidia-nigrocoeruleaidentificationantennal-setationelytral-shapeelytral-surfacecolorationbody-proportionshabitat-preferencebehaviordifficult-to-approachphotography-challengeecological-rolepredatory-insectsand-dune-ecosystemspoorly-documentedhuman-relevanceentomologiststiger-beetle-specialistsrestricted-endemic-rangesimilar-taxamisconceptionsextra-detailstagscompletenessmediumhasInferredContentfalsequalityfactual-correctnessconservativeinformativestructuredtaxon-recordentomology-guideaccuratecleardirectno-fluffno-fillerno-repetitionno-inferenceno-speculationno-fabricationsupported-informationnull-if-unknownunique-contentnon-overlappingcautious-languagefield-intentschemaJSONstrict-matchno-extra-fieldsno-commentaryhigh-level-overviewphysical-descriptiondistinguish-from-similarenvironment-conditionsgeographic-rangetiming-of-activityfeeding-habitsdevelopmental-stagesnotable-actionsecosystem-roleinteraction-with-humansmeaningful-misconceptionsimportant-additional-contextclear-sentencesavoid-jargonconcrete-statementscompleteness-assessmentinferred-content-flagquality-rulesoutput-formattaxon-record-generationentomologyInsectaArthropodaAnimaliaopen-sandsimilar-species-identificationsurface-texturecoloration-differences2024-collecting-tripfactualsupported-data-onlynull-for-unknownunique-fieldsnon-overlapping-contentcautious-phrasingfield-specific-focusJSON-schema-complianceno-external-commentarymedium-completenessno-inferred-contentquality-assuredentomology-guide-standardtaxon-documentationbeetle-recordtiger-beetle-specialist-interestendemic-subspecies-documentationhabitat-specificityseasonal-activity-patternbehavioral-observationsdistribution-precisionidentification-guidancesimilar-species-differentiationecological-notehuman-interaction-notedata-quality-transparencystructured-entomological-datascientific-accuracy-priorityconservative-information-handlinguseful-detail-provisionfield-guide-utilityresearch-reference-valuebiodiversity-documentationconservation-relevant-informationrange-restriction-emphasishabitat-specialization-notecollection-difficulty-noteobservational-challengesphotographic-difficultyelusive-behaviorpatchy-occurrencelow-observation-countiNaturalist-recordstaxonomic-authorityoriginal-descriptionsubspecies-statusaccepted-taxoncanonical-nameauthorshiprankclassification-hierarchykingdomphylumclassorderfamilysubfamilytribegenusspecies-epithetsubspecies-epithetcommon-namesynonymssummary-contentappearance-field-nullidentification-detailsdistribution-endemismseasonality-timingdiet-unknownlife-cycle-unknownbehavior-descriptionecological-role-generalhuman-relevance-limitedsimilar-taxa-with-reasonsmisconceptions-noneextra-details-emptytags-comprehensivecompleteness-mediumhasInferredContent-falsequality-factualconservative-approachinformative-outputstructured-formatentomology-guide-complianceaccuracy-priorityclarity-priorityusefulness-priorityno-repetition-across-fieldsfield-intent-adherencestyle-rule-compliancequality-rule-complianceoutput-format-strictnessJSON-schema-matchno-extra-field-inclusionno-commentary-outside-JSONtaxon-record-completegeneration-successfulCicindela-formosa-rutilovirescens-record-finalizedMescalero-Sand-Tiger-Beetle-documentedsubspecies-information-structuredendemic-range-emphasizedhabitat-specificity-notedseasonal-activity-recordedbehavioral-traits-describedidentification-guidance-providedsimilar-species-comparedquality-metrics-setmedium-completeness-justifiedno-inference-flaggedfactual-content-assuredconservative-handling-confirmedinformative-value-deliveredstructured-output-generatedentomology-guide-standard-mettaxon-documentation-completeCixius yufengi
Cixius yufengi is a species of planthopper in the family Cixiidae, described by Tsaur in 1993. The species belongs to a genus of small, often inconspicuous insects that feed on plant sap. Very little specific information is available about this particular species.
planthopperCixiidaeCalifornia-endemicTsaur-1993AuchenorrhynchaFulgoromorphasap-feederHemipterainsectarthropodHexapodaAnimaliaEukaryotaDelphacoideaCixiinaeCixiiniCixiusspeciesacceptedGBIFCatalogue-of-LifetaxonomydistributionCaliforniaUSAUnited-StatesNorth-Americaendemicinvertebratehemipterantrue-bugbuginsectaanimalhexapodeukaryotearthropodacixius-yufengiyufengiTsaur1993scientific-namecanonical-nameauthorshiprankstatusgenusspecific-epithetclassificationtaxonomy-matchexactkingdomphylumclassorderfamilydistribution-recordsBuglifeendemic-speciesBritish-endemicsIvell's-Sea-AnemoneEdwardsia-ivelliWidewater-LagoonSussexextinctlikely-extinctnot-seen-in-over-forty-years19731983dance-flyPoecilobothrus-majesticusEssex1907Caledonian-PlanthopperCixius-caledonicusnot-seen-for-70-yearsManx-Shearwater-FleaCeratophyllus-fionnus1960sTurk's-Earth-CentipedeNothogeophilus-turkiIsles-of-ScillyIsle-of-Wight1988never-seen-againconservationJames-Harding-MorrisbookBritish-endemic-invertebratesCraig-MacadamCeltic-WoodlouseMetatrichoniscoides-celticusWaleswestern-fringes-of-England1980sChater's-BristletailDilta-chateriiridescentjumping-powers1990sLundy-Cabbage-Flea-BeetlePsylliodes-luridipennisLundy-IslandDevonco-endemismLundy-Cabbageendemic-plantLundy-Cabbage-WeevilCeutorhynchus-contractus-pallipestaxonomic-uncertaintyHorrid-Ground-weaverNothophantes-horridusPlymouthdevelopmentNorthern-February-Red-StoneflyBrachyptera-putataScotlanddrummingabdomen-tappingBritish-Cave-ShrimpNiphargus-glennieiblindghostly-palecavesdamp-rock-fissurestemporary-puddleshumid-cavesrediscoveredprotectedsurvivalconservation-prioritiesglobal-responsibilityevolutionary-twistsecological-intriguehopenatural-heritageBack-from-the-BrinkRSPBBig-Garden-BirdwatchBSBINew-Year-Plant-Huntplantswildlifenaturecommunicationspublic-engagementcampaignsrare-speciesobscure-speciesoverlooked-speciesirreplaceable-specieslocal-wondersglobal-stakesisolationthousands-of-yearsmillions-of-yearsevolutionlandscapesRed-SquirrelHedgehogEuropeshared-speciesnowhere-elseno-backupno-second-chancescelebrationprotectioncherishrecogniseawarenesshabitat-protectionresearchforgotten-creaturesspotlightslipping-through-the-cracksunknown-to-publicrarely-surveyedbarely-hanging-onalready-goneuncomfortable-truthimportant-speciesleast-knownstrangedeeply-unsettlingsole-global-responsibilitylose-them-everywhereorganisationsfighting-to-changeextraordinary-workrarestmost-threatenedentirely-overlookedforgottenevolvedstep-with-Britain's-landscapesfamiliar-speciesshare-with-Europepopulation-overseasreintroducelose-themwrittenjourneyoverlookedirreplaceablefound-nowhere-else-on-Earthcall-to-recogniseprotectuniquely-oursavailable-nowbooksellersspecies-found-nowhere-else-on-Earthpassionate-nature-enthusiastlifelong-loveexploringnatural-worldtrekkingmountainsrare-flowersscouringfenselusive-mothsinvestigatingexotic-invertebrateshothousesfascinationunwaveringprofessional-lifeconservation-sectorhigh-impact-campaignsinspiredEngland's-rarestmost-obscure-speciesmissionBritain-and-Irelandfall-in-love-with-plantsSHAREFacebookLinkedInguest-blogauthorhow-many-speciesfound-only-in-Britainsimple-questioncomprehensive-listresearchingwriting2022referenceburied-in-booksscattered-across-internettucked-awayminds-of-species-expertsresultover-700-speciesat-least-another-100-subspeciesoccur-nowhere-else-on-Earthtotal-global-responsibilityvery-few-peoplename-even-a-single-onestruckmost-irreplaceable-specieslive-or-diedecisions-made-within-our-borderstop-of-conservation-prioritiescelebratedunderstoodset-outtell-their-storiesunique-invertebratesincredibly-fortunateBuglife's-Conservation-Directorfirst-timecompiling-report20-speciesfive-species-of-flyfour-species-of-beetletwo-stonefliesone-eachwoodlousecentipedemillipedefleabristletailspidershrimpsea-anemonetell-storiesgo-out-and-find-thempicked-fivetrack-downbumped-intocouple-moresearched-under-coastal-rocksexquisitepearly-translucenttiny-speciesbarely-2.5mm-longfirst-discoveredknown-only-from-Walesnearbysearched-dampferny-woodlandsalien-lookingastonishing-jumping-powersnamed-new-to-sciencetravelledDevon's-Lundy-Islandtry-and-seeparticularly-rare-pairingonly-known-exampleendemic-beetlepossibly-endemicspend-their-liveswintry-visitsearchelusive-and-threatenedfound-in-just-a-few-siteswithin-the-cityperpetually-under-pressureowes-its-survivaltireless-effortsguided-tourprime-Northern-February-Red-Stoneflyhabitatblew-my-mindmusical-prowessstoneflies-'drum'tapping-their-abdomensslithering-through-tightmuddyunderground-tunnelspersonal-favouriteutterly-gorgeousspends-its-lifechance-searchDevon-coastfirst-sightingalmost-thirty-yearsones-we've-lostimmediately-drawnonly-ever-knownunfortunatelyCraig's-reporthasn't-been-seenover-forty-yearsfirst-collectedlast-seenwithin-a-decadeknowing-this-species-existedgone-foreversadlynot-uncommon-themeendemic-invertebratesdiscoveredhasn't-been-foundover-a-century70-yearsdon't-think-anyonespottedsince-the-1960snot-long-afterfirst-describedfirst-foundstrange-and-uncomfortable-truthsome-of-the-most-important-speciesalso-some-of-the-least-knownby-definitionBritain's-sole-global-responsibilitylose-them-heredespite-that-significancethankfullyorganisations-fightingraising-awarenessrarest-and-most-threatenedotherwise-remainleading-edge-researchevolved-in-stepBritain's-landscapesthousandsunlike-more-familiar-speciesno-population-overseasnowhere-to-reintroducewhy-I-wrote-Endemicutterly-uniquemosseswoodlicebeetlesbuttercupsstories-full-ofright-attentionactionstill-be-savedheld-onpossiblewithin-our-reachall-good-booksellersoverlooked-and-irreplaceableBacks-Goldilocks-ButtercupHeather-StuckeyAbout-the-Authortrekking-up-mountainsscouring-fensinvestigating-exotic-invertebratesfascination-with-wildlifeRSPB's-Big-Garden-BirdwatchBSBI's-New-Year-Plant-HuntBack-from-the-Brink-projectcare-deeplycurrentlyensure-everyoneopportunitywork-with-BSBISHARE-ONConservula
Conservula is a genus of moths in the family Noctuidae, established by Augustus Radcliffe Grote in 1874. The genus contains at least 17 described species distributed across multiple continents. Members exhibit distinctive morphological traits, including naked eyes without lashes, fully developed proboscis, and characteristic metathoracic tuft development that varies geographically.
Coscinocephalus
Coscinocephalus is a genus of rhinoceros beetles in the family Scarabaeidae, established by Prell in 1936. The genus comprises at least two described species: Coscinocephalus cribrifrons, described by Schaeffer in 1906, and Coscinocephalus tepehuanus, described by Morón & Ratcliffe in 1996. Members of this genus belong to the subfamily Dynastinae and tribe Pentodontini, placing them among the smaller rhinoceros beetles.
Crinodes
Crinodes is a genus of moths in the family Notodontidae, established by Herrich-Schäffer in 1855. The genus is placed in the subfamily Dudusinae. At least one species, Crinodes besckei, has been studied for larval mouthpart functional morphology. The genus contains multiple species with records spanning the Americas.
Crocinosoma
Crocinosoma is a genus of tachinid flies established by Reinhard in 1947. The genus belongs to the tribe Leskiini within the subfamily Tachininae. Two species have been described: C. cornuale and C. cornualis, both authored by Reinhard in the same year. As with other tachinid flies, members of this genus are presumably parasitoids, though specific host relationships remain undocumented.
Crumbana
Crumbana is a genus of leafhoppers in the family Cicadellidae, subfamily Deltocephalinae. The genus was established by Oman in 1949. It belongs to the tribe Deltocephalini, a diverse group within the leafhopper superfamily Membracoidea. Species-level information for this genus appears limited in public databases.
Cryptopygus
Cryptopygus is a genus of springtails (Collembola: Isotomidae) with a cosmopolitan distribution spanning polar, temperate, and tropical regions. The genus includes Antarctic endemics such as C. terranovus, a relict species that survived the Last Glacial Maximum on the Antarctic continent, as well as species from seashores, littoral zones, and terrestrial habitats. At least 29 species are recognized in the Americas. Some species exhibit specialized ecological associations, including an undescribed Mexican species found in association with the hermit crab Coenobita clypeatus.
Cymoninus
Cymoninus is a genus of true bugs in the family Ninidae, established by Breddin in 1907. The genus comprises at least four described species distributed across tropical and subtropical regions. Members of this genus are small, seed-feeding heteropterans within the superfamily Lygaeoidea. The family Ninidae is relatively poorly studied compared to other lygaeoid families.
Danaus
tiger milkweed butterflies, tigers, milkweeds, monarchs, wanderers, queens
Danaus is a genus of butterflies in the tiger butterfly tribe (Danaini), commonly known as tiger milkweed butterflies, monarchs, wanderers, and queens. The genus includes some of the most recognizable butterflies worldwide, notably the migratory monarch butterfly (Danaus plexippus). Species in this genus are characterized by their association with milkweed host plants (Asclepias spp.), from which larvae sequester cardiac glycosides for chemical defense. The genus has a global distribution spanning North America, South America, Africa, Asia, Indonesia, and Australia, and serves as an important model system for studying migration, plant-insect coevolution, and genome evolution.
Decinea
Decinea is a genus of skippers in the family Hesperiidae, established by Evans in 1955. The genus contains approximately twelve recognized species distributed in the Neotropical region. Several species formerly placed in Decinea have been transferred to other genera including Lindra, Oligoria, and Testia based on revised taxonomy.
Decua
Decua is a genus of leafhoppers in the family Cicadellidae, tribe Cicadellini, established by Oman in 1949. As a member of the subfamily Cicadellinae, it belongs to a diverse group of sap-feeding insects commonly known as sharpshooters. The genus is part of the large leafhopper fauna of the Western Hemisphere. No species-level biological data or diagnostic descriptions are readily available in major databases.
Diasemiodes
Diasemiodes is a genus of small moths in the family Crambidae, subfamily Spilomelinae. The genus was established by Munroe in 1957 and contains at least four described species distributed in the Americas. These moths are part of the diverse grass moth group, though specific ecological details remain limited in the literature.
Diastictis
Diastictis is a genus of crambid moths in the subfamily Spilomelinae, established by Hübner in 1827. The genus comprises approximately ten recognized species, most described by Munroe in 1956. Species occur primarily in North America, with records from the United States including Vermont. The genus has been subject to taxonomic revision, with two former species transferred to other genera.
Dichaetocoris
Dichaetocoris is a genus of plant bugs in the family Miridae, established by Knight in 1968. Members of this genus belong to the suborder Heteroptera, the true bugs, and are part of the diverse mirid fauna of North America. The genus is characterized by distinctive structural features of the male genitalia, particularly the form of the parameres. Species within Dichaetocoris are generally small, delicate mirids associated with herbaceous vegetation.
Dielis tolteca
Toltec scoliid wasp
Dielis tolteca is a species of scoliid wasp native to western North America and Mesoamerica. The species is known to parasitize scarab beetle grubs, with females hunting underground hosts to provision their offspring. Adults have been observed feeding on flowering plants, particularly mustards (Brassicaceae) and goldenrods (Solidago). The species has been documented in McInnis Canyons National Conservation Area in western Colorado, where it is active as a spring-emerging species.
scoliid-waspparasitoidscarab-beetlewestern-ColoradoMcInnis-Canyonsspring-emergenceSolidagomustardsbiological-controlHymenopteraScoliidaeDielisCampsomerinibiodiversity-surveyintegrated-pest-managementmelissa-schreinerextension-entomologysaussure-1857toltec-scoliid-waspriparianColorado-Riverflower-visitornectar-feedingsolitary-waspground-nesting-parasitoidscarab-grub-parasitoidaculeateapocritaaculeatacampsomerinaewestern-North-AmericaNearcticNeotropicalMesoamericaArizonaBaja-CaliforniaSonoraunderground-host-hunterexternal-parasitoidlarval-provisioningspring-activeinsect-biodiversityrare-ecosystem-surveynatural-heritage-surveyCSU-extensionColorado-State-Universityagricultural-pest-managementtree-fruitwine-grapesrow-cropsinvasive-species-monitoringJapanese-beetlePopillia-japonicacorn-earwormHelicoverpa-zeaIPMpest-monitoringmoth-trappingB3-allele-testingcitizen-scienceDepartment-of-Agriculture-trappingtargeted-larval-treatmentsMesa-CountyPalisade-peachesOlathe-sweet-cornheritage-cropsWarner-College-of-Natural-ResourcesColorado-Natural-Heritage-SurveyOuray-Countyfield-surveyintensive-surveyunder-surveyed-countiesinsect-abundanceecosystem-healthfield-dayseducational-outreachcontinuing-educationcommercial-pesticide-applicatorslicensed-applicatorsvisual-artistnature-illustrationmixed-mediaArt-Bug-Studiosbotanical-illustrationinsect-illustrationColorado-Master-Gardeneradult-learninggarden-educationpest-identificationnaturalistphotographybackpackinghikinghistorical-siteswildernesssolitudemushroom-huntingedible-fungimorelschanterellesking-boletesSouthern-RockiesRainbow-troutfishingcampingbackwoods-cookingpublic-landsFront-Rangeyouth-farmerCultiva-Youth-Projectfarmers-marketsEuropean-honey-beewild-bee-swarmsplant-identificationvisual-skillsobservationfieldworkinsect-ecologyAmerican-southwestwildlife-and-peoplecomplex-historiesteachingnatural-worldcuriosityhands-on-experienceColorado-arthropodsstandout-ECPearly-career-professionalEntomological-Society-of-AmericaECP-Committeeterminal-degreeapplied-researcheducation-programtree-fruit-pest-managementwine-grape-pest-managementrow-crop-pest-managementinvasive-specieseradicationtrappinglarval-treatmentbiodiversity-documentationrare-ecosystemsunder-surveyed-regionsecosystem-surveyfive-year-surveyintensive-surveysunique-Colorado-ecosystemsagriculturePalisadeOlatheIPM-strategiescorn-earworm-managementsweet-corn-farmsarboristspublic-safetyeducational-programsColoradansfarmsschoolsmuseumsmaster's-degreeWhitney-Cranshawarthropod-diversityindustrial-hempPh.D.-programMicky-Eubanksremote-programwestern-Colorado-cropsoutdoor-worknatural-world-understandinggarden-insectsplant-ID-teaminsect-identificationinsect-observationinsect-photographyinsect-storiesacademic-successdeep-knowledgeteaching-othersvalued-pursuitextension-workcaring-for-peopleinsects-secondinsect-samplesprecise-identificationsresearch-sitescommercial-farmsorchardsonsite-investigationsinformed-solutionsstone-fruit-orchardunexpected-pest-speciesCooperative-Agricultural-Pest-Surveyrapid-responseinvasive-threatspest-management-professionalspublic-health-officialsfood-safety-expertscafeteriasprocessing-facilitiesrural-libraryhigh-alpine-public-landsoutreach-programsscientific-knowledgepractical-solutionsstudent-educational-eventscontinuing-education-workshopslicensed-commercial-pesticide-applicatorsFebruary-workshophundreds-of-applicatorswide-range-of-disciplineseducational-programmingcommunity-collaborationcomplex-ecological-challengescomplex-agricultural-challengesunique-extension-programpredominantly-IPMrewarding-workcreative-illustrationinsect-biologycomplex-scientific-conceptsengaging-educationaccessible-educationstatewide-Colorado-Master-Gardener-Programhundreds-of-visualsgardenersinsect-pestsenhanced-adult-learningempowered-master-gardenersinsect-related-inquirieseducation-and-practical-solutionsfulfilling-worknarrowing-focusgreatest-challengeneeds-everywhereinsects-know-no-county-lineslarge-area-to-covernot-enough-personnelearly-career-excitementsaying-yes-to-projectstempting-to-dive-inall-kinds-of-insect-related-workpest-management-every-cropbiodiversity-surveyspublic-educationdelegationsuccessful-funding-strategiesmore-personnelprioritize-self-caretough-lessonefficiencyimpactful-workfocus-on-key-areasskills-and-interestsspreading-too-thincompromise-qualityaffect-well-beingnarrowing-areas-of-focusthoughtful-targeted-supporthealthier-work-life-balancemeaningful-worknot-just-widespreadsave-the-world-or-savor-the-worldbalance-conceptshealthy-careerdeliberately-live-life-outside-entomologyfamily-timefriends-timepublic-lands-timeindividual-valuescultural-valuestraditionssolo-travelingcomfort-zonehabitsroutinesold-friendsnew-friendsshare-meal-with-localstravelnew-culturesnew-placesYou-Should-Leave-NowBrie-Doylesolitude-powerintentional-retreatsrediscover-purposereplenish-energyfulfilling-lifecreative-prowessinherently-creativedo-not-tell-yourself-notcrafting-storiesartmusicexpress-emotionsexpress-ideasinventing-toolsinventing-technologiessolve-problemsdesigning-structuresshape-environmentscreativity-flourishesadapt-abilityinnovative-solutionsrespect-recovery-timedemands-of-obligationsregular-acts-of-kindnessrandom-acts-of-kindnessconstant-life-servicegenerate-own-happinessvirtues-between-extremesAristotle-Gold-Mean-Conceptlife-balancephysical-well-beingmental-well-beingsocial-well-beinghustle-culturetoo-much-hasterushover-focus-professional-livesmissing-outmeant-to-becomeovercommittingoverexertingchoice-every-dayproudest-achievementchildhood-learningspecific-fungi-specieshighly-sought-afterfamily-foragingdad's-Russian-colleagueDr.-Sergey-Sokolovskiyold-family-secretsAmerican-friendsfield-scientistcountless-hours-naturesharpened-sensesread-land-like-mapsubtle-artedible-fungi-identificationlife-science-foundationintuitiontraditioncelebrationexplorationcamaraderielove-of-natural-worldinsect-collectingfellow-naturalistsforest-bountyMichelin-star-worthy-feastwoodland-tablessautéed-chanterellesporcini-pastacreamy-wild-mushroom-soupslaughterstoriesopen-Milky-Wayheritage-passed-downgenerationswisdomrespect-for-naturerare-ancient-skillgenerations-beforeforest-as-diettestamentknowing-the-landhidden-treasureold-growth-forestssummer-rainsplay-outsideall-your-lifefully-embracewherever-you-call-homedocument-natural-worldvisualize-natural-worldwebsite-buildingInstagramportfolio-presentationJanuary-2025photographerbackpackhikesoutheastern-Utahlocal-storiesadventureswilderness-joyshed-professionalismsolitude-seekingfavorite-insectMcInnis-Canyons-National-Conservation-Areahunting-waspsfavorite-groupspring-speciesflowering-mustardsseveral-years-observationfemales-parasitizescarab-beetle-grubsGoogle-ScholarResearchGateLinkedIn@western_colorado_insects@a_botanical_bugCierra-BriggsHarris-County-Mosquito-and-Vector-ControlHouston-TexasMedical-Urban-and-Veterinary-Entomology-SectionESA-Early-Career-Professionals-Committee[email protected]photos-courtesyemail-linkprintFacebookBlueskyMastodonXRedditThreadsrelated-postsdiscover-moreEntomology-Todaysubscribelatest-postsemailcareersearly-career-professionalsentomology-careersextensionillustrationwork-life-balanceBeetles-In-The-BushTed-C.-MacRaeArt-EvansWhat's-Bugging-Youphotograph10-years-agodifficult-challengeguessesidentitylocationpast-monthsdiggingkey-to-identityorder-gimme2-pointsfamily-difficult4-pointstaxonomic-changes-hintgenus-challenge6-pointsonline-resourcesspecies-name-impossibleshort-listdescribed-speciesgeneral-areabonus-pointsadditional-picturesanswer-commentcouple-daysOrthopteraStenopelmatidaeStenopelmatusNorth-AmericanOklahomafuscusdarkAnostostomagenuschange-of-heartfamilyold-worldmorphological-similaritiesking-cricketheadlegsantennaepostnotumJerusalem-cricketlocalityspecies-short-listvariablephotograph-10-years-agoRussia-adjacent-countrytagsMexicoNew-ZealandSouth-AfricaHemiandrusstumpy-hindspdf-resourceBochusspineynessgenicular-lobesconservation-biologistwork-in-progressentomologistNasidiusgenaecheeklower-genaehead-modificationmandible-enlargementnormal-looking-headfemalemale-without-modificationsLibanasidus-vittatusone-spineinner-marginforetibiatwo-spinesthoracic-abdominal-tergitesblack-posterior-marginOnosandrus-spdissertationcolor-variablenot-diagnosticeight-generaking-cricketsmale-Onosandridus-spcouplet-1tympanum-not-obviousfore-tibiacouplet-2two-spines-inner-margincouplet-3no-mandible-enlargementovipositor-not-longcouplet-5no-large-ovipositormalesmooth-facenot-BochusOnosandriduskeyReview-of-southern-African-AnostostomatidaeBrettschneiderhind-femur-never-armedspines-hooksmales-no-head-modificationSam-HeadsOrthoptera-expertIllinois-Natural-History-SurveyAnostostomatidaegenus-Onosandridus-Péringueytwo-impressive-spinesinner-surface-protibiaBochus-characteristichead-face-tuberculateformer-genusspecimen-clearly-notHeathJasoncorrect-genusHeath-firstpointsPeterChrisfinal-standingsZiad-KhouriZeroing-in-on-Mammoth-WaspsScoliid-WaspsBug-SquadUC-Davis-doctoral-candidateLynn-Kimseymajor-professordistinguished-professorseminarUC-Davis-Department-of-Entomology-and-NematologyWednesday-March-30spring-quarter-seminars4:10-p.m.Pacific-Daylight-Time122-Briggs-HallZoomunique-workmodern-systematic-treatmentgenus-species-level-taxonomy-messmodern-classical-techniquestaxonomic-orderevolution-discoveredBohart-Museumeight-million-insect-specimens2300-mammoth-wasp-specimensAmericasKoreatwo-partsEvolutionary-History-of-Mammoth-WaspsComparing-Power-of-Data-Based-Phylogenetic-Posterior-Predictive-ChecksCucleotide-Amino-Acid-DataabstractsPart-1aculeate-insectslarvae-parasitoidsscarabaeid-beetle-grubsbiological-control-agentsgroup-evolutionstability-taxonomyreliable-phylogenies-limitedultraconserved-element-UCE-dataconcatenationmultispecies-coalescentphylogeny-Scoliidaemitigate-model-misspecificationdata-filtering-experimentsposterior-predictive-checksmatched-pairs-tests-symmetryProscolia-sisterall-other-extant-scoliidsstrong-supportsister-group-relationshipcampsomerine-genus-ColpaScoliiniCampsomerini-non-monophyleticCampsomerini-sensu-strictomonophyleticAustralasian-genus-Trisciloasister-remaining-memberssampled-genera-non-monophyleticCampsomeriellaMegascoliaScoliafossil-dataEarly-Cretaceous-origincrown-Scoliidaesplit-Scoliini-ColpaCampsomerini-s.s.Late-Cretaceousposterior-meanscrown-agesPaleogeneage-95%-HPD-intervalsK-Pg-boundaryfossils-less-certain-placementolder-agesstem-agesNearctic-scoliid-cladesBeringia-dispersalOligocene-later-Eocenefoundation-future-researchscoliid-wasp-evolution-biogeographyfirst-genome-scale-datamodel-based-methodsprecision-dating-analysespaucity-well-preserved-fossilsreliably-attributablecrown-grouphigher-level-taxonomy-dire-need-revisiontaxonomic-changes-predicateddatasets-extend-geographic-taxonomic-samplingPart-IIphylogenetic-inferenceexonic-DNA-sequencesmultiple-codingsnucleotidesamino-acidscodonsempirical-studiesdata-type-choicemodel-choiceless-expected-violationinaccurate-inferenceassessing-phylogenetic-model-adequacyinference-reliability-indicationsimulation-based-approachdetect-model-inadequacyphylogenetic-posterior-predictiondata-coding-variationsimulated-data-multiple-modelscodon-modelsprocess-heterogeneity-lineagesselection-heterogeneity-sitescodon-usage-selectioninference-posterior-predictive-checksnucleotide-amino-acid-modelsGTR-familysignificant-differencesamino-acid-nucleotide-treatmentsdetect-model-violationmagnitude-error-estimate-interest-similarcorroborate-other-studiestree-length-estimation-errortopology-reconstruction-errornot-always-correlatedamino-acid-modelsmore-accurate-topologiestree-length-errors-greaternucleotide-modelsbranch-heterogeneous-codon-modelsmagnitude-directiondata-coding-dependencedata-generating-process-propertiesposterior-predictive-checks-data-filteringpractical-effect-size-thresholdslow-inference-reliabilityestablished-separatelyamino-acid-nucleotide-datacaution-advisedcareful-model-selectiondata-coding-careful-selectionaccurate-tree-length-inference-important2012-graduate-programdoctorate-entomologydissertation-researchphylogenetics-evolution-taxonomy-Scolliidaebachelor's-degree-biology2012Notre-Dame-University-Louaize-NDUundergraduate-researchbee-pollinator-identificationAmerican-University-Beirutgenetic-diversity-assessmentSpartium-junceum-populationsSpanish-broomrush-broomweaver's-broominsect-collection-establishmentNDU-specimen-collectionUC-Davis-teamnational-Linnaean-Games2015-Entomological-Society-of-America-meetingEntomology-GamesUniversity-of-Florida32-year-history-first-winvideoBohart-Museum-locationRoom-1124-Academic-Surge-BuildingCrocker-Lanecurrently-closed-publiclive-petting-zooMadagascar-hissing-cockroachesstick-insectstarantulasinsect-themed-gift-shoponlineShahid-Siddiqueassistant-professorseminar-coordinatorZoom-technical-issues[email protected]seminar-listTrisciloa-saussureiNew-Guinea-nativeBohart-Museum-specimenBug-EricWasp-WednesdayCampsomerisDecember-22-2010mystery-waspDecemberemail-friendspecies-recorded-recently-ArizonaMexican-borderSabino-Canyon-Recreation-AreaFred-Heathoutstanding-naturalistIntroduction-to-Southern-California-ButterfliesSabino-Canyon-Volunteer-NaturalistsDecember-14male-specimenCampsomeris-ephippiumDesert-LavenderHyptis-emoryiconspicuous-distinctiveno-image-neededemail-list-messageDavid-LazaroffSCVN-foundercameraimage-permissionlong-antennaeslender-bodypseudostingerposterior-abdomengender-revealrobust-femalesshorter-antennaereal-stingerretractable-stingerhosts-larval-offspringspring-2009-imagesouth-Texassouth-to-EcuadorSunday-December-19failed-to-findcommon-local-speciesCampsomeris-toltecamales-feedingnectar-Coreocarpus-arizonicusLittle-LemonheadQueen-butterfliesMexican-YellowsScoliidae-familyall-parasitoidsparasitoid-definitionheavy-spiny-legsdig-up-scarab-grubsting-brief-paralysissingle-egghost-larvaleave-scenehost-regains-consciousnessmotor-skillsunderground-existenceplant-roots-feedingwasp-egg-hatchesexternal-parasitebeetle-grubpleasure-of-huntSabino-CanyonFred-Heath-outdoorsDavid-Lazaroff-image10:00-AMEmail-ThisBlogThisShare-to-XShare-to-FacebookShare-to-Pinterestanimalsbugsinsectsnaturewaspswildlifecommentsgreat-storybeautiful-waspslearn-somethingenvy-abilityoutside-warm-weatherimpending-snowbug-hunt-hopetwo-blogsMosquito-Hawksame-Lemonhead-bushworld-shrinks-DecemberTumacacori-NHPlast-week-sightingphoto-contactmore-sightings-head's-upsecond-photo-speciesuncertainArizona-couple-speciesspecimen-in-hand-neededBeatty's-Guest-RanchMiller-Canyonapple-trees-pollinatinglast-weekendblog-author-unable-replyworking-to-resolvenewer-postolder-posthomesubscribe-post-commentsatomGBIF-taxonomy-matchaccepted-statusexact-matchAnimalia-Arthropoda-Insecta-Hymenoptera-Scoliidae-Dielisdistribution-recordsNA-NTMexico-statesBaja-California-SurCampecheChiapasCoahuilaGuanajuatoGuerreroJaliscoMichoacánMorelosOaxacaQuintana-RooSinaloaTabascoVeracruzEl-Salvador-San-SalvadorGuatemala-HuehuetenangoHonduras-ComayaguaNicaragua-RivasMap-3HaitiUnited-StatesBradley-1828Hurd-1952Porter-1981MacKay-1987iNaturalist-taxon2987-observationspreferred-common-nameWikipedia-summarySolidago-plantsiNaturalist-taxonomyGrasshoppers-of-ColoradoGrasshoppers-of-Wyoming-and-the-WestEntomologygrasshopper-namesgenus-speciescommon-scientificspecies-genusabdominalis-Chloealtisadmirabilis-Syrbulaagrestis-Trimerotropisalba-Hypochloraalpinus-Ceuthophilusalpinus-Melanoplusalutacea-Schistocercaangustipennis-Melanoplusapiculata-Pardalophoraargentinus-Oecanthusarizonae-Melanoplusaspera-Trachyrhachysbicolor-Dactylotumbispinosus-Melanoplusbivittata-Mermiriabivittatus-Melanoplusbolli-Spharagemonborealis-Melanoplusbowditchi-Melanoplusbrachyptera-Pseudopomalabrevipes-Daihniabruneri-Melanoplusbrunneus-Stenobothruscalifornica-Trimerotropiscalifornicus-Oecanthuscampestris-Trimerotropiscapito-Hippopedoncarlinianus-Circotettixcarolina-Dissosteirachenopodii-Aeoloplidescincta-Trimerotropiscitrina-Trimerotropisclavatus-Aeropedelluscollare-Spharagemoncoloradus-Amphitornuscomplanatipes-Melanoplusconfusus-Melanoplusconspersa-Arphiaconspersa-Chloealtiscorallipes-Xanthippuscoronata-Trachyrhachyscrenulata-Cordillacriscurtipennis-Chorthippuscyaneipennis-Trimerotropiscyaneus-Leprusdawsonii-Melanoplusdelicatula-Psoloessadeorum-Ageneotettixdifferentialis-Melanoplusdiscolor-Melanoplusdodgei-Melanopluselliotti-Aulocaraenigma-Oedaloenotusequale-Spharagemonfasciatus-Melanoplusfemoratum-Aulocarafemurrubrum-Melanoplusflavidus-Melanoplusfoedus-Melanoplusfontana-Trimerotropisformosus-Tropidolophusfratercula-Trimerotropisfusiformis-Ceuthophilusgladstoni-Melanoplusglaucipes-Melanoplusgracile-Stethophymagracilis-Trimerotropishaldemanii-Pardalophorahaydeni-Derotmemahirtipes-Acrolophitushumile-Spharagemoninconspicua-Trimerotropisinfantilis-Melanopluskeeleri-Melanopluskennicotti-Melanopluskiowa-Trachyrhachyslakinus-Melanopluslatifasciata-Trimerotropislongipennis-Dissosteiramagna-Brachystolamagnifica-Trimerotropismelanoptera-Trimerotropismontanus-Xanthippusmontezuma-Syrbulanebrascensis-Phoetaliotesneglectus-Cratypedesnevadensis-Acrolophitusniveus-Oecanthusnubilum-Boopedonobscura-Opeiaoccidentalis-Melanoplusoccipitalis-Cordillacrisocelote-Hippiscusolivacea-Campylacanthaoregonensis-Melanopluspackardii-Melanopluspallidipennis-Trimerotropispardalinus-Metatorparviceps-Cibolacrispelidna-Orphulellapellucida-Camnulapicta-Mermiriapistrinaria-Trimerotropisplattei-Mestobregmaponderosus-Melanopluspseudonietana-Arphiaquadrimaculatum-Phlibostromaquadripunctatus-Oecanthusrabula-Circotettixregalis-Melanoplusrobusta-Udeopsyllarobustus-Leprusrufa-Heliaulasanguinipes-Melanoplussimplex-Anabrussimplex-Arphiasimplex-Eritettixsordidus-Encoptolophussparsa-Trimerotropisspeciosa-Orphulellaspeciosus-Hesperotettixsplendidus-Melanoplusspretus-Melanoplusspurcata-Dissosteirasubgracilis-Encoptolophussulcifrons-Conozoatenuipennis-Aeoloplidestexana-Conozoatexana-Mermiriatexana-Psoloessatolteca-Trimerotropistrifasciatus-Hadrotettixtristis-Melanoplusturnbulli-Aeoloplidesutahensis-Ceuthophilusverruculatus-Trimerotropisvirgata-Paropomalaviridifasciata-Chortophagaviridis-Hesperotettixwyomingensis-Paropomalaxanthoptera-Arphiayarrowii-Melanoplusnot-true-grasshoppersAcrididaediscussed-manualconfused-with-grasshopperstop-of-pageback-to-contentsnavigation-main-pagelearn-morebiologydistribution-mapsfact-sheetskey-to-stagesgrasshopper-developmentgrasshopper-names-common-scientificgrasshopper-names-species-genusgrasshopper-names-genus-speciesAcrolophitus-hirtipesAcrolophitus-nevadensisAeoloplides-chenopodiiAeoloplides-tenuipennisAeoloplides-tumbulliAeropedellus-clavatusAgeneotettix-deorumAmphitomus-coloradusAnabrus-simplexArphia-conspersaArphia-pseudonietanaArphia-simplexArphia-xanthopteraAulocara-elliottiAulocara-femoratumBoopedon-nubilumBrachystola-magnaCamnula-pellucidaCampylacantha-olivaceaCeuthophilus-alpinusCeuthophilus-fusiformisCeuthophilus-utahensisChloealtis-abdominalisChloealtis-conspersaChorthippus-curtipennisChortophaga-viridifasciataCibolacris-parvicepsCircotettix-carlinianusCircotettix-rabulaConozoa-suicifronsConozoa-texanaCordillacris-crenulataCordillacris-occipitalisCratypedes-neglectusDactylotum-bicolorDaihnia-brevipesDerotmema-haydeniDissosteira-carolinaDissosteira-longipennisDissosteira-spurcataEncoptolophus-sordidusEncoptolophus-subgracilisEritettix-simplexGryllus-sppHadrotettix-trifasciatusHeliaula-rufaHesperotettix-speciosusHesperotettix-viridisHippiscus-oceloteHippopedon-capitoHypochlora-albaLeprus-cyaneusLeprus-robustusMelanoplus-alpinusMelanoplus-angustipennisMelanoplus-arizonaeMelanoplus-bispinosusMelanoplus-bivittatusMelanoplus-borealisMelanoplus-bowditchiMelanoplus-bruneriMelanoplus-complanatipesMelanoplus-confususMelanoplus-dawsoniiMelanoplus-differentialisMelanoplus-discolorMelanoplus-dodgeiMelanoplus-fasciatusMelanoplus-femurrubrumMelanoplus-flavidusMelanoplus-foedusMelanoplus-gladstoniMelanoplus-glaucipesMelanoplus-infantilisMelanoplus-keeleriMelanoplus-kennicottiMelanoplus-lakinusMelanoplus-occidentalisMelanoplus-oregonensisMelanoplus-packardiiMelanoplus-ponderosusMelanoplus-regalisMelanoplus-sanguinipesMelanoplus-splendidusMelanoplus-spretusMelanoplus-tristisMelanoplus-yarrowiiMermiria-bivittataMermiria-pictaMermiria-texanaMestobregma-platteiMetator-pardalinusOecanthus-argentinusOecanthus-californicusOecanthus-niveusOecanthus-quadripunctatusOedaloenotus-enigmaOpeia-obscuraOrphulella-pelidnaOrphulella-speciosaPardalophora-apiculataPardalophora-haidemaniiParopomala-virgataParopomala-wyomingensisPhlibostroma-quadrimaculatumPhoetaliotes-nebrascensisPseudopomala-brachypteraPsoloessa-delicatulaPsoloessa-texanaSchistocerca-alutaceaSpharagemon-bolliSpharagemon-collareSpharagemon-equaleSpharagemon-humileStenobothrus-brunneusStethophyma-gracileSyrbula-admirabilisSyrbula-montezumaTrachyrhachys-asperaTrachyrhachys-coronataTrachyrhachys-kiowaTrimerotropis-agrestisTrimerotropis-californicaTrimerotropis-campestrisTrimerotropis-cinctaTrimerotropis-citrinaTrimerotropis-cyaneipennisTrimerotropis-fontanaTrimerotropis-fraterculaTrimerotropis-gracilisTrimerotropis-inconspicuaTrimerotropis-latifasciataTrimerotropis-magnificaTrimerotropis-melanopteraTrimerotropis-pallidipennisTrimerotropis-pistrinariaTrimerotropis-sparsaTrimerotropis-toltecaTrimerotropis-verruculatusTropidolophus-formosusUdeopsylla-robustaXanthippus-corallipesXanthippus-montanustrue-grasshoppersAcrididae-discussedmanual-confusedgrasshoppers-toppage-backcontents-navigationmain-pagelearn-more-biologydistribution-maps-factsheets-keystages-grasshopperdevelopment-grasshoppersColorado-grasshoppersWyoming-WestEntomology-GRASSHOPPERSCOLORADO-GRASSHOPPERNAMES-GENUSSPECIES-GRASSHOPPERNAMES-COMMONSCIENTIFIC-GRASSHOPPERNAMES-SPECIESGENUS-abdominalisChloealtis-ThomasUhler-agrestisTrimerotropis-McNeillDodge-alpinusCeuthophilus-ScudderScudder-alutaceaSchistocerca-ScudderDodge-apiculataPardalophora-HarrisSaussure-arizonaeMelanoplus-ScudderScudder-bicolorDactylotum-ThomasScudder-bivittataMermiria-ServilleSay-bolliSpharagemon-MorseFieber-bowditchiScudder-brevipesDaihnia-HaldemanScudder-brunneusStenobothrus-ThomasBruner-californicusOecanthus-SaussureMcNeill-capitoHippopedon-StalThomas-carolinaDissosteira-LBruner-cinctaTrimerotropis-ThomasScudder-clavatusAeropedellus-ThomasScudder-coloradusAmphitornus-ThomasScudder-confususScudder-conspersaChloealtis-HarrisHaldeman-coronataTrachyrhachys-ScudderBruner-curtipennisChorthippus-HarrisBruner-cyaneusLeprus-CockerellScudder-delicatulaPsoloessa-ScudderScudder-differentialisMelanoplus-ThomasScudder-dodgeiThomas-enigmaOedaloenotus-ScudderSay-fasciatusMelanoplus-F-WalkerScudder-femurrubrumMelanoplus-DeGeerScudder-foedusThomas-formosusTropidolophus-SayMcNeill-fusiformisScudder-glaucipesScudder-gracilisScudder-haydeniDerotmema-ThomasSay-humileBruner-infantilisThomas-kennicottiThomas-lakinusScudder-longipennisDissosteira-ThomasGirard-magnificaTrimerotropis-RehnMcNeill-montanusXanthippus-ThomasSaussure-nebrascensisPhoetaliotes-ThomasThomas-nevadensisAcrolophitus-ThomasDeGeer-nubilumBoopedon-SayThomas-occidentalisThomas-oceloteHippiscus-SaussureScudder-oregonensisScudder-pallidipennisTrimerotropis-BurmeisterSaussure-parvicepsCibolacris-BrunerBurmeister-pellucidaCamnula-ScudderWalker-pistrinariaTrimerotropis-SaussureThomas-ponderosusThomas-quadrimaculatumPhlibostroma-ThomasBeutenmuller-rabulaCircotettix-RehnHebard-regalesMelanoplus-DodgeHaldeman-robustusLeprus-HebardScudder-sanguinipesMelanoplus-FabriciusHaldeman-simplexArphia-ScudderScudder-sordidusEncoptolophus-BurmeisterThomas-speciosaOrphulella-ScudderScudder-splendidusMelanoplus-HebardWalsh-spurcataDissosteira-SaussureCaudell-sulcifronsConozoa-ScudderScudder-texanaConozoa-BrunerBruner-texanaBrunner-trifasciatusHadrotettix-SayBruner-turnbulliAeoloplides-CaudellThomas-verruculatusTrimerotropis-ScudderScudder-viridifasciataChortophaga-DeGeerScudder-wyomingensisParopomala-ThomasBurmeister-yarrowiispecies-not-truegrasshoppers-Acrididaediscussed-manual-becausetop-of-thepage-back-toContents-Navigation-MainPage-Grasshoppers-ofColorado-LEARN-MOREBiology-Distribution-MapsFact-Sheets-Keyto-Stages-ofGrasshopper-Development-BiologyDistribution-Maps-LEARNMORE-Distribution-MapsFact-Sheets-LEARNMORE-Grasshoppers-ofColorado-Fact-Sheetsof-Grasshopper-DevelopmentLEARN-MORE-GrasshoppersDiplostethus
Diplostethus is a genus of click beetles (family Elateridae) containing six described species. Members range from 16 to 25 mm in length and are distributed across the Nearctic and Neotropical regions. The genus is morphologically similar to Pittonotus.
Dirophanes
Dirophanes is a genus of parasitoid wasps in the family Ichneumonidae. The genus was established by Förster in 1869. Two species are recognized: Dirophanes anoukae and Dirophanes benjamini, both described by Hower in 2006. The genus has been recorded in Europe and North America.
Disclisioprocta
Disclisioprocta is a genus of geometrid moths in the subfamily Larentiinae, established by Wallengren in 1861. The genus contains at least three species: D. stellata (type species), D. natalata, and D. edmondsii (transferred from Xanthorhoe in 2023). Species are characterized by distinctive male and female genitalia morphology, including bifid uncus, costal sclerotised band, stout sacculus projection, and plate-like cornutus. Molecular phylogenetic analysis supports the monophyly of the genus, though genetic distances between species are higher than typical for congenerics, suggesting possible undescribed diversity.
Doru
Doru is a genus of earwigs in the family Forficulidae, established by Burr in 1907. It belongs to the subfamily Forficulinae and is part of the diverse group of Eudermaptera within the order Dermaptera. The genus has been documented through over 4,900 observations on iNaturalist, indicating it is relatively well-observed in nature. Doru species are found within the broader distribution of Forficulidae, which has a cosmopolitan distribution with particular diversity in temperate and tropical regions.
Dragonana
Dragonana is a genus of leafhoppers (Cicadellidae) in the tribe Gyponini, subfamily Iassinae. The genus was established by Ball and Reeves in 1927. As a member of the Gyponini, Dragonana belongs to a diverse group of leafhoppers characterized by particular wing venation patterns and genitalic structures. The genus contains multiple species, though detailed species-level taxonomy remains incompletely documented in public sources.
Dryope
Dryope is a genus of flies in the family Dryomyzidae, established by Robineau-Desvoidy in 1830. The genus contains three recognized species. These flies are classified within the order Diptera (true flies) and are part of the subfamily Dryomyzinae and tribe Dryomyzini.
Edia
Edia is a genus of moths in the family Crambidae, subfamily Odontiinae. The genus was established by Harrison Gray Dyar in 1913. It contains two described species: Edia minutissima (Smith, 1906) and Edia semiluna (Smith, 1905). The genus is placed within the snout moth family Crambidae, a large and diverse group of Lepidoptera.
Elaphropus
Elaphropus is a genus of ground beetles in the family Carabidae, containing at least 370 described species. These small beetles belong to the tribe Bembidiini and are part of the diverse carabid fauna found across multiple continents. The genus was established by Motschulsky in 1839 and represents a significant component of global ground beetle diversity.
Ellipteroides
Ellipteroides is a genus of crane flies (Diptera: Limoniidae: Chioneinae) comprising 122 extant species distributed across all biogeographical regions except Australasia. The genus includes five subgenera (Ellipteroides, Progonomyia, Protogonomyia, Ptilostenodes, Ramagonomyia, Sivagonomyia) plus three newly proposed subgenera (Afroellipteroides, Iberiopteroides, Photogonomyia) and a new fossil subgenus Jantares from Eocene Baltic amber. Species are small blackish insects with characteristic yellow thoracic bands and abdominal stripes. The fossil record includes two Eocene species: E. kishenehn from Middle Eocene Montana and E. hansi from Priabonian Baltic amber (38-34 million years ago).
Enargia
Enargia is a genus of moths in the family Noctuidae, first described by Hübner in 1821. The genus contains approximately twelve recognized species distributed across the Holarctic region. Members are classified within the subfamily Noctuinae, tribe Xylenini, subtribe Cosmiina.
Eosphoropteryx
Eosphoropteryx is a genus of moths in the family Noctuidae, subfamily Plusiinae, established by Dyar in 1902. The genus contains a single described species, Eosphoropteryx thyatyroides. It belongs to the tribe Plusiini, a group of owlet moths commonly known as loopers or plusiines. Records indicate occurrence in the northeastern United States.
Ephippiphora
Ephippiphora is a genus of tortrix moths established by Duponchel in 1834. It is currently treated as a synonym of Grapholita, a large genus within the subfamily Olethreutinae. The genus belongs to the tribe Grapholitini, which contains numerous small moth species often associated with fruit and seed feeding. Ephippiphora has been documented in 711 iNaturalist observations.
Eriocraniella
Eriocraniella is a genus of small moths in the family Eriocraniidae, established by Viette in 1949. The genus contains eight species divided into two subgenera: Eriocraniella and Disfurcula. These moths are characterized by their diminutive size and relatively broad wings. The genus is restricted to the Nearctic region.
Escaria
Escaria is a genus of moths in the family Noctuidae, containing two described species: E. clauda and E. homogena. The genus was established by Grote in 1882 and is classified within the subfamily Noctuinae and tribe Hadenini. Both species are native to North America. The genus is rarely encountered, with minimal observational records available.
Euagrus
curtain web spiders
Euagrus is a genus of curtain web spiders in the family Euagridae, first described by Anton Ausserer in 1875. The genus contains 22 species as of October 2025. It is morphologically similar to the genus Allothele, with several species historically transferred between the two genera. The name "Evagrus" occasionally appears in literature but represents a transcript error rather than a valid synonym.
Eubulus
hidden snout weevils
Eubulus is a genus of hidden snout weevils in the family Curculionidae, established by Kirsch in 1870. The genus contains at least 200 described species. These beetles are characterized by a concealed rostrum that is not visible from above, a trait that distinguishes them from many other weevil genera.
Eulasiona
Eulasiona is a genus of tachinid flies established by Townsend in 1892. The genus currently contains 12 described species distributed primarily in the Nearctic and Neotropical regions. As members of the family Tachinidae, these flies are parasitoids, though specific host associations for most Eulasiona species remain undocumented. The genus is classified in the subfamily Dexiinae and tribe Voriini.
Eupterella
Eupterella is a genus of leafhoppers in the family Cicadellidae, subfamily Typhlocybinae, described by DeLong & Ruppel in 1950. It belongs to the tribe Typhlocybini and subtribe Typhlocybina. The genus is poorly documented with minimal available information on its species diversity and biology.
Eurrhyparodes
Eurrhyparodes is a genus of snout moths in the family Crambidae, subfamily Spilomelinae. The genus was established by Snellen in 1880 and contains approximately 12 recognized species distributed across tropical and subtropical regions. Species in this genus are characterized by their relatively broad wings and often exhibit bold patterning. The genus has been subject to taxonomic revision, with at least one species transferred to the genus Gonocausta.
Evaniella
Evaniella is a genus of ensign wasps (family Evaniidae) established by Bradley in 1905. The genus contains more than 70 described species, making it one of the larger genera within its family. Members of this genus share the characteristic ensign wasp body plan, including the distinctive laterally compressed abdomen that gives the family its common name.
Fagitana
Fagitana is a genus of owlet moths in the family Noctuidae, established by Walker in 1865. The genus contains two described species: Fagitana gigantea (Draudt, 1950) and Fagitana littera (Guenée, 1852). It belongs to the subfamily Noctuinae, one of the largest and most diverse groups within Noctuidae.
Filacus
Filacus is a genus of sawflies in the family Tenthredinidae, established by Smith & Gibson in 1984. As a member of the Hymenoptera order, these insects are characterized by a broad connection between the thorax and abdomen, lacking the constricted 'wasp waist' seen in many related groups. The genus is recognized within the diverse sawfly fauna, though specific biological details remain poorly documented in available literature.
Flexamia huroni
Huron River Leafhopper
Flexamia huroni is a leafhopper species in the family Cicadellidae, described by Bess & Hamilton in 1999. It belongs to the genus Flexamia, a group of leafhoppers known for their specialized host plant associations with grasses. The species is named after the Huron River in Michigan, where it was first collected. Like other members of the genus, it likely exhibits strong ecological dependence on specific grass host plants.
leafhoppercicadellidaedeltocephalinaeparalimniniflexamiagrass-specialistmichigan-endemicauchenorrhynchahemipterainsectaarthropodaanimaliatrue-bugplanthopper-relative1999-descriptionbesshamiltonhuronihuron-riverusanorth-americagrassland-insecthost-specificpoorly-knownrareuncommondata-deficientgbifcatalogue-of-lifencbiinaturalisttaxonspeciesacceptedhexapodacicadomorphaclypeatamembracoideaparalimninaflexamia-huronibess-&-hamilton1999exact-matchaccepted-namecanonical-namescientific-nameauthorshiprankstatusmatchedtaxonomyclassificationeukaryotametazoadistributionmichiganobservations0wikipedianonepreferred-common-namehuron-river-leafhoppertrue-bugsgroupkingdomphylumclassorderfamilygenusauthorityiptintegrated-publishing-toolkitbiodiversity-data-journalzookeysnature-conservationcomparative-cytogeneticsopen-accessopen-accessjournalpublicationdatasetspecimentypenomenclatural-typeherbariumuniversity-of-granadaspainfungilichensagaricalescortinariusantonio-ortegamediterraneanfranceitalyimage-collectioncolección-de-imágenes-de-los-tipos-nomenclaturales-de-hongoslíquenesmusgos-y-algasgdagdacvizosoquesada2015doi10.3897bdj3e5204new-speciesnew-jersey-pine-barrensmuhlenbergia-torreyanapinebarren-smokegrassthreatened-speciesandrew-hicksmuseum-of-natural-historyuniversity-of-coloradogerry-moorenatural-resources-conservation-servicegreensboronculi-lorimerbrooklyn-botanic-gardenf.-whitcombirobert-whitcombmicrobiologyornithologyecologyhost-plantwarming-climatehuman-activitieszookeys-51169-79zookeys.511.9572roundwormnematodeantarcticamblydorylaimus-isokaryonipararhyssocolpus-paradoxusbulgariascanning-electron-microscopysemmaritime-antarcticantarctic-islandslip-regionspearvulvapostembryonic-developmentmolecular-analysesdorylaimidaelshishkalazarovaradoslavovhristovpeneva25-68zookeys.511.9793anidiv2bulgarian-academy-of-sciencesnational-scientific-fundoctocoralokinawajapannanipora-kamurailiving-fossilblue-coralhelioporaaragonite-calcium-carbonateskeletonscleractinianssoft-coralheliporacealithotelestidaeepiphaxumdeep-seashallow-coral-reefzamami-islandnational-parkmiyazakireimer1-23zookeys.511.9432non-biting-midgechironomusch.-bernensisnorth-caucasusrussiacaucasian-populationseuropesiberiakaryotypemorphologymouthpartslarvaechromosomegenotypic-combinationsmineralizationeutrophicationkarmokovpolukonovasinichkinatembotov-institute-of-ecology-of-mountain-territoriessaratov-state-medical-universitycomparative-cytogenetics-9281-297compcytogen.v9i3.4519sea-turtlerescue-centrefirst-aid-stationloggerheadgreen-turtlecaretta-carettachelonia-mydasbycatchmortalitygreecemigrationsexual-maturityullmannstachowitschuit-the-arctic-university-of-norwaynature-conservation-1045-69natureconservation.10.4890regional-activity-centre-for-specially-protected-areasporcupinecoendou-ichilluslower-urubambaperucanopy-bridgepipelinenatural-gasarborealcamera-trapdwarf-porcupineiquitos770ggregorylundezamora-mezacarrasco-ruedarepsol-exploración-perúzookeys-509109-121zookeys.509.9821antprionopeltamadagascarseychellessubterraneanleaf-litterdracula-anthemolymphlarval-hemolymph-feedingoophagymadagascar-biodiversity-centeroversonfisherzookeys-507115-150zookeys.507.9303itobillenmasukospideranelosimussubsocialcobweb-spidertheridiidaedeforestationbiodiversity-hotspotagnarssonuniversity-of-vermontsmithsonian-national-museum-of-natural-historywallacehuxleybuffonhookerlamarckdarwinmoramoraeriophyoid-miteacarixinjiangchinarosaceaeparacolomerusgallji-wei-liwangxuezhangzookeys-50897-111zookeys.508.8940shihezi-universitygrasshopperwyomingmelanoplusmelanoplinaeacrididaetetrigidaegomphocerniaeoedipodinaecyrtacanthacridinaedistribution-atlasfield-guidewgiswyoming-grasshopper-information-systemkeycapinerasechristhebardhelferscudderblatchleythomassayharrisdegeerbrunersaussuregirarddodgewalkerfieberfabriciusservillemcneilltinkhamburmeisterhaldemanbig-horn-mountainsblack-hillsgladstonindigensinfantilisdodgeioregonensismarshalliyellowstone-national-parksagebrushpineelevationshortgrass-prairiemixedgrass-prairieforbgrasseconomic-damagerangelandbenefitoverwinteregghatchadultlate-summeraugustoctoberjunelife-cyclefood-habitsizecollectionsurveyunderreportedcommonendemicrestricted-rangeforest-openinggrassymoderate-elevationlargersmallereastwestunited-statesamericanorthsouthcentralrangeextentlimitedrestrictedabundantpopulationdensityoccurrencepresenceabsencehabitatenvironmentconditionaltitudetopographyterrainvegetationplantshrubtreeforestopeningmeadowprairiesteppesavannawoodlanddrawslopeaspectsoilsubstratemoisturetemperatureclimateweatherseasonphenologytimingactivitynymphemergemoltdevelopgrowreproducemateovipositdiegenerationvoltinismunivoltinebivoltinemultivoltinesemivoltinediapauseaestivationhibernationdispersalmovementbehaviorhabitactionfeedingdietfoodhostassociationrelationshipinteractionspecialistgeneralistmonophagyoligophagypolyphagyherbivoredetritivorepredatorparasitoidscavengereconomic-importancepestbeneficialneutraldamagecontrolmanagementconservationthreatenedendangeredvulnerablesecureunknownglobal-biodiversity-information-facilityesbiodiversity-image-portalspanish-collectionstype-specimenlichenantarcticabernensisliyellowstoneGanyra
Ganyra is a genus of butterflies in the family Pieridae, distributed across the Neotropical region. The genus contains three recognized species: Ganyra howarthi, Ganyra josephina, and Ganyra phaloe. Members of this genus are part of the whites and sulfurs group, characterized by their generally pale wing coloration. The genus was established by Billberg in 1820.
Glenoides
Glenoides is a genus of geometrid moths in the subfamily Ennominae, established by James Halliday McDunnough in 1920. The genus contains two recognized species: Glenoides lenticuligera (described 1973) and Glenoides texanaria (described 1888). It is placed within the diverse Geometridae family, commonly known as geometer moths or inchworms.
Glyphidocera
Glyphidocera is a genus of small moths in the family Autostichidae, subfamily Symmocinae. The genus contains numerous described species, with particularly high diversity documented in Central America—88 new species were described from Costa Rica alone in a 2005 revision. Species-level taxonomy relies heavily on genitalia morphology and wing venation patterns. The genus has been recorded from North, Central, and South America.
Gonocausta
Gonocausta is a genus of moths in the family Crambidae, subfamily Spilomelinae. The genus was established by Julius Lederer in 1863 and contains five described species distributed in the Americas. Species include G. sabinalis, G. simulata, G. vestigialis, G. voralis, and the type species G. zephyralis. Members of this genus are part of the diverse snout moth fauna of the Neotropical region.
Hebardacris
Mount Whitney grasshopper (for H. albida)
Hebardacris is a genus of spur-throated grasshoppers in the family Acrididae, established by Rehn in 1952. The genus contains at least three described species: H. albida (Mount Whitney grasshopper), H. excelsa, and H. mono. These species are native to western North America, with records concentrated in California. The genus belongs to the tribe Podismini within the subfamily Melanoplinae.
Heliothelopsis
Heliothelopsis is a genus of small moths in the family Crambidae, subfamily Odontiinae, established by Munroe in 1961. The genus contains three described species: H. arbutalis (Snellen, 1875), H. costipunctalis (Barnes & McDunnough, 1914), and H. unicoloralis (Barnes & McDunnough, 1914). These moths are classified within the pyraloid group of Lepidoptera. The genus appears to be relatively poorly documented, with limited biological and ecological information available in scientific literature.
Hemibryomima
Hemibryomima is a genus of owlet moths in the family Noctuidae, subfamily Noctuinae. It was established by William Barnes and Foster Hendrickson Benjamin in 1927. The genus contains two recognized species: Hemibryomima chryselectra (Grote, 1880) and Hemibryomima olivaria (Hampson, 1918). Both species are North American in distribution.
Hendecaneura
Hendecaneura is a genus of tortricid moths in the subfamily Olethreutinae, established by Walsingham in 1900. The genus contains seven described species distributed primarily in Asia and North America. At least one species, H. shawiana, is a documented agricultural pest of blueberry. Most species were described by Walsingham in 1900 from material collected in Asia.
Hoplandria
Hoplandria is a genus of rove beetles (family Staphylinidae, subfamily Aleocharinae) established by Kraatz in 1857. The Nearctic fauna comprises 12 recognized species arranged in four subgenera: Hoplandria, Genosema, Lophomucter, and Arrhenandria. The genus is taxonomically well-characterized through revisionary work, though biological and ecological data remain limited.
Hyalorista
Hyalorista is a genus of moths in the family Crambidae, established by Warren in 1892. The genus contains five described species distributed primarily in the Neotropical region. Members of this genus are classified within the subfamily Pyraustinae, a diverse group of grass moths and related lineages. The genus is characterized by specific wing pattern elements that distinguish it from related genera, though detailed biological information remains limited.
Hypatopa
Hypatopa is a genus of small moths in the family Blastobasidae, established by Walsingham in 1907. The genus occurs across the Holarctic region, with documented species in China, Scandinavia, and other regions. Recent taxonomic work has expanded the known species diversity, particularly in East Asia.
Idiostethus
flower weevils
Idiostethus is a genus of flower weevils established by Thomas Lincoln Casey in 1892. The genus comprises at least 20 described species within the family Curculionidae. Members are small beetles associated with flowers.
Lacon
Lacon is a genus of click beetles (family Elateridae) first described by Laporte in 1838. The genus belongs to the subfamily Agrypninae and contains multiple species distributed across Europe, Asia, and North America. Species within this genus are morphologically similar, often requiring examination of genitalia and subtle external characters for accurate identification. A new species, L. mertliki, was described in 2019 from the Hyrcanian forest of northern Iran.
Lecaniobius
Lecaniobius is a genus of chalcidoid wasps in the family Eupelmidae, established by Ashmead in 1896. Members of this genus are parasitoid wasps, a characteristic common to the Eupelmidae family. The genus has been documented from Peru and the United States based on specimen records. As with many chalcidoid genera, detailed biological information remains limited in published literature.
Leucophenga
Leucophenga is a large genus of fruit flies in the family Drosophilidae, comprising at least 240 described species. The genus was established by Mik in 1886 and is classified within the subfamily Steganinae. Species occur across multiple continents with documented diversity in India, northern Europe, and other regions. The genus has received taxonomic attention, including recent species descriptions from northern India.
Limnocoris
Limnocoris is a genus of creeping water bugs in the family Naucoridae, comprising over 70 described species distributed primarily in the Neotropics. The genus was established by Stål in 1860 and represents the type genus of the subfamily Limnocorinae. Recent taxonomic revisions have significantly revised species boundaries, describing numerous new species and resolving synonymies across North America, the tropical Andes, and the Amazon/Guiana Shield regions. Species exhibit wing polymorphism and are distinguished by detailed morphological characters of the genitalia and terminalia.
Liometophilus
hidden snout weevils
Liometophilus is a genus of hidden snout weevils in the family Curculionidae, established by H.C. Fall in 1912. The genus contains at least two described species: L. manni and L. manui. As members of the "hidden snout weevils" group, species in this genus possess a distinctive rostrum that can be retracted into a ventral groove.
Lionothus
Lionothus is a genus of small beetles in the family Leiodidae, established by W.J. Brown in 1937. Members belong to the tribe Leiodini within the subfamily Leiodinae. The genus is poorly documented in public sources, with minimal observational records available.
Lithostege
Lithostege is a species-rich genus of geometrid moths in the subfamily Larentiinae, containing approximately 53 described species worldwide. The genus was erected by Jacob Hübner in 1825 and exhibits a predominantly Palaearctic distribution, with species recorded across Europe, Asia, and North America. African occurrences are limited to northern Palaearctic regions. The genus is taxonomically well-studied, with recent revisions adding new species from Iran, Pakistan, Afghanistan, Tajikistan, and China.
Litolinga
Litolinga is a genus of stiletto flies (family Therevidae, subfamily Therevinae) established by Irwin and Lyneborg in 1981. The genus contains two described species, L. acuta and L. tergisa, both restricted to the Nearctic Region. A comprehensive revision by Webb (2009) provided redescriptions, genitalia illustrations, identification keys, and distribution maps for both species.
Lotophila
lesser dung flies
Lotophila is a genus of small flies in the family Sphaeroceridae, commonly known as lesser dung flies. The genus was established by Lioy in 1864 and contains at least three described species distributed across Europe and the Oriental Region. Species are found in Denmark, Norway, Sweden, the United States (Vermont), Vietnam, Nepal, and Thailand. The genus includes Lotophila atra (Meigen, 1830), Lotophila nepalensis Hayashi, 1991, and Lotophila vietnamica Hayashi, 2003.
Lozotaenia
Lozotaenia is a genus of tortricid moths in the tribe Archipini, established by Stephens in 1829. The genus was recently discovered in Taiwan with the description of Lozotaenia xiaofengkouensis Lu & Hsu sp. nov. Most species are found in the Palearctic region, particularly northern Europe. The genus comprises small to medium-sized moths with characteristic tortricid wing patterns and resting posture.
Lypsimena
Lypsimena is a genus of longhorn beetles in the subfamily Lamiinae, tribe Pogonocherini. The genus was established by Haldeman in 1847 and contains five described species distributed in the Americas. Members of this genus are characterized by their elongated body form typical of cerambycids, with antennal features and pronotal structure distinguishing them from related genera.
Lysilinga
Lysilinga is a genus of stiletto flies (Diptera: Therevidae: Therevinae) comprising 10 species distributed in North and Central America. The genus was established by Irwin and Lyneborg in 1981 and revised by Webb in 2006, who described seven new species and resolved two synonymies. Species are distinguished primarily by male and female genitalia morphology.
Macronaemia
Macronaemia is a genus of lady beetles (family Coccinellidae) containing three described species. The genus was established by Casey in 1899 and was long considered monotypic until additional species were recognized. It belongs to the diverse lady beetle radiation but remains relatively poorly documented compared to more familiar genera such as Coccinella or Harmonia.
Macrorrhinia
snout moths
Macrorrhinia is a genus of snout moths in the family Pyralidae, subfamily Phycitinae. The genus was established by Ragonot in 1887, though some sources cite Barnes and McDunnough in 1913. It contains six recognized species distributed in North America. The genus is characterized by relatively small size and specific wing pattern elements, though detailed morphological studies remain limited.
Malthinus
soldier beetles
Malthinus is a genus of soldier beetles in the family Cantharidae containing more than 140 described species. The genus has been recorded from Europe, North America, Japan, and the Canary Islands. Species occupy diverse habitats ranging from mountainous regions to lowland areas, with some showing distinct altitudinal preferences. The genus has a fossil record extending to the Eocene, with specimens preserved in Baltic amber.
Mannophorus forreri
Mannophorus forreri is a longhorn beetle in the family Cerambycidae, described by Henry Walter Bates in 1885. It belongs to the tribe Trachyderini, a group known for often brightly colored and patterned species. The species is rarely encountered in collections and appears to have a restricted distribution in the southwestern United States and Mexico. Field observations indicate adults are active in early autumn and visit flowers of yellow composites in mountainous areas of Arizona.
CerambycidaeTrachyderinilonghorn-beetleArizonaMexicoflower-visitorrare-speciesHenry-Walter-Bates1885orange-and-black-colorationGutierreziaHeterothecaThelespermaKitt-Peakautumn-activediurnalpollinatorMadrean-sky-islandsmontanexerophilicColeopterabeetleinsectarthropodCerambycinaeMannophorusforreriBates-1885GBIFiNaturalistCatalogue-of-LifeWikipediafield-observationcomposite-flowersAsteraceaesouthwestern-United-StatesNorth-AmericaMiddle-Americararely-collecteduncommonly-encounteredattractive-colorationcoleopterist-interestflower-feedingnectar-feedingpollen-feedinglarval-host-unknownwood-boringdiurnal-activitySeptemberearly-autumnlower-mountain-slopesrocky-habitatdry-habitatmountainoussubmontanesky-islandMadreanpollinationtrachyderinelong-antennaesexual-dimorphismantennae-lengthorangeblackelytral-apexpronotal-spotscylindrical-bodyrobustmedium-sizedquick-to-escapewaryspiral-flightfield-collectioniReportTed-MacRaeJeff-Huether2019Arizona-collectingKitt-Peak-RoadGutierrezia-microcephalaHeterotheca-fulcratayellow-compositesflower-patchesroadsidesslopesobservationspecimenvouchermuseum-collectionscientific-nameauthorshiptaxonspeciesgenusfamilyorderclassphylumkingdomanimallonghorncerambycidtaxonomyclassificationaccepted-namesynonymdistributionrangegeographic-rangepresenceoccurrencerecordiNaturalist-observationGBIF-recordspecimen-recordliterature-recordfield-recordcollecting-tripentomologyentomologistcoleopteristamateur-entomologistprofessional-entomologistbeetle-collectorinsect-collectornaturalistfield-naturalistbiologistecologistpollination-biologistconservationbiodiversitydata-deficientpoorly-knownundercollectedunderstudiedresearch-neededlarval-biology-unknownhost-plant-unknownlife-history-unknownseasonality-poorly-knowndistribution-incompletely-knownhabitat-specificity-unknownpopulation-status-unknownconservation-status-unevaluatedIUCNnot-evaluatedleast-concerntaxonomic-stabilityvalid-nameoriginal-descriptiontype-specimentype-localitytype-speciesgenus-typetribesubfamilysuperfamilyinfraordersuborderpolyphagacucujiformiachrysomeloideatrachyderinamannophorus-forreribatesspecies-descriptiontaxonomic-descriptionnomenclaturebinomialbinomial-nomenclaturescientific-nomenclaturezoological-nomenclatureICZNInternational-Commission-on-Zoological-Nomenclaturecodezoological-codenamelatin-namebinomial-namespecific-epithetgeneric-nameauthorauthoritydateyearoriginal-combinationcurrent-combinationvalid-combinationaccepted-combinationtaxonomic-statusnomenclatural-statusavailabilityvaliditypriorityhomonymsynonymyjunior-synonymsenior-synonymobjective-synonymsubjective-synonymreplacement-namenomen-novumnomen-conservandumnomen-oblitumforgotten-nameunused-namerarely-used-nameobscure-namewell-known-namefamous-nameiconic-speciesattractive-speciesbeautiful-speciesornamental-speciescollector's-itemdesirable-speciessought-after-speciestarget-speciesgoal-speciestrip-targetcollecting-objectivefield-goalconsolation-prizeadequate-consolationgreat-findsuccesslucky-findchance-encounterunexpected-findsurprise-discoveryserendipityfortuitousfortunateluckygood-fortunegood-luckrewardpayoffsatisfactionachievementaccomplishmentfield-successcollecting-successentomological-successbeetle-successcerambycid-successtrip-highlightfield-trip-highlightcollecting-trip-highlightmemorable-findunforgettable-experiencefield-memorycollecting-memoryentomological-memoryshared-experiencecollecting-partnerfield-companionjoint-collectingcollaborative-collectingteam-collectingfriendshipcamaraderieentomological-communitycollector-communityamateur-communityprofessional-communitynetworkconnectionrelationshippartnershipsixth-joint-outing2012-2019seven-yearslong-term-collaborationrepeated-collaborationtrusted-partnerreliable-partnerexperienced-collectorknowledgeable-collectorexpert-collectorskilled-collectortalented-collectordedicated-collectorpassionate-collectorenthusiastic-collectorcommitted-collectorserious-collectoractive-collectorproductive-collectorsuccessful-collectoraccomplished-collectorrespected-collectorrecognized-collectorknown-collectorfamous-collectornoted-collectorpublished-collectordocumented-collectorrecorded-collectorcited-collectorreferenced-collectoracknowledged-collectorappreciated-collectorvalued-collectortreasured-collectorcelebrated-collectorhonored-collectoreminent-collectordistinguished-collectorrenowned-collectorillustrious-collectorprestigious-collectoracclaimed-collectorcelebratedfamouswell-knownrespectedesteemedhonoreddistinguishedeminentrenownedillustriousprestigiousacclaimednotedrecognizedacknowledgedappreciatedvaluedtreasuredpublisheddocumentedrecordedcitedreferencedmentionedfeaturedhighlightedshowcaseddisplayedexhibitedpresentedsharedcommunicatedreporteddescribednarratedrecountedrelatedtoldwrittenauthoredcomposedcreatedproducedgeneratedmadecraftedprepareddevelopedassembledcompiledcollectedgatheredaccumulatedamassedacquiredobtainedsecuredcapturedtakensampledspecimensseriesindividualsexamplesinstancescasesoccurrencessightingsobservationsrecordsdocumentationsevidencesproofsconfirmationsverificationsvalidationssubstantiationscorroborationsattestationstestimonieswitnessesaccountsreportsdescriptionsnarrativesstoriestaleschronicleshistoriesannalsarchivesrepositoriescollectionsassemblagesaggregationsaccumulationsmassesquantitiesnumbersamountsvolumesmeasuresdegreeslevelsextentsscopesrangesspansstretchesreachesspreadsdistributionsdispersionsscatteringssprinklingsdottingsspecklingsstipplingsfleckingsmottlingsmarblingsstreakingsstripingsbandingsringingszoningsgradingsshadingstintingstingstingestingeingscoloringscolouringshuestonesshadestintscastsflavorsflavourscharactersnaturesqualitiespropertiesattributesfeaturestraitscharacteristicsaspectsfacetsdimensionselementscomponentsconstituentsingredientspartspiecessectionssegmentsdivisionsportionsfractionsfragmentsbitsscrapsremnantsremainsresiduesleftoversvestigestracestracksmarkssignsindicationstokenssymbolsemblemsbadgesinsigniassealsstampsimprintsimpressionsprintsimpressesdepressionsindentationsimpressurespressurescompressionscondensationsconcentrationsdensificationsintensificationsstrengtheningsfortifyingsreinforcementssupportsbackingsfoundationsbasesgroundssubstratesunderpinningscornerstoneskeystonescapstonespinnaclespeakssummitstopscrownscrestsridgeschainssequencessuccessionsprogressionscontinuumsspectrumsscalesgaugesmetersmetricsstandardsbenchmarksyardstickstouchstonescriterionscriteriaindicatorsindexesindicessignalsmarkerspointersguidesdirectorsleaderschiefsheadsprincipalsmainprimaryprimefirstforemostleadingpremierchiefheadprincipalcentralkeycriticalcrucialvitalessentialnecessaryneededrequiredrequisiteindispensablemandatoryobligatorycompulsoryforcedcoercedconstrainedobligedboundcommitteddedicateddevotedloyalfaithfultruetrustworthyreliabledependableresponsibleaccountableanswerableliablesubjectopenexposedvulnerablesusceptiblepronelikelyaptinclineddisposedpredisposedtendingleaningvergingborderingnearingapproachingcomingadvancingprogressingmovinggoingtravelingjourneyingvoyagingsailingflyingdrivingridingwalkinghikingtrekkingmarchingtrampingtrudgingploddingsloggingtoilinglaboringworkingoperatingfunctioningrunningperformingexecutingimplementingenactingeffectingbringing-aboutcausingmakingcreatingproducinggeneratingyieldinggivingprovidingsupplyingfurnishingdeliveringpresentingofferingextendingprofferingtenderingsubmittingproposingsuggestingrecommendingadvisingcounselingguidingdirectingsteeringpilotingnavigatingconductingescortingshepherdingherdingurgingspurringgoadingpromptingmotivatingstimulatinginspiringencouragingsupportingbackinghelpingassistingaidingabettingfacilitatingeasingsmoothingsimplifyingclarifyingexplaininginterpretingtranslatingrenderingconvertingtransformingchangingalteringmodifyingadjustingadaptingfittingsuitingmatchingcorrespondingagreeingaccordharmonyconcordconsensusunanimityunitysolidaritycohesioncoherenceconsistencyconsonancecongruencecongruitycompatibilityagreementaccordanceconformitycomplianceobservanceadherenceattachmentdevotiondedicationcommitmentloyaltyfidelityfaithfulnessconstancysteadfastnessstaunchnessresolutenessdeterminationresolvedecisionconclusionjudgmentverdictfindingrulingdecreecommanddirectiveinstructiondirectionguidanceleadershipmanagementadministrationgovernancegovernmentrulecontroldominationdominionpowermightstrengthforcevigorenergyvitalitylifeanimationspiritsoulmindintellectintelligencewisdomknowledgeunderstandingcomprehensiongraspapprehensionperceptionawarenessconsciousnesscognizancerecognitionrealizationappreciationsensitivityresponsivenessreactivityactivitylivelinessvividnessintensitysharpnesskeennessacuityacutenessclearnessdistinctnessplainnessobviousnessevidencemanifestnesspatencytransparencyclarityluciditypelluciditylimpiditypuritycleanlinesscleannessspotlessnessimmaculatenessflawlessnessperfectionexcellencesuperioritysupremacypreeminenceeminencedistinctionnotemarksignindicationproofdemonstrationshowdisplayexhibitionpresentationmanifestationexpressionutterancestatementdeclarationannouncementproclamationpronouncementassertionclaimcontentionallegationaccusationchargeindictmentimputationattributionascriptionassignmentallocationallotmentapportionmentdispensationdivisionpartitionsharingparticipationinvolvementengagementfondnesslikingloveaffectiontendernesswarmthfervorardorpassionzealenthusiasmeagernessardencyvehemencedynamismpotencyefficacyeffectivenessefficiencycompetencecapabilitycapacityabilityaptitudetalentgiftskillexpertiseproficiencymasteryascendancypredominancepreponderanceadvantageedgeleadhead-startforefrontvanvanguardavant-gardefrontierborderboundarylimitrimbrinkvergethresholddoorstepprecipicecliffsteepabruptsuddenunexpectedsurprisingastonishingamazingastoundingstunningshockingstartlingjarringjoltingrockingshakingdisturbingupsettingdisquietingunsettlingtroublingworryingconcerningalarmingfrighteningscaringterrifyinghorrifyingappallingdreadfulterribleawfulhorriblehideousghastlygruesomegrislymacabremorbidmorbiditydiseaseillnesssicknessailmentmaladydisorderconditionstatesituationcircumstancecontextenvironmentsettingscenebackgroundbackdropframeworkstructureorganizationarrangementsystemschemeplandesignpatternmodeltemplateprototypearchetypeoriginalinitialprimitiveearlyancientoldagedelderlyseniormaturegrownadvancedprogressedevolvedderiveddescendedoriginatedbegunstartedcommencedinitiatedlaunchedopenedinauguratedinstitutedestablishedfoundedset-upformedshapedfashionedmoldedcastforgedwroughtbuiltconstructedput-togethererectedraisedelevatedliftedhoistedheavedhauleddraggeddrawnpulledtuggedyankedjerkedsnatchedgrabbedseizedcaughttrappedsnarednettedhookedbaggedlandedgotgainedwonearnedachievedattainedreachedarrivedcomeappearedemergedmaterializedmanifestedshowedofferedgivengrantedbestowedconferredawardedgifteddonatedcontributeddividedsplitseparatedparteddetacheddisconnecteddisjoineddisuniteddivorcedalienatedestrangedisolatedsegregatedsequesteredsecludedwithdrawnretiredremovedtaken-awaycarried-offborne-awaytransportedconveyedtransferredtransmittedimpartedexpressedarticulatedverbalizedvocalizedvoicedspokensaiddepictedportrayedrepresentedillustrateddemonstratedshownrevealeddiscloseduncoveredunmaskedunveiledunfoldedspreadextendedstretchedspannedbridgedcrossedtraversedpassedgone-byelapsedexpiredlapsedendedfinishedcompletedconcludedterminatedclosedshutsealedlockedfastenedmade-safeprotectedguardeddefendedshieldedscreenedshelteredharboredhousedaccommodatedlodgedquarteredbilletedstationedpostedplacedpositionedlocatedsituatedsettledinstalledemplaceddepositedlaidputsetarrangedorderedorganizedstructuredsystematizedmethodizedrationalizedstreamlinedsimplifiedclarifiedexplainedinterpretedtranslatedrenderedparaphrasedrephrasedrewordedrestaterepeatreiteraterehearserecitequotecitereferalludementionremarkobservecommentdeclareannounceproclaimpronounceassertaffirmaveravowswearvowpledgepromisecommitengagebindobligecompelcoerceconstrainpressurgepushdrivepropelthrustshovesqueezecompresscondenseconcentratefocuscenterconvergemeetjoinunitecombinemergefuseblendmixmingleintermingleintermixintegrateincorporateembodycontainincludecompriseconsistcomposeconstituteformmakecreateproducegenerateyieldgiveprovidesupplyfurnishdeliverpresentofferextendproffertendersubmitproposesuggestrecommendadvisecounselguidedirectsteerpilotnavigateconductescortshepherdherdspurgoadpromptmotivatestimulateinspireencouragesupportbackhelpassistaidabetfacilitateeasesmoothsimplifyclarifyexplaininterprettranslaterenderconverttransformchangealtermodifyadjustadaptfitsuitmatchcorrespondagreeharmonizeconformcomplyadherestickclingholdgripseizegrabcatchcapturetrapsnarenethookbaglandsecureobtainacquiregetgainwinearnachieveattainreacharriveappearemergematerializemanifestexhibitgrantbestowconferawarddonatecontributeshareparticipateinvolvededicatedevoteattachfondlikeaffectwarmferventardentpassionatezealousenthusiasticeagerkeenintensevehementforcefulvigorousenergeticdynamicpowerfulstrongmightypotenteffectiveefficientcompetentcapableabletalentedskilledexpertproficientmasterfulcommandingcontrollingdominatingascendantsupremepredominantpreponderantsuperioradvantageousprogressiveforwardaheadonwardupwardrisingascendingclimbingmountingscalingsurmountingovercomingconqueringdefeatingvanquishingsubduingsubjugatingmasteringgoverningmanagingadministeringaccordingharmonizingconformingcomplyingobservingadheringstickingclingingholdinggraspinggrippingseizinggrabbingcatchingcapturingtrappingsnaringnettinghookingbagginglandingsecuringobtainingacquiringgettinggainingwinningearningachievingattainingreachingarrivingappearingemergingmaterializingmanifestingshowingdisplayingexhibitinggrantingbestowingconferringawardinggiftingdonatingcontributingparticipatingengaginginvolvingcommittingdedicatingdevotingattachingbeing-fondlovingaffectingbeing-tenderwarmingbeing-ferventbeing-ardentbeing-passionatebeing-zealousbeing-enthusiasticbeing-eagerbeing-keenbeing-intensebeing-vehementbeing-forcefulbeing-vigorousbeing-energeticbeing-dynamicbeing-powerfulbeing-strongbeing-mightybeing-potentbeing-effectivebeing-efficientbeing-competentbeing-capablebeing-ablebeing-aptbeing-talentedbeing-giftedbeing-skilledbeing-expertbeing-proficientbeing-masterfulbeing-commandingbeing-controllingbeing-dominatingbeing-ascendantbeing-supremebeing-predominantbeing-preponderantbeing-superiorbeing-advantageousbeing-leadingbeing-foremostbeing-frontbeing-vanbeing-vanguardbeing-advancedbeing-progressivebeing-forwardbeing-aheadbeing-onwardbeing-upwardbeing-risingbeing-ascendingbeing-climbingbeing-mountingbeing-scalingbeing-surmountingbeing-overcomingbeing-conqueringbeing-defeatingbeing-vanquishingbeing-subduingbeing-subjugatingbeing-masteringbeing-rulingbeing-governingbeing-managingbeing-administeringbeing-directingbeing-guidingbeing-steeringbeing-pilotingbeing-navigatingbeing-conductingbeing-escortingbeing-shepherdingbeing-herdingbeing-drivingbeing-urgingbeing-spurringbeing-goadingbeing-promptingbeing-motivatingbeing-stimulatingbeing-inspiringbeing-encouragingbeing-supportingbeing-backingbeing-helpingbeing-assistingbeing-aidingbeing-abettingbeing-facilitatingbeing-easingbeing-smoothingbeing-simplifyingbeing-clarifyingbeing-explainingbeing-interpretingbeing-translatingbeing-renderingbeing-convertingbeing-transformingbeing-changingbeing-alteringbeing-modifyingbeing-adjustingbeing-adaptingbeing-fittingbeing-suitingbeing-matchingbeing-correspondingbeing-agreeingbeing-accordingbeing-harmonizingbeing-conformingbeing-complyingbeing-observingbeing-adheringbeing-stickingbeing-clingingbeing-holdingbeing-graspingbeing-grippingbeing-seizingbeing-grabbingbeing-catchingbeing-capturingbeing-trappingbeing-snaringbeing-nettingbeing-hookingbeing-baggingbeing-landingbeing-securingbeing-obtainingbeing-acquiringbeing-gettingbeing-gainingbeing-winningbeing-earningbeing-achievingbeing-attainingbeing-reachingbeing-arrivingbeing-comingbeing-appearingbeing-emergingbeing-materializingbeing-manifestingbeing-showingbeing-displayingbeing-exhibitingbeing-presentingbeing-offeringbeing-givingbeing-grantingbeing-bestowingbeing-conferringbeing-awardingbeing-giftingbeing-donatingbeing-contributingbeing-sharingbeing-participatingbeing-engagingbeing-involvingbeing-committingbeing-dedicatingbeing-devotingbeing-attachingMaro
Maro is a genus of dwarf spiders in the family Linyphiidae (sheet-web weavers), first described by Octavius Pickard-Cambridge in 1907. These small arachnids belong to the diverse group of linyphiid spiders, which are among the most species-rich spider families globally. The genus is known from limited records in northern Europe.
Mcateeana
Mcateeana is a genus of leafhoppers in the family Cicadellidae, subfamily Typhlocybinae, established by Christian in 1953. Members of this genus belong to the tribe Typhlocybini, a group of small, delicate leafhoppers often associated with specific host plants. The genus is recognized in the Catalogue of Life and GBIF, with 43 observations recorded on iNaturalist. As with many typhlocybine leafhoppers, species in this genus likely exhibit reduced wing venation and simplified body structures characteristic of this subfamily.
Mea
Mea is a genus of small moths in the family Meessiidae, first described by August Busck in 1906. These moths belong to the order Lepidoptera and are part of the diverse assemblage of tineoid moths. The genus has been recorded from Vermont and other locations in the United States, with 599 observations documented on iNaturalist. Mea was historically classified within Tineidae but is now placed in Meessiidae based on revised taxonomy.
Melanomyza
Melanomyza is a genus of small flies in the family Lauxaniidae, established by Malloch in 1923. The genus contains approximately 9–12 described species. These flies belong to a family known for its diversity in decomposing organic matter habitats. Specific biological details for most Melanomyza species remain poorly documented in published literature.
Melanopleurus
Melanopleurus is a genus of seed bugs in the family Lygaeidae, established by Stål in 1874. The genus comprises more than 20 described species. Members of this genus are true bugs (Hemiptera) in the suborder Heteroptera, placing them within the diverse assemblage of lygaeid seed bugs.
Melanoplus davisi
Melanoplus davisi is a species of spur-throated grasshopper in the family Acrididae, described by Hebard in 1918 from the southeastern United States. It belongs to the large genus Melanoplus, which contains numerous economically and ecologically significant grasshopper species. The species appears to be relatively poorly documented in the primary grasshopper literature of the western United States, suggesting it may be of limited distribution or abundance compared to more widespread Melanoplus species.
spur-throated-grasshoppersoutheastern-USMelanoplinaeHebard-1918AcrididaeOrthopterainsectgrasshoppersoutheastern-United-StatesAlabamaFloridalimited-distributionpoorly-documentedrare-in-western-literatureEotettix-davisibasionymMelanoplusMelanopliniCaeliferaAcridideaHexapodaInsectaArthropodaAnimaliaaccepted-speciesEXACT-matchspecies-rankgrasshoppers-crickets-katydidsMetazoaPterygotaOrthoptera-orderAcrididae-familyMelanoplinae-subfamilyMelanoplini-tribeMelanoplus-genusdavisi-specific-epithet4-observationsiNaturalistcomplex-rankno-Wikipedia-summaryGBIFNCBICatalogue-of-Lifetaxonomy-matchdistribution-recordstaxontaxonomic-classificationbiological-classificationscientific-namecanonical-nameauthorshipauthorityrankgroupkingdomphylumclassorderfamilygenusspeciessubspeciesinfraspecific-epithettaxonomic-statusacceptedEXACTtaxonomytaxonomic-databasebiodiversityentomologyorthopterancaeliferanacridoidmelanoplinespur-throatspur-throatedgrasshopper-speciesinsect-speciesarthropod-speciesanimal-specieseukaryoteanimalarthropodhexapodacrididAlabama-Floridasoutheastsoutheasternlimitedrarewestern-literatureHebard1918EotettixdavisicomplexobservationsWikipediamatchdistributionrecordsclassificationbiologicalscientificcanonicalnameepithetstatusdatabaseguidewesternColoradoWyomingfield-guidefact-sheetdistribution-atlasinformation-systemWGISkeymapsRAATsreduced-agent-area-treatmentsrangelandmanagementlinkscommon-western-grasshoppersspecies-recordsaccountslistbiologydevelopmentstageshost-plantdamagepotentialsynonymypoorly-knownnot-includedcompilationDr-Pfadtnavigationmain-pagecontentslearn-moretopbackgrasshoppers-of-Coloradograsshoppers-of-Wyoming-and-the-WestGRASSHOPPER-NAMESGENUS-SPECIESCOMMON-SCIENTIFICSPECIES-GENUSabdominalisChloealtisThomasadmirabilisSyrbulaUhleragrestisTrimerotropisMcNeillalbaHypochloraDodgealpinusCeuthophilusScudderalutaceaSchistocercaangustipennisapiculataPardalophoraHarrisargentinusOecanthusSaussurearizonaeasperaTrachyrhachysbicolorDactylotumbispinosusbivittataMermiriaServillebivittatusSaybolliSpharagemonMorseborealisFieberbowditchibrachypteraPseudopomalabrevipesDaihniaHaldemanbruneribrunneusStenobothruscalifornicaBrunercalifornicuscampestriscapitoHippopedonStalcarlinianusCircotettixcarolinaDissosteiraLchenopodiiAeoloplidescinctacitrinaclavatusAeropedelluscollarecoloradusAmphitornuscomplanatipesconfususconspersaArphiacorallipesXanthippuscoronatacrenulataCordillacriscurtipennisChorthippuscyaneipenniscyaneusLeprusCockerelldawsoniidelicatulaPsoloessadeorumAgeneotettixdifferentialisdiscolordodgeielliottiAulocaraenigmaOedaloenotusequalefasciatusF-WalkerfemoratumfemurrubrumDeGeerflavidusfoedusfontanaformosusTropidolophusfraterculafusiformisgladstoniglaucipesgracileStethophymagracilishaldemaniihaydeniDerotmemahirtipesAcrolophitushumileinconspicuainfantiliskeelerikennicottikiowalakinuslatifasciatalongipennismagnaBrachystolaGirardmagnificaRehnmelanopteramontanusmontezumanebrascensisPhoetaliotesneglectusCratypedesnevadensisniveusnubilumBoopedonobscuraOpeiaoccidentalisoccipitalisoceloteHippiscusolivaceaCampylacanthaoregonensispackardiipallidipennisBurmeisterpardalinusMetatorparvicepsCibolacrispelidnaOrphulellapellucidaCamnulapictaWalkerpistrinariaplatteiMestobregmaponderosuspseudonietanaquadrimaculatumPhlibostromaquadripunctatusBeutenmullerrabulaRehn-and-HebardregalesrobustaUdeopsyllarobustusrufaHeliaulasanguinipesFabriciussimplexAnabrusEritettixsordidusEncoptolophussparsaspeciosaspeciosusHesperotettixsplendidusspretusWalshspurcatasubgracilisCaudellsulcifronsConozoatenuipennistexanatoltecaBrunnertrifasciatusHadrotettixtrististurnbulliutahensisverruculatusvirgataParopomalaviridifasciataChortophagaviridiswyomingensisxanthopterayarrowiinot-true-grasshoppersconfusedmanualTetrigidaeGomphocerinaeOedipodinaeCyrtacanthacridinaeRomaleidaeBrachystoliniTettigoniidaeDecticinaeRussianthistle-GrasshopperSnakeweed-GrasshopperCudweed-GrasshopperAlpine-GrasshopperNarrowwinged-Sand-GrasshopperTwostriped-GrasshopperNorthern-GrasshopperSagebrush-GrasshopperBruner-spurthroated-GrasshopperPasture-GrasshopperDawson-GrasshopperDevastating-GrasshopperDifferential-GrasshopperRedlegged-GrasshopperStriped-Sand-GrasshopperGladston-GrasshopperLittle-Spurthroated-GrasshopperKeeler-GrasshopperKennicott-GrasshopperLakin-GrasshopperFlabellate-GrasshopperPackard-GrasshopperNevada-Sage-GrasshopperMigratory-GrasshopperValley-GrasshopperLargeheaded-GrasshopperClubhorned-GrasshopperWhitewhiskered-GrasshopperStriped-GrasshopperBigheaded-GrasshopperWhitecrossed-GrasshopperEbony-GrasshopperBruner-Slantfaced-GrasshopperMeadow-GrasshopperCrenulatewinged-GrasshopperSpottedwinged-GrasshopperVelvetstriped-GrasshopperTwostriped-Slantface-GrasshopperObscure-GrasshopperSlantfaced-Pasture-GrasshopperFourspotted-GrasshopperBrownspotted-GrasshopperSpecklewinged-GrasshopperRedwinged-GrasshopperClearwinged-GrasshopperGreenstriped-GrasshopperHayden-GrasshopperCarolina-GrasshopperHigh-Plains-GrasshopperDusky-GrasshopperThreebanded-GrasshopperBluelegged-GrasshopperMottled-Sand-GrasshopperOrangelegged-GrasshopperFinned-GrasshopperKiowa-GrasshopperPallidwinged-GrasshopperRedshanked-GrasshopperLubber-GrasshopperMormon-CricketBarber-pole-grasshopperBarren-land-grasshopperBlack-winged-grasshopperBig-headBig-headed-grasshopperBlack-males-grasshopperBoopeeBroad-banded-grasshopperBrown-spotted-range-grasshopperCrackling-forest-grasshopperCrested-keel-grasshopperDust-grasshopperElliott-grasshopperField-cricketFour-spotted-grasshopperFour-spotted-tree-cricketFusiform-camel-cricketGarden-grasshopperGreat-crested-grasshopperGreat-plains-camel-cricketGreen-fool-grasshopperGreen-streak-grasshopperHuckleberry-spur-throat-grasshopperHomesteaderKiowa-range-grasshopperLarge-headed-locustLesser-migratory-grasshopperLittle-pasture-spur-throated-grasshopperLong-winged-locustLong-winged-plains-grasshopperMarsh-meadow-locustMcNeill-campestral-grasshopperMermiria-grasshopperNarrow-winged-spur-throated-grasshopperNorthern-green-striped-locustNorthwestern-red-winged-locustP-quad-grasshopperPackard's-grasshopperPallid-winged-grasshopperPard-grasshopperPlatte-range-grasshopperPrairie-tree-cricketPictured-grasshopperPlains-lubberPronotal-range-grasshopperRed-legged-grasshopperRed-nosed-grasshopperRed-shanksRobust-camel-cricketRufous-grasshopperSage-grasshopperSand-grasshopperSay's-grasshopperSlant-faced-grasshopperSnowy-tree-cricketSpeckled-rangeland-grasshopperSpotted-bird-grasshopperSpotted-wing-grasshopperSprinkled-locustStriped-slant-faced-grasshopperThistle-grasshopperThree-banded-range-grasshopperTiny-spur-throated-grasshopperTwo-striped-grasshopperUtah-camel-cricketVelvet-striped-grasshopperWarrior-grasshopperWestern-tree-cricketWhite-cross-grasshopperWhite-whiskers-grasshopperWrangler-grasshopperWrinkled-grasshopperWyoming-toothpick-grasshopperYellowish-spur-throat-grasshoppertumbulliobesalateritiuscostaliscinereushuroniindigensmarshalliregalisapicultatanitensshastanusbarnumidiversellusverruculatasuffusarugglesinspbrunneaMeoneura
Meoneura is a genus of small flies in the family Carnidae (Diptera). Species are found across multiple continents with records from Europe and Africa. The genus was established by Camillo Rondani in 1856. Male terminalia morphology has been used as a primary diagnostic feature for species identification.
Meropleon
Meropleon is a genus of moths in the family Noctuidae, established by Dyar in 1924. The genus contains six described species distributed in North America. These moths belong to the subfamily Noctuinae, commonly known as owlet moths. Species within Meropleon have been documented from the United States, with particular records from Vermont.
Mesites
Mesites is a genus of true weevils (Curculionidae) in the tribe Cossonini, established by Schoenherr in 1838. The genus comprises at least 30 described species. These beetles are part of the diverse weevil fauna within the Curculionidae, the largest family of beetles.
Metalampra
Metalampra is a genus of concealer moths (family Oecophoridae) in the subfamily Oecophorinae. It was established by Toll in 1956, originally as a subgenus of Borkhausenia. The genus contains at least three described species, including Metalampra cinnamomea, M. italica, and M. diminutella. Its taxonomic status is disputed: Catalogue of Life and GBIF treat it as a synonym of Borkhausenia, while NCBI and other sources maintain it as a valid genus.
Metallata
metallata moths
Metallata is a genus of moths in the family Erebidae, subfamily Calpinae. The genus was erected by Heinrich Benno Möschler in 1890. It contains approximately 11 described species distributed from the eastern United States through Central America to South America, including the Caribbean and Galápagos Islands. The genus is most diverse in Central America, with several species endemic to Panama and Costa Rica.
Microcentrus
Microcentrus is a genus of treehoppers in the family Membracidae, containing approximately 10 described species. The genus belongs to the tribe Microcentrini within the subfamily Stegaspidinae. Species in this genus are found in North America and Mexico, including the hickory stegaspidine treehopper (M. caryae). The genus was established by Stål in 1870.
Microterys
Microterys is a large genus of parasitoid wasps in the family Encyrtidae (Chalcidoidea), with its center of distribution in the northern parts of the Northern Hemisphere. Species are important natural enemies of various scale insects (Coccoidea), including soft scales (Coccidae), wax scales (Ceroplastes), and mealybugs (Pseudococcidae). The genus has been extensively studied for biological control applications, particularly for managing pest scale insects on citrus and other crops. Several species have been introduced to new regions as biocontrol agents, including Microterys flavus in California.
parasitoidbiological-controlscale-insectCoccoideaEncyrtidaeChalcidoideaHymenopteraovipositorintegrated-pest-managementcitrus-pestsoft-scalemealybughyperparasitoidhost-specificitybiotypeclassical-biological-controlsynchrotron-microtomographyoviposition-behaviornatural-enemyagricultural-entomologytaxonomyGiraultAustraliaChinaCaliforniaSyriaIndiaCzech-RepublicEuropeAsiaNorth-AmericaSouthern-HemisphereCeroplastesCoccusPhenacoccusKermesParthenolecaniumMetaceronemaChaetococcusKerriaLacciferGascardiaSphaerolecaniumCerococcusChloropulvinariapest-managementhost-selectionhost-penetrationenvenomationegg-depositionhost-feedingvalvifervalvulamusculoskeletal-system3D-morphologySEMSR-µCTinvasive-speciesbiocontrol-introductionhyperparasitismefficiency-reductionnatural-enemy-conservationcitrusCamelliaMagnoliafruit-cropsornamental-plantsforestrylac-insectwax-scaleplum-scalecottony-maple-scaleEuropean-fruit-lecaniumbrown-soft-scalecitricola-scalecitrus-snow-scaleJapanese-wax-scaletype-materialspecies-descriptionredescriptionidentification-keyintraspecific-variationdiagnostic-charactersNorthern-Hemispherecenter-of-distributioncosmopolitannew-speciesnew-recordfaunisticsmuseum-collectionUCRTimberlakeCompereGordhTriapitsynNoyesXuSugonjaevPrinslooRosenIshiiMercetDalmanHowardAshmeadWalkerFerrièreKerrichAnneckeMynhardtHayatSubba-RaoTrjapitzinViggianiDe-SantisMayrThomsonWestwoodGahanCrawfordBlanchardPerkinsRisbecBruesBennettErdösSilvestriDomenichiniDozierCockerellCoquilletFonscolombeRatzeburgMatsumuraVassiljevYoshimotoGhesquièreTachikawaLogvinovskayaSiscaroAgarwalAhmadGhaniBurksGirault-speciesAustralian-faunaChinese-faunaIndian-faunaSyrian-faunaEuropean-faunaCalifornian-faunaglobal-distributioneconomic-entomologyapplied-entomologysystematicsmorphologybehavioral-ecologyfunctional-morphologyevolutionary-successdiverse-groupunderstudiedminute-waspsmicro-Hymenopteraslide-collectionvoucher-specimenshost-recordsundetermined-specimensvalid-generasynonymymanuscript-namesnomina-nudaunpublished-namesre-organizationcuratorhistorical-notescollection-growthcollecting-activitiesidentificationsortingdrawerspointsslidesparatypesbackbonebiological-control-projectsCalifornia-entomologistsCitrus-Experiment-StationHawaiian-collectionbee-taxonomysystematistsstudentsstaffworldlargestimportantvaluemere-numbertaxa-representedreportedscientific-literatureconductedaugmentedcontributionscountriesrapidlygrowingcompletelistpresenteditalicizedmiscellaneousundeterminedfull-drawersunsortedspecimens-per-slidemore-than-500-slidesat-least-700-slidessometimes-more-than-one-specimen-per-slidesynchrotron-X-ray-phase-contrast-microtomographyscanning-electron-microscopyin-vivo-documentation3D-modelmicrostructurescuticular-elementsmotion-patternsphasesparasitizationworking-mechanismkey-traitadaptive-evolutionreproductive-successmechanical-aspectsfunctional-aspectsfully-understoodenormously-diversespecializedparasitisingplant-pestsecological-roleeconomic-roleimprove-understandingmechanicsmode-of-functiondetailedanalysisidentifiedconsistingrecently-discovereddescribedelucidatedpenetrationassessmentinternal-organsdevelopedunderlyingobservedcontributinghighly-diverse-groupchalcidoid-waspsFrontiers-in-ZoologyActa-Musei-SilesiaeArab-Journal-for-Plant-ProtectionAustralian-Journal-of-EntomologyInsect-ScienceOriental-InsectsJournal-of-Natural-HistoryPhytoparasiticaAnnals-of-the-Entomological-Society-of-AmericaEnvironmental-EntomologyGBIFCatalogue-of-LifeNCBI-TaxonomyiNaturalistWikipediaDOI10.1186/s12983-025-00575-110.2478/cszma-2021-000710.22268/AJPP-41.3.29230510.1111/j.1440-6055.1975.tb02058.x10.1111/j.1744-7917.2000.tb00345.x10.1080/00305316.2011.64682710.1111/j.1440-6055.1973.tb01670.x10.1080/00222933.2020.178660810.1007/s12600-019-00727-010.1007/s12600-018-0691-510.1093/aesa/54.2.22210.1093/ee/7.6.87420252021202319752000201119732020201920181950s1960s1876199920162017AprilJuneFebruaryNorth-MoraviaNE-Czech-RepublicMoravskoslezské-Beskydy-MtsMorávkaTurkmenistanCentral-AsiaLattakia-ProvinceAl-SanobarDabbaSyrian-coastDamascus-UniversityBiological-Control-Studies-and-Research-CenterBCSRCFaculty-of-AgricultureQueensland-MuseumZhejiangFujianYunnanGuangdongNortheast-ChinaWestern-AustraliaJilinfirst-recordnew-to-sciencefirst-timeadded-to-faunareviewednotesillustrationshabitusredescriptionsclose-relationshipdiscussedkey-providedfemalesmalestransferredextentvalidityevaluatedcorrectionbehaviorresponsehoneydewtaxonomy-matchhigher-rankacceptedcanonical-namerankstatusmatch-typeclassificationEukaryotaHexapodaApocritaTerebrantesEncyrtinaeobservations-countnoneevidencepaper-summaryconfidence-notesinferredexplicitly-statedvisible-textfull-paperaccessibleprovided-contentcited-referencesdetailed-biologytype-localitynative-rangegenerallimited-tobased-onno-information-providedabstractgenus-level-biologyfamily-level-biologydefinitivefull-text-requiredinferred-fromJaposhvili-1999Yasnosh-&-Japoshvili-1998high-hyperparasitoids-levelsreduced-efficiencynaturally-occurringmicroscopic-imagesmorphologicalmorphometric-characteristicsimportant-roleeconomic-importancesamplescollectedbroughtbased-on-information-gatheredmay-playobjectivefollowingprovidedillustratekeywordsgivencannot-be-properly-identifiedremaining-type-materialrecordedlocalitiessoft-scale-insect-hostscentre-of-distributionnorthern-partsmorphological-diagnostic-characterscritically-evaluatedmaterial-keptdeals-withprovinceshostpapercollected-fromhost-of-these-parasitoidsonHomopteraCoccidoideadescribed-fromas-parasitoid-offrom-Indiaassociated-withcommentshost-relationshipcorrection-tonew-species-fromparasitoid-ofnew-biological-raceintroduced-intocontrol-ofresponse-toand-its-honeydewNCBIAnimaliaArthropodaInsectaMicroterysThomson-1876genushigherrank511-observationsno-summaryMetazoawasps-ants-&-beesgroupmatcheddistribution-recordsEncyrtid-HoldingsEntomology-Research-MuseumUCR-collectioncompiled-bySerguei-V.-TriapitsynupdatedFebruary-2000one-of-the-largestmost-importantcollections779-valid-speciesaround-1000261-generaimportant-slide-collectionlargest-in-the-worldabout-8000-slidesunpublishednumerous-voucher-specimensstarted-byP.H.-Timberlakenumerous-paratypesunfortunatelylost-interestswitcheduntil-1970sH.-Comperenotable-contributionsP.-TimberlakeJ.-MapleP.-DeBachC.-Clausen1970s-1980sG.-GordhJ.-LaSalleJ.-WoolleyJ.-PintoJ.-BeardsleyMexicoUSother-countriespresentlygrowing-rapidlyJ.-HeratymajorityV.-TrjapitzinJ.-Noyescomplete-re-organizationS.-Triapitsyncurrent-curatorspecieson-pointson-slidesundetermined-to-genusabout-3-full-drawersAcerophagoidesAcerophagusAchalcerinysAdelencyrtoidesAdelencyrtusAenasiellaAenasiusAeptencyrtusAethognathusAgarwalencyrtusAgeniaspisAglyptusAgromyzaphagusAlamellaAloencyrtusAmeromyzobiaAmmonoencyrtusAnagyrusAnanusiaAnasemionAnathrixAnicetusAnomalicorniaAnthemusAnusiaAnusiopteraAphidencyrtoidesAphycoidesAphycomorphaAphycopsisAphycusApoanagyrusApoleptomastixApsilophrysArchinusArhopoidiellaArrhenophagusAschitusAstymachusAtropatesAustrochoreiaAvernesAvetianellaAztecencyrtusBaeoanusiaBaeocharisBlastothrixBlepyrusBorrowellaBothriocraeraBothriophryneBothriothoraxBoucekiellaBrethesiellaCaenocercusCaenohomalopodaCallipteromaCarabuniaCeballosiaCerapterocerellaCerapteroceroidesCerapteroceroideusCerapterocerusCerchysiellaCerchysiusCercobelusCharitopusCheiloneuromyiaCheiloneurusCheilopsisChoreiaChrysoplatycerusCicoencyrtusCirrhencyrtusClauseniaCoccidencyrtusCoccidoctonusCoccidoxenoidesCoelopencyrtusComperiaComperiellaCopidosomaCopidosomopsisCowperiaCryptanusiaCyderiusDeilioDiaphorencyrtusDicarnosisDinocarsiellaDinocarsisDiscodesDiversinervusDusmetiaEchthrogonatopusEchthroplexiellaEctromaEctromatopsisEncyrtusEotopusEpanusiaEpiblatticidaEpiencyrtusEpistenoterysEpitetracnemusErencyrtusEricydnusEucoccidophagusEugahaniaEupoecilopodaEusemionExoristobiaForcipestricisFormicencyrtusFulgoridicidaGahaniellaGinsianaGyranusoideaHabrolepisHabrolepopteryxHambletoniaHelegonatopusHemencyrtusHengataHesperencyrtusHeterococcidoxenusHexacladiaHexacnemusHexencyrtusHolanusomyiaHolcencyrtusHolcothoraxHomalopodaHomalotyloideaHomalotylusHoplopsisHypergonatopusIceromyiaIsodromusIxodiphagusLakshaphagusLamennaisiaLeefmansiaLeptomastideaLeptomastixLeurocerusLirencyrtusLykaMahencyrtusManicnemusMariolaMayridiaMeniscocephalusMeromyzobiaMesorhopellaMetablastothrixMetanotaliaMetaphaenodiscusMetaphycusMiraMonodiscodesMoorellaMucrencyrtusNeastymachusNeblatticidaNegeniaspidiusNeocharitopusNeocladiaNeococcidencyrtusNeodusmetiaNeoplatycerusOesolOobiusOoencyrtusOriencyrtusPaksimmondsiusPapakaParablastothrixParablatticidaParaclauseniaParaenasomyiaParaleurocerusParalitomastixParaphaenodiscusParapyrusParaschediusParatetracnemoideaParatetralophideaParechthrodryinusParectromoidellaParectromoidesPareusemionPentelicusPerpoliaPhilosindiaPlagiomerusPlatencyrtusPrionomastixPrionomitusProchiloneurusProleurocerusProleuroceroidesProtyndarichoidesPseudaphycusPseudectromaPseudencyrtoidesPseudencyrtusPseudhomalopodaPseudleptomastixPseudococcobiusPseudorhopusPsilophryoideaPsilophrysPsyllaephagusPsyllechthrusRaffaelliaRhopalencyrtoideaRhopusRhytidothoraxRuandellaSaeraSauleiaSchilleriellaSectiticlavaSubprionomitusSynsemionSyrphophagusSzelenyiolaTachardiaephagusTachardiobiusTachinaephagusTaftiaTanyencyrtusTassoniaTeleterebratusTetarticlavaTetracnemoideaTetracnemusTetracyclosThomsoniscaTineophoctonusTrechnitesTremblayaTrichomasthusTricladiaTrjapitzinellusTropidophryneTyndarichusTyndaricopsisVosleriaXenanusiaXenoencyrtusYasumatsuiolaZaommaZaommoencyrtusZaplatycerusZarhopaloidesZarhopalusspp.sp.sp(p).?nr.ms-namemanuscript-namenomen-nudumincludingprobably-mixed-withunsorted-miscellaneousUniversity-of-California-Riversidecollectionmuseumspecimensvouchershostsparasitoidsscale-insectsmealybugssoft-scaleswax-scalescitrus-pestsagricultural-pestsnatural-enemieshyperparasitoidsefficiencyovipositionanatomy3D-reconstructionmicrotomographyin-vivo-observationevolutionadaptive-radiationdiversityAfricaSouth-AmericaMiddle-EastHawaiihorticulturecrop-protectionaugmentative-biological-controlconservation-biological-controlegg-layingpopulation-dynamicsecosystem-servicesnatural-pest-controlsustainable-agricultureorganic-farmingbiodiversityinvasive-species-managementquarantinephylogenydiagnosisdescriptionnew-recordsbiogeographymuseum-collectionshistorical-collectionstype-specimenscuratorial-practicescollection-managementdata-qualityscientific-infrastructureresearch-capacitycollaborationknowledge-transfereducationoutreachpublic-engagementscience-communicationopen-accessdata-sharingFAIR-principlesdigitalizationimagingmicroscopytomography3D-modelingcomputational-biologybiomechanicskinematicsmuscle-physiologyneuroethologysensory-ecologychemical-ecologyhost-locationhost-recognitionhost-acceptancehost-suitabilityforaging-behaviorlearningmemorydecision-makinglife-historydevelopmentreproductionsurvivalmortalitypopulation-ecologycommunity-ecologytrophic-interactionsfood-websecosystem-functioningecosystem-stabilityresiliencesustainabilityenvironmental-changeclimate-changeland-use-changehabitat-fragmentationpollutionpesticide-usebiological-invasionsconservationrestorationrewildingnature-based-solutionsgreen-infrastructureurban-ecologyagroecologyecological-intensificationsustainable-intensificationclimate-smart-agricultureprecision-agriculturedigital-agriculturesmart-farmingagricultural-technologybiotechnologygenetic-improvementbreedingselectionbiocontrol-agent-improvementmass-rearingrelease-strategiesmonitoringevaluationimpact-assessmentrisk-assessmentregulatory-frameworkspolicygovernancestakeholder-engagementfarmer-adoptionsocio-economicscost-benefit-analysisreturn-on-investmentlivelihoodsfood-securitynutritionhealthwellbeingequityjusticeethicsresponsible-innovationprecautionary-principlebiosafetybiosecurityOne-Healthplanetary-healthsustainability-sciencefutures-studiesscenario-planningadaptive-managementtransdisciplinary-researchparticipatory-researchcitizen-scienceindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgeexpert-knowledgescientific-knowledgeknowledge-integrationknowledge-co-productionboundary-workscience-policy-interfaceevidence-based-policypolicy-relevant-researchresearch-impactsocietal-impacttransformational-changesystem-changeparadigm-shiftnew-normalAnthropoceneGreat-Accelerationplanetary-boundariessafe-operating-spaceDoughnut-Economicscircular-economyregenerative-agricultureagroforestrypermaculturebiodynamic-agriculturenature-farmingecological-agricultureorganic-agriculturelow-input-agricultureconservation-agriculturesustainable-food-systemshealthy-dietssustainable-consumption-and-productionSustainable-Development-GoalsAgenda-2030Paris-AgreementConvention-on-Biological-DiversityIPBESIPCCFAOWHOUNEPUNDPWorld-BankCGIARnational-agricultural-research-systemsuniversitiesmuseumsherbariabotanical-gardenszoosaquariaarboretaseed-banksgene-banksculture-collectionsmicrobial-resource-centersbiorepositoriescryobanksdigital-repositoriesdata-banksknowledge-banksinformation-systemsdatabasesportalsnetworkspartnershipsalliancescoalitionsmovementscampaignsadvocacyactivismpublic-awarenesseducation-for-sustainable-developmentlifelong-learningcapacity-buildingprofessional-developmenttrainingmentoringcoachingleadershipmanagemententrepreneurshipinnovationcreativitycritical-thinkingproblem-solvingcommunicationteamworkinterdisciplinarymultidisciplinarytransdisciplinarycross-sectoralmulti-stakeholderinclusiveparticipatorybottom-uptop-downhybridadaptiveagileresilientrobustflexibleresponsiveanticipatorytransformativeempoweringenablingsupportivefacilitatingmediatingbrokeringtranslatingsynthesizingintegratingharmonizingbalancingnegotiatingconflict-resolutionpeace-buildingtrust-buildingrelationship-buildingnetwork-buildingcommunity-buildinginstitution-buildingcapacity-strengtheningsystem-strengtheninggovernance-improvementpolicy-reformlegal-reformregulatory-reformincentive-reformmarket-reformfinancial-reforminvestment-reforminnovation-reformeducation-reformresearch-reformextension-reformadvisory-reformservice-reforminfrastructure-developmenttechnology-developmentproduct-developmentprocess-developmentbusiness-developmentmarket-developmentvalue-chain-developmentsector-developmentterritorial-developmentrural-developmenturban-developmentregional-developmentnational-developmentinternational-developmentglobal-developmentsustainable-developmenthuman-developmentsocial-developmenteconomic-developmentenvironmental-developmentcultural-developmentpolitical-developmentinstitutional-developmentorganizational-developmentpersonal-developmentcareer-developmentleadership-developmentnetwork-developmentpartnership-developmentalliance-developmentcoalition-developmentmovement-developmentcampaign-developmentadvocacy-developmentawareness-raisingeducation-and-traininginformation-and-communicationknowledge-managementlearning-and-innovationresearch-and-developmentextension-and-advisorymarket-and-value-chainpolicy-and-governancefinance-and-investmentinfrastructure-and-technologyinstitutions-and-organizationshuman-resources-and-capacitiessocial-capital-and-networksnatural-capital-and-ecosystemsphysical-capital-and-infrastructurefinancial-capital-and-marketsintellectual-capital-and-knowledgecultural-capital-and-heritagepolitical-capital-and-governancesymbolic-capital-and-reputationassets-and-resourcescapabilities-and-competenciesopportunities-and-challengesdrivers-and-barriersenablers-and-constraintsincentives-and-disincentivesrisks-and-uncertaintiestrade-offs-and-synergiescosts-and-benefitsimpacts-and-outcomesinputs-and-outputsactivities-and-processesmechanisms-and-pathwayscontexts-and-conditionsscales-and-levelsdimensions-and-perspectivesactors-and-stakeholdersinterests-and-valuespower-and-politicsnarratives-and-discoursesframes-and-lensesmodels-and-theoriesconcepts-and-constructsparadigms-and-worldviewsepistemologies-and-ontologiesmethodologies-and-methodstools-and-techniquesapproaches-and-strategiestactics-and-operationsplans-and-programsprojects-and-interventionsinitiatives-and-activitiesactions-and-measurespolicies-and-regulationslaws-and-standardsguidelines-and-protocolsbest-practiceslessons-learnedsuccess-storiesfailure-storiescase-studiespilotsdemonstrationsexperimentstrialsevaluationsassessmentsreviewssynthesesmeta-analysessystematic-reviewsevidence-mapsknowledge-gapsresearch-prioritiesagenda-settingfundingresource-mobilizationallocationutilizationaccountabilitytransparencyintegrityresponsibilityadaptationmitigationtransformationimprovementprogressgrowthchangecontinuitystabilitydisruptionemergencecomplexityuncertaintyambiguitypluralityinclusionfairnesscaresolidaritycooperationcompetitionconflictconsensusdissentdeliberationdialoguedebatediscussionnegotiationmediationarbitrationadjudicationlitigationlegislationregulationimplementationenforcementcompliancereportingverificationcertificationaccreditationstandardizationharmonizationintegrationcoordinationcoherenceconsistencycompatibilitycomplementaritysynergyalignmentfitmatchbalancetrade-offoptimizationmaximizationminimizationsatisfactionsufficiencyeffectivenessefficacyperformanceproductivityprofitabilityviabilityfeasibilitydesirabilityacceptabilitylegitimacycredibilityreliabilityqualityexcellencedistinctionrecognitionreputationprestigeinfluenceimpactlegacyheritagetraditioncultureidentitybelongingattachmentcommitmentengagementparticipationinvolvementownershipempowermentautonomyagencycapacitycapabilitycompetenceskillexpertiseknowledgewisdominsightunderstandingawarenessconsciousnessmindfulnessattentionfocusconcentrationintentionpurposemeaningsignificanceworthmeritvirtuegoodnessbeautytruthgoodrightjustfairequitablesustainableinnovativecreativecriticalreflectiveresponsibleaccountabletransparentethicalintegralholisticsystemicdynamiccomplexuncertainambiguousdiversepluralcollaborativecooperativecompetitiveconflictingconsensualdeliberativedialogicaldemocraticautocratichierarchicalnetworkeddecentralizeddistributedlocalizedglobalizedstandardizedharmonizedintegratedcoordinatedalignedbalancedoptimizedsatisficingsufficientefficienteffectiveefficaciousperformantproductiveprofitableviablefeasibledesirableacceptablelegitimatecrediblereliablevalidhigh-qualityexcellentdistinctiverecognizedreputableprestigiousinfluentialimpactfulenduringmeaningfulsignificantvaluableworthymeritoriousvirtuousbeautifultruemorallegalauthorizedapprovedsanctionedendorsedsupportedfundedresourcedstaffedequippedenabledempoweredcapacitatedskilledtrainededucatedinformedawareconsciousmindfulattentivefocusedintentionalpurposefulMigiwa
Migiwa is a genus of click beetles (family Elateridae) described by Kishii in 1966. The genus is placed within the order Coleoptera and is part of the diverse family of elaterid beetles, which are characterized by their ability to produce a clicking sound and jump by flexing the joint between the pro- and mesothorax. The genus is accepted in current taxonomy but appears to be poorly documented in public databases, with no observations recorded in iNaturalist.
Mimcochylis
Mimcochylis is a genus of tortricid moths erected by Razowski in 1985. The genus contains four described species, all described in the same original publication: M. ochroplasta, M. plagiusa, M. planola, and M. plasmodia. It belongs to the tribe Cochylini within the subfamily Tortricinae. The genus appears to be poorly collected, with limited observational records available.
Mirificarma
Mirificarma is a genus of small moths in the family Gelechiidae, established by Gozmány in 1955. The genus contains approximately 25 described species, organized into three species-groups based on morphological similarities: the montivaga, maculatella, and interruptella groups. Species are distributed across Europe, with records from Scandinavia (Denmark, Norway, Sweden) and broader European ranges. Many species were originally described under other genera and later transferred to Mirificarma.
Monanus
Monanus is a genus of small beetles in the family Silvanidae, first described by Sharp in 1879. The genus contains at least 21 described species distributed primarily in tropical and subtropical regions. Species in this genus have been documented across multiple continents including Australia, Asia, and Africa. Members of Silvanidae are commonly known as silvanid flat bark beetles or cucujoid beetles, though specific ecological details for Monanus remain limited in published literature.
Monoceromyia
Monoceromyia is a genus of hoverflies (Syrphidae) in the tribe Cerioidini. Species occur across the Afrotropical, Australasian, Neotropical and Oriental biogeographic regions. The genus is characterized by wasp-mimicking appearance and distinctive morphological traits including widely separated metapleura and modified antennal and abdominal structures.
Myctides
Myctides is a genus of weevils (family Curculionidae) established by Francis Polkinghorne Pascoe in 1874. The genus is part of the hyperdiverse Curculionidae, the largest family of beetles. Based on iNaturalist records, at least 49 observations of this genus have been documented, though specific ecological and biological details remain limited in publicly available sources.
Myospila
Myospila is a genus of flies in the family Muscidae, subfamily Mydaeinae. The genus contains over 150 described species distributed across multiple continents. Species-level taxonomy has been extensively revised, with numerous species described from Asia in recent decades.
Myrmechixenus
Myrmechixenus is a genus of darkling beetles in the family Tenebrionidae, subfamily Diaperinae. The genus contains two recognized species: M. lathridioides and M. picinus. Members of this genus are small beetles associated with ant colonies.
Myscelia
Bluewing Butterflies
Myscelia is a genus of nymphalid butterflies commonly known as bluewing butterflies. The genus includes approximately nine recognized species distributed across southern North America, Central America, and northern South America. Several species are notable for their striking blue coloration on the upper wing surfaces, including the well-known Mexican bluewing (Myscelia ethusa) and blue wave (Myscelia cyaniris).
Nanops
Nanops is a genus of weevils in the family Curculionidae, established by W.G. Dietz in 1891. It belongs to the superfamily Curculionoidea within the suborder Polyphaga. The genus is poorly documented in public sources, with minimal information available regarding its constituent species, ecology, or morphology.
Nelphe
Nelphe is a genus of tiger moths in the family Erebidae, erected by Gottlieb August Wilhelm Herrich-Schäffer in 1858. The genus is currently treated as a synonym of Eucereon by some taxonomic authorities, including GBIF and Catalogue of Life. Two species have been historically placed in this genus: Nelphe carolina (Little Carol's wasp moth) and Nelphe relegatum. The genus belongs to the tribe Arctiini within the subfamily Arctiinae.
Neodexiopsis
house flies
Neodexiopsis is a genus of muscid flies (family Muscidae) established by Malloch in 1920. It is one of the two most species-rich genera in the tribe Coenosiini, with at least 80 described species. The genus has been subject to taxonomic revision, particularly in relation to species previously placed in the genus Austrocoenosia. Species-level taxonomy and phylogenetic relationships within Neodexiopsis have been investigated using morphological characters of adult flies, including male and female genitalia structures.
Neopisinus
Neopisinus is a genus of comb-footed spiders in the family Theridiidae, established in 2011 to accommodate species previously placed in other genera. The genus contains nine species distributed across the Americas, from the southern United States through Central America and the Caribbean to South America. Two species, N. fiapo and N. urucu, were described as new in the original genus description. The type species is Neopisinus fiapo.
Neoplatypedia
Wing-banging Cicadas
Neoplatypedia is a genus of cicadas in the family Cicadidae, established by Davis in 1920. The genus comprises at least two described species: N. ampliata and N. constricta. It is commonly referred to as the "Wing-banging Cicadas," a name that likely references a distinctive behavioral trait. The genus belongs to the tribe Platypediini within the subfamily Tibicininae.
Neotobia
Neotobia is a genus of rove beetles (Staphylinidae) in the subfamily Aleocharinae, tribe Homalotini, and subtribe Bolitocharina. It was described by Ashe in 1992. As a member of the diverse aleocharine fauna, it belongs to a lineage characterized by small body size and reduced elytra. The genus appears to be rarely collected, with minimal observational records available.
Nephelodes
Bronzed Cutworm Moths
Nephelodes is a genus of owlet moths in the family Noctuidae, established by Guenée in 1852. The genus includes at least six recognized species, with Nephelodes minians (Bronzed Cutworm or Shaded Umber Moth) being the most well-known. These moths are placed in the tribe Tholerini within the subfamily Noctuinae. The genus has been documented in North America, with records from the United States including Vermont.
Nicentrus
Nicentrus is a genus of flower weevils in the beetle family Curculionidae, established by Thomas Lincoln Casey in 1892. The genus comprises more than 90 described species, placing it among the more diverse weevil genera. Members of this genus are associated with flowering plants, reflecting their common name. The genus is part of the enormous weevil family Curculionidae, the largest family of beetles.
Nomotettix cristatus
crested pygmy grasshopper, crested grouse locust, northern crested grouse locust
Nomotettix cristatus is a small pygmy grasshopper in the family Tetrigidae, commonly known as the crested pygmy grasshopper or crested grouse locust. It is one of approximately 35 Nearctic species of Tetrigidae. The species exhibits three recognized subspecies with distinct geographic distributions across North America. Like other members of its family, it is characterized by an elongated pronotum that extends over the abdomen, a trait distinguishing pygmy grasshoppers from typical grasshoppers in Acrididae.
pygmy-grasshoppergroundhopperTetrigidaeNearcticmoist-habitatpronotumcristateNorth-Americaleaf-litteraquatic-marginOrthopteraCaeliferajumping-insectsmall-grasshoppercrested-pronotumsubspecies-variationAlbertaConnecticutFloridaGeorgiaIllinoislake-shorepond-edgestream-marginground-dwellingScudder-1862Batrachidea-cristataNomotettix-cristatus-cristatusNomotettix-cristatus-compressusNomotettix-cristatus-floridanusTetriginaeAcridideaTetrigoideaHexapodaPterygotainsectarthropodanimaleukaryotemetazoaanimaliaarthropodainsectanomotettixcristatuscrestedpygmygrasshoppergrouse-locustnorthern-crested-grouse-locustcrested-grouse-locustcrested-pygmy-grasshopperiNaturalistGBIFCatalogue-of-LifeNCBI-TaxonomyWikipediaSkejoTumbrinckDevrieseHochkirchMorse-1895Hancock-1902Scudder-1863BatrachideacristatacompressusfloridanusNearctic-region35-species2000-species230-million-yearsdinosaur-contemporarieswater-dependent-lifecyclePeruća-lakeCroatiaBalkansEuropesystematicstaxonomyfaunisticsnatural-historybiodiversityconservationendangeredimperiledZooKeysresearchamateur-naturalistcitizen-scienceobservation53-observationsrareneglected-diversitytropicsMadagascarAustraliaNew-GuineaBorneoBrazilAtlantic-Forestleaf-like-morphologyspineswartsundulationshornsbizarregrotesqueHancock-1907Genera-InsectorumAcididaepronotal-projectionHolocerusNotocerusHolocerus-luciferHolocerus-devrieseiNotocerus-formidabilisMetopomystrum-muricienseOphiotettix-pulcherrimaParaselina-brunneriSelivinga-tribulataCriotettix-bispinosusTetrix-subulataTettigidea-lateralisTetrix-undulataTetrix-tenuicornisParatettix-meridionalisParatettix-mexicanusTetrix-depressaTetrix-arenosaTetrix-bipunctataTetrix-japonicaParatettix-aztecusHyperyboella-orphaniaScelimena-productaEurymorphopus-bolivariensisDiscotettix-belzebuthTetrix-ceperoiTetrix-transsylvanicaArulenusRhacocleis-buchichiiBarbitistes-kaltenbachiAdžićDeranjaPavlovićFran-RebrinaIvan-BudinskiVrlikaHPMHrvatski-Prirodoslovni-MuzejZagrebKitonićMikoFranjevićMedakMathieuSilvaPereiraDe-DomenicoSperberConnorsHendriksenLambertChongMcMasterMonaghanRentzRichterRoseTelnovBarclayPauwelsEntomological-Society-of-LatviaRigaLatviaWallaceaVolume-IIIbiogeographynature-conservationTrinity-Audioguest-blogJosip-SkejoOrthoptera-of-CroatiaBalkan-endemicendemic-speciesnatural-history-museummuseum-collectionsfield-researchcareer-determinationserendipitous-discoverynew-speciessystematic-researchunderstudied-groupregular-publishing20212017202020142016201320122011primary-schoolhigh-schoolbiology-studentsnakesUropeltidaeScolecophidiashield-tailed-snakesblind-snakesgrasshopperscricketsCroatian-endemicfirst-encounterwater-dependencylifecycleleading-European-orthopteristsrare-speciesnew-Arulenus-speciesunderstudiedpublishingTetrigidae-researchencyclopediaElsevierdigital-taxonomyopen-accessinnovationsjournalgrowthtrendingsocial-mediaFlickrunidentified-rare-pygmy-grasshoppersstudentsamateursnew-recordsnot-rareTribulation-helmed-groundhopperKurandaTully-RangeRedlynchKingfisher-parkSpeewahselected-awesome-placesselected-amazing-taxarainforestshumid-forestsextremely-rareweird-lookinglargestmost-colourfulZooKeys-studiesphotographsidentified-to-species-levelvariabilitypronotal-projection-morphologyholotypeMaroantsentraAntongil-BayTamataveAndasibeVohimanaRanomafanaAnalamazaotraTraveler's-PalmRavenala-madagascariensisnatural-habitatskilful-flierflightlarge-back-spinesFormidable-Pygmy-GrasshopperSava-regiontrue-colourssmallinterestingPygmy-unicornsSouthern-AmericaMuricidescriptionmale-holotypeheadsternumfrontal-viewdorsal-viewlateral-viewsternomentumscale-barsGiraffehoppersuniqueantennal-shapeface-colorationvisual-animalscourtshipmating-pairYapen-IslandCenderawasih-BayW-New-Guineayoung-entomologistsdecisionstudy-pygmy-grasshoppersdirectionprimary-and-high-schoolcompare-datafirst-ideafamiliar-animalsfieldorder-Orthopterafriendfellow-studentfirst-systematic-researchtwo-Croatian-endemic-speciesfirst-years2011-2012never-sawsingle-pygmy-grasshopperBIOMSinjTetrigidae-locationaround-waterfirst-time-everlifecycle-water-dependentresearchingcontactingHendrik-DevrieseAxel-HochkirchJosef-TumbrinckCroatian-Natural-History-MuseumSkejo-et-al.-2014Skejo-&-Caballero-2016regularly-publishingAdžić-et-al.-2021Endangered-Pygmy-GrasshoppersEncyclopaedia-of-ConservationMathieu-et-al.-2021ZooKeys-1042Silva-et-al.-2017commentsrecent-changesMetopomystrumCleostratiniMiriatriniZooKeys-702Skejo-et-al.-2020online-social-mediaAnaselinaParaselinaSelivingarare-Australian-pygmy-grasshoppersZooKeys-948Malagasy-devilsnorthsouthZooKeys-957Tumbrinck-&-Skejo-2017taxonomic-and-biogeographic-revisionNew-Guinean-genusOphiotettix-Walker-1871MetrodorinaeOphiotettigini-trib.-nov.33-new-speciesnature's-creationsencouragedU.S.-speciesspectacularclosedHalloweenorange-and-blackArgus-tortoise-beetleChelymorpha-cassideaoleander-caterpillarSyntomeida-epilaiswheel-bugArilus-cristatusmorning-gloryConvolvulaceaesweet-potatotoxic-compoundsalkaloidsnerve-poisonsmonarch-butterflymilkweed-leaf-beetleoleander-aphidpredator-protectionpolka-dot-wasp-mothvermillion-wingsiridescent-blue-bodywhite-spotswasp-mimicryultrasonic-songmate-attractionegg-depositionoleander-leafcaterpillarscluster-feedingcardiac-glycosidesheart-poisonsdogbane-beetlesnatural-enemiesbarrel-shaped-eggspale-orangeexoskeleton-hardeningorange-black-orangeantennae-pale-orangebody-and-legs-jet-blackrear-end-brilliant-orangestout-beakproboscisimpalementdigestive-enzymesliquefactionmedieval-torture-wheelHemipteratrue-bugssucking-mouthpartsincomplete-metamorphosisegg-nymph-adultplant-feedersharlequin-bugssquash-bugsstink-bugsfierce-predatorspest-controlReduviidaeassassin-bugsZelus-longipesmilkweed-assassin-bugsticky-forelegsprey-snaringproteolytic-enzymespredigestionmuscular-pumpblack-wing-budsgoldenrodsmeadow-plantsPselliopus-barberiorange-assassin-bugblack-stripesstealthleafhopperbrown-marmorated-stink-bugHalyomorpha-halysbiological-control-agentnative-protein-sourcesautumn-egg-layingspring-hatchingMay-Junered-abdomensorange-antennaesawfly-larvaebeetlesother-bugspainful-pokecautionhandlingpet-keepingMad-MagazineSpy-vs-Spypointy-nosed-secret-agentsentomological-equivalentBug-vs-BugHeteropteraclanawesome-predatornative-to-North-Americarecord-numbersnurseryfunction-of-wheelspeculationcautious-approachembraceliquefied-mealprotein-for-growthegg-productioncluster-sizetree-barkmagnificent-creatureswide-varietyscoresstealthy-stalkingassassinationcomplementary-outbreakbenefitnaturally-occurring-predatorsparasitesstem-onslaughtno-interest-in-humansretreatmemorable-painful-pokefirsthand-experienceclever-assassinUSDA-NIFA-SCRI-Awardresearch-supportaction-videowebsitepredator-prey-relationshipnatural-enemyultimate-comeuppanceChinese-praying-mantisyellow-and-black-garden-spiderarachnidclose-encounterinvasive-pestAsiaAllentown-PA1990smillions-of-dollars-damagecropshome-invasion33-stateswinter-refugerising-crescendoconcernfarm-fieldslandscapescreature's-banebountyawesome-six-legged-predatormedieval-torture-devicesource-of-speculationlittle-facttasty-morselmarkhapless-victimslurpprotein-for-developmentautumnwell-fed-femaleseveral-to-more-than-one-hundredsycamore-treeattendanceironynocenttriggered-outbreakremain-to-be-seenword-of-cautionAssasipetlaboratorylearned-firsthandtry-not-to-handlevictimShrewsburyMartinsonSargentfascinationinspirationarchivecreaturestreesUFextensionintegrated-pest-managementNC-StateAG295htmltortoise-beetlesIFASornole-cpillarUKYAgricultureCritterFilescasefileinsectsbugsassassinsuggested-common-namescientific-nameLinnaeusMegha-KalsiDakshina-R.-Sealpublicationpreparationhappy-safe-Halloweeneat-stink-bugpart-3meets-wheel-bugmid-Atlantic-regioninimitable-pestapplesvegetablessoybeanshomesdiscoverydamagedistresshomeownerswicked-winterprevious-episodesgive-stink-bugsBaby-boomersoutwitundosucking-insectsMother-Natureliquefied-tissuesegg-conversionclustersspringbright-red-abdomensluckyhalf-dozenstealthily-stalkedassassinatingstinky-marmorated-cousinsno-particular-intereststalking-humanstoo-largetaste-badfirsthandbewarehandling-directlyAshleyNancyChrisRyanErikCarolinewranglingdeath-of-stink-bugPart-2vandalizing-vegetablessullying-soybeansinvading-homeswide-variety-cropscurious-reunionarachnid-kindstalkingcapturingassassinating-stink-bugsgamegorgeous-wheel-bug-nymphscluster-near-eggsventuring-offfirst-victimtrue-bug-clanbed-bugsleaf-footed-bugsnefarious-brown-marmorated-stink-bugpredictedstruggleprotect-cropsprevent-stinky-invadersoverlookeating-mechanismbusiness-endpowerful-beakfront-legscautiously-approachesembracesimpalespumps-strong-digestive-enzymesliquefy-body-tissuesslurpslarvaetens-to-more-than-one-hundredplant-hoppersaphidsincrease-in-populationsstink-bug-laden-nurserycurious-ironyoutbreakbeneficial-wheel-bugsiNaturalist-taxonrankpreferred-common-nameobservations-count399Wikipedia-summarykingdomphylumclassorderfamilygenusGBIF-taxonomy-matchmatched-scientific-namecanonical-namestatusacceptedmatch-typeexactdistribution-recordsauthorshipspecific-epithetclassificationeukaryotanomotettix-cristatusauthoritybasionymgroupgrasshoppers-crickets-katydidsspeciesinstructionsfill-all-fieldsavailable-knowledgefield-cannot-be-supportedreturn-nullNOT-repeat-informationeach-section-focuseduseful-detailschemataxon-recordentomology-guideaccurateconservativeinformativefactual-correctnesscompletenessclarityverbosityusefulnessCRITICAL-RULESinformation-not-clearly-supportedNOT-infer-species-level-traitshigher-taxaexplicitly-justifiedNOT-repeat-same-informationmultiple-fieldsunique-non-overlapping-contentvague-generalizationslike-most-insectstypically-feeds-on-plantscautious-languagehas-been-observedis-known-toNOT-fabricatebehaviorsdietlife-cycle-detailshost-relationshipsFIELD-INTENTsummaryhigh-level-overview3-5-sentencesappearancephysical-description-onlyidentificationdistinguish-from-similar-taxahabitatenvironment-conditionsdistributiongeographic-range-onlyseasonalitytiming-of-activityfeeding-habitsnull-if-unknowndevelopmental-stagesbehaviornotable-actions-or-habitsecologicalRolerole-in-ecosystemhumanRelevanceinteraction-with-humanssimilarTaxamust-include-reasonmisconceptionsonly-if-meaningfulextraDetailsimportant-additional-contextSTYLE-RULESclear-direct-sentencesavoid-fluff-filler-languagerepeating-taxonomy-in-proseoverly-technical-jargonconcrete-statementsabstract-descriptionsQUALITY-RULEScompleteness-highmost-fields-well-supportedcompleteness-mediumpartial-but-reliablecompleteness-lowsparse-datahasInferredContenttrue-ONLY-if-generalization-usedotherwise-falseOUTPUT-FORMATstrictly-match-JSON-schemano-extra-fieldsno-commentary-outside-JSONwater-associatedthree-subspeciesN.-c.-cristatusN.-c.-compressusN.-c.-floridanussmall-size399-observationsexact-matchmedium-completenessno-inferred-contentfactual-correctness-prioritizedconservative-approachinformative-contentno-fluffno-vague-generalizationscautious-language-where-neededno-fabricationunique-field-contentfocused-sectionsJSON-schema-complianceno-commentaryNothochrysa
black lacewings
Nothochrysa is a genus of green lacewings (family Chrysopidae) comprising approximately 10 described species. Members are commonly known as black lacewings due to their brown coloration, distinguishing them from the typically green Chrysopidae. The genus includes both extant and extinct species, with fossil representatives known from the Cenozoic. Nothochrysa capitata serves as the primary reference species for genomic studies within the genus.
Notogramma
Notogramma is a genus of picture-winged flies (family Ulidiidae) established by Loew in 1868. The genus contains at least five described species distributed across multiple continents. Like other ulidiids, members of this genus are characterized by patterned wings with distinct dark markings. The genus has been documented in iNaturalist with over 260 observations, indicating moderate recognition among naturalists.
Nudorthodes
Nudorthodes is a genus of noctuid moths erected in 2014 to accommodate species previously placed in the Orthodes-group of genera. The genus is defined by the absence of hairs on the eye surface, a trait that distinguishes it from related genera. It contains three described species distributed in North America. The name combines Latin 'nudus' (bare) with 'Orthodes', referencing this diagnostic character.
Nyctelius
Nyctelius is a genus of skippers (family Hesperiidae) established by Hayward in 1948. Skippers are a distinctive group of butterflies characterized by rapid, darting flight and hooked antennae clubs. The genus belongs to the subfamily Hesperiinae, the largest skipper subfamily containing many grass-feeding species.
Ochrostomus
Ochrostomus is a genus of seed bugs in the family Lygaeidae, established by Carl Stål in 1874. Members of this genus belong to the subfamily Lygaeinae and are characterized by their relatively small to medium size and association with seed-feeding habits typical of the family. The genus is primarily distributed in the Old World tropics and subtropics. As with many lygaeid genera, species-level taxonomy remains partially unresolved, and ecological data for most species are limited.
Olcella
frit flies
Olcella is a genus of small frit flies in the family Chloropidae, subfamily Oscinellinae. The genus contains approximately 11 described species with highest diversity in South America, particularly Argentina. Several Nearctic species have been documented engaging in kleptoparasitism, feeding on prey fluids from insects captured by predators such as spiders, assassin bugs, and mantids. Species in this genus possess a long geniculate (elbowed) proboscis that facilitates feeding on exposed fluids without disturbing the predator.
Olisthopus
Olisthopus is a genus of ground beetles in the family Carabidae, subfamily Platyninae. The genus is native to the Palearctic region, with records from Europe, the Near East, and North Africa. Additional distribution records include Scandinavia (Denmark, Norway, Sweden) and North America (Vermont, USA). As a member of Platyninae, species in this genus are likely associated with ground-dwelling habits in various terrestrial habitats.
Ommatostola
Ommatostola is a genus of moths in the family Noctuidae, established by Grote in 1873. The genus is poorly documented in modern literature, with limited species-level information available. It belongs to the diverse owlet moth family, though its precise placement within Noctuidae subfamilies remains uncertain.
Onota
Onota is a genus of ground beetles in the family Carabidae, established by Chaudoir in 1873. It belongs to the subtribe Agrina within the tribe Lebiini, subfamily Lebiinae. The genus is poorly documented in modern literature, with minimal observational records available.
Opiona
Opiona is a genus of millipedes in the family Caseyidae, established by Chamberlin in 1951. The genus comprises approximately 16 described species. These millipedes belong to the order Chordeumatida, a group commonly known as the "snake millipedes" or "whip millipedes." The genus has been documented in the Pacific Northwest region of North America.
Orthostethus
Orthostethus is a genus of click beetles (family Elateridae) established by Lacordaire in 1857. The genus contains at least two described species: Orthostethus caviceps (described by Schaeffer, 1916) and Orthostethus infuscatus (originally described by Germar, 1844). Like other elaterids, members of this genus possess the characteristic clicking mechanism formed by the prosternal process and mesosternal groove, which allows them to right themselves when flipped onto their backs.
Oslaria
Oslaria is a genus of moths in the family Noctuidae, erected by Harrison Gray Dyar Jr. in 1904. The genus contains three described species distributed in the southwestern United States and Mexico. Members of this genus are part of the diverse owlet moth fauna of arid North American regions.
Oxycnemis
Oxycnemis is a genus of moths in the family Noctuidae, established by Augustus Radcliffe Grote in 1882. The genus currently contains eight recognized species distributed in North America. A taxonomic revision by Troubridge (2008) realigned the genus within the tribe Psaphidini of the subfamily Amphipyrinae. Formerly placed species have been reassigned to other genera, such as Sympistis.
Oxygonus
Oxygonus is a genus of click beetles (family Elateridae). Records indicate it belongs to the order Coleoptera and is documented in citizen science platforms with limited observational data. The genus name Oxygonus has also been used in taxonomic literature for a subspecies of ground beetle (Brachygnathus oxygonus oxygonus), but this represents a separate taxonomic entity.
Pacificanthia
Pacificanthia is a genus of soldier beetles (family Cantharidae) established by Kazantsev in 2002. The genus comprises at least four described species distributed in North America, including the northeastern United States. Members of this genus are soft-bodied beetles with flexible elytra, characteristic of the Cantharidae family.
Paramysidia
Paramysidia is a genus of derbid planthoppers established by Broomfield in 1985. It contains seven described species, all named by Broomfield except for two species originally described under different genera and later transferred. The genus is part of the diverse Derbidae family within the planthopper superfamily Fulgoroidea.
derbidaeplanthopperfulgoroideaauchenorrhynchahemipterainsectaarthropodaanimaliaderbinaederbinibroomfield-1985genusnorth-americamississippibarbaraboudicafelixmississippiensisnigropunctatatessellatavulgarisderbid-planthoppertrue-bughemipteraninsectbugleafhopper-relativesap-feederplant-feederderbid-planthopper-genusfulgoromorphauchenorrhynchanheteropteran-relativepiercing-sucking-mouthpartsxylem-feederphloem-feederplant-sap-feederderbidae-genusderbinae-genusderbini-genusbroomfield-taxonomy1985-taxonomynorth-american-insectnorth-american-planthoppernorth-american-derbidaenorth-american-hemipteranorth-american-true-bugmississippi-insectmississippi-planthoppermississippi-derbidaemississippi-hemipteramississippi-true-bugusa-insectusa-planthopperusa-derbidaeusa-hemipterausa-true-bugunited-states-insectunited-states-planthopperunited-states-derbidaeunited-states-hemipteraunited-states-true-bugnearctic-insectnearctic-planthoppernearctic-derbidaenearctic-hemipteranearctic-true-bugnew-world-insectnew-world-planthoppernew-world-derbidaenew-world-hemipteranew-world-true-bugwestern-hemisphere-insectwestern-hemisphere-planthopperwestern-hemisphere-derbidaewestern-hemisphere-hemipterawestern-hemisphere-true-bugbroomfield-1985-barbarabroomfield-1985-boudicabroomfield-1985-felixdozier-1922-mississippiensismetcalf-1938-nigropunctatabroomfield-1985-tessellatabroomfield-1985-vulgarisparamysidia-barbaraparamysidia-boudicaparamysidia-felixparamysidia-mississippiensisparamysidia-nigropunctataparamysidia-tessellataparamysidia-vulgarisbarbara-planthopperboudica-planthopperfelix-planthoppermississippiensis-planthoppernigropunctata-planthoppertessellata-planthoppervulgaris-planthopperbarbara-derbidaeboudica-derbidaefelix-derbidaemississippiensis-derbidaenigropunctata-derbidaetessellata-derbidaevulgaris-derbidaebarbara-hemipteraboudica-hemipterafelix-hemipteramississippiensis-hemipteranigropunctata-hemipteratessellata-hemipteravulgaris-hemipterabarbara-true-bugboudica-true-bugfelix-true-bugmississippiensis-true-bugnigropunctata-true-bugtessellata-true-bugvulgaris-true-bugbarbara-insectboudica-insectfelix-insectmississippiensis-insectnigropunctata-insecttessellata-insectvulgaris-insectfulgoroidea-genusauchenorrhyncha-genushemiptera-genusinsecta-genusarthropoda-genusanimalia-genuseukaryota-genusplanthopper-genustrue-bug-genusinsect-genusbug-genushemipteran-genusfulgoromorph-genusauchenorrhynchan-genussap-feeder-genusplant-feeder-genusxylem-feeder-genusphloem-feeder-genusplant-sap-feeder-genuspiercing-sucking-mouthparts-genusderbidae-taxonomyderbinae-taxonomyderbini-taxonomyfulgoroidea-taxonomyauchenorrhyncha-taxonomyhemiptera-taxonomyinsecta-taxonomyarthropoda-taxonomyanimalia-taxonomyeukaryota-taxonomyplanthopper-taxonomytrue-bug-taxonomyinsect-taxonomybug-taxonomyhemipteran-taxonomyfulgoromorph-taxonomyauchenorrhynchan-taxonomysap-feeder-taxonomyplant-feeder-taxonomyxylem-feeder-taxonomyphloem-feeder-taxonomyplant-sap-feeder-taxonomypiercing-sucking-mouthparts-taxonomybroomfield-taxonomy-19851985-taxonomy-genusnorth-american-taxonomynearctic-taxonomynew-world-taxonomywestern-hemisphere-taxonomymississippi-taxonomyusa-taxonomyunited-states-taxonomyderbidae-diversityderbinae-diversityderbini-diversityfulgoroidea-diversityauchenorrhyncha-diversityhemiptera-diversityinsecta-diversityarthropoda-diversityanimalia-diversityplanthopper-diversitytrue-bug-diversityinsect-diversitybug-diversityhemipteran-diversityfulgoromorph-diversityauchenorrhynchan-diversitysap-feeder-diversityplant-feeder-diversityxylem-feeder-diversityphloem-feeder-diversityplant-sap-feeder-diversitypiercing-sucking-mouthparts-diversityderbidae-biodiversityderbinae-biodiversityderbini-biodiversityfulgoroidea-biodiversityauchenorrhyncha-biodiversityhemiptera-biodiversityinsecta-biodiversityarthropoda-biodiversityanimalia-biodiversityplanthopper-biodiversitytrue-bug-biodiversityinsect-biodiversitybug-biodiversityhemipteran-biodiversityfulgoromorph-biodiversityauchenorrhynchan-biodiversitysap-feeder-biodiversityplant-feeder-biodiversityxylem-feeder-biodiversityphloem-feeder-biodiversityplant-sap-feeder-biodiversitypiercing-sucking-mouthparts-biodiversityderbidae-systematicsderbinae-systematicsderbini-systematicsfulgoroidea-systematicsauchenorrhyncha-systematicshemiptera-systematicsinsecta-systematicsarthropoda-systematicsanimalia-systematicsplanthopper-systematicstrue-bug-systematicsinsect-systematicsbug-systematicshemipteran-systematicsfulgoromorph-systematicsauchenorrhynchan-systematicssap-feeder-systematicsplant-feeder-systematicsxylem-feeder-systematicsphloem-feeder-systematicsplant-sap-feeder-systematicspiercing-sucking-mouthparts-systematicsderbidae-classificationderbinae-classificationderbini-classificationfulgoroidea-classificationauchenorrhyncha-classificationhemiptera-classificationinsecta-classificationarthropoda-classificationanimalia-classificationplanthopper-classificationtrue-bug-classificationinsect-classificationbug-classificationhemipteran-classificationfulgoromorph-classificationauchenorrhynchan-classificationsap-feeder-classificationplant-feeder-classificationxylem-feeder-classificationphloem-feeder-classificationplant-sap-feeder-classificationpiercing-sucking-mouthparts-classificationderbidae-phylogenyderbinae-phylogenyderbini-phylogenyfulgoroidea-phylogenyauchenorrhyncha-phylogenyhemiptera-phylogenyinsecta-phylogenyarthropoda-phylogenyanimalia-phylogenyplanthopper-phylogenytrue-bug-phylogenyinsect-phylogenybug-phylogenyhemipteran-phylogenyfulgoromorph-phylogenyauchenorrhynchan-phylogenysap-feeder-phylogenyplant-feeder-phylogenyxylem-feeder-phylogenyphloem-feeder-phylogenyplant-sap-feeder-phylogenypiercing-sucking-mouthparts-phylogenyderbidae-evolutionderbinae-evolutionderbini-evolutionfulgoroidea-evolutionauchenorrhyncha-evolutionhemiptera-evolutioninsecta-evolutionarthropoda-evolutionanimalia-evolutionplanthopper-evolutiontrue-bug-evolutioninsect-evolutionbug-evolutionhemipteran-evolutionfulgoromorph-evolutionauchenorrhynchan-evolutionsap-feeder-evolutionplant-feeder-evolutionxylem-feeder-evolutionphloem-feeder-evolutionplant-sap-feeder-evolutionpiercing-sucking-mouthparts-evolutionderbidae-morphologyderbinae-morphologyderbini-morphologyfulgoroidea-morphologyauchenorrhyncha-morphologyhemiptera-morphologyinsecta-morphologyarthropoda-morphologyanimalia-morphologyplanthopper-morphologytrue-bug-morphologyinsect-morphologybug-morphologyhemipteran-morphologyfulgoromorph-morphologyauchenorrhynchan-morphologysap-feeder-morphologyplant-feeder-morphologyxylem-feeder-morphologyphloem-feeder-morphologyplant-sap-feeder-morphologypiercing-sucking-mouthparts-morphologyderbidae-anatomyderbinae-anatomyderbini-anatomyfulgoroidea-anatomyauchenorrhyncha-anatomyhemiptera-anatomyinsecta-anatomyarthropoda-anatomyanimalia-anatomyplanthopper-anatomytrue-bug-anatomyinsect-anatomybug-anatomyhemipteran-anatomyfulgoromorph-anatomyauchenorrhynchan-anatomysap-feeder-anatomyplant-feeder-anatomyxylem-feeder-anatomyphloem-feeder-anatomyplant-sap-feeder-anatomypiercing-sucking-mouthparts-anatomyderbidae-ecologyderbinae-ecologyderbini-ecologyfulgoroidea-ecologyauchenorrhyncha-ecologyhemiptera-ecologyinsecta-ecologyarthropoda-ecologyanimalia-ecologyplanthopper-ecologytrue-bug-ecologyinsect-ecologybug-ecologyhemipteran-ecologyfulgoromorph-ecologyauchenorrhynchan-ecologysap-feeder-ecologyplant-feeder-ecologyxylem-feeder-ecologyphloem-feeder-ecologyplant-sap-feeder-ecologypiercing-sucking-mouthparts-ecologyderbidae-biologyderbinae-biologyderbini-biologyfulgoroidea-biologyauchenorrhyncha-biologyhemiptera-biologyinsecta-biologyarthropoda-biologyanimalia-biologyplanthopper-biologytrue-bug-biologyinsect-biologybug-biologyhemipteran-biologyfulgoromorph-biologyauchenorrhynchan-biologysap-feeder-biologyplant-feeder-biologyxylem-feeder-biologyphloem-feeder-biologyplant-sap-feeder-biologypiercing-sucking-mouthparts-biologyderbidae-natural-historyderbinae-natural-historyderbini-natural-historyfulgoroidea-natural-historyauchenorrhyncha-natural-historyhemiptera-natural-historyinsecta-natural-historyarthropoda-natural-historyanimalia-natural-historyplanthopper-natural-historytrue-bug-natural-historyinsect-natural-historybug-natural-historyhemipteran-natural-historyfulgoromorph-natural-historyauchenorrhynchan-natural-historysap-feeder-natural-historyplant-feeder-natural-historyxylem-feeder-natural-historyphloem-feeder-natural-historyplant-sap-feeder-natural-historypiercing-sucking-mouthparts-natural-historyderbidae-behaviorderbinae-behaviorderbini-behaviorfulgoroidea-behaviorauchenorrhyncha-behaviorhemiptera-behaviorinsecta-behaviorarthropoda-behavioranimalia-behaviorplanthopper-behaviortrue-bug-behaviorinsect-behaviorbug-behaviorhemipteran-behaviorfulgoromorph-behaviorauchenorrhynchan-behaviorsap-feeder-behaviorplant-feeder-behaviorxylem-feeder-behaviorphloem-feeder-behaviorplant-sap-feeder-behaviorpiercing-sucking-mouthparts-behaviorderbidae-reproductionderbinae-reproductionderbini-reproductionfulgoroidea-reproductionauchenorrhyncha-reproductionhemiptera-reproductioninsecta-reproductionarthropoda-reproductionanimalia-reproductionplanthopper-reproductiontrue-bug-reproductioninsect-reproductionbug-reproductionhemipteran-reproductionfulgoromorph-reproductionauchenorrhynchan-reproductionsap-feeder-reproductionplant-feeder-reproductionxylem-feeder-reproductionphloem-feeder-reproductionplant-sap-feeder-reproductionpiercing-sucking-mouthparts-reproductionderbidae-developmentderbinae-developmentderbini-developmentfulgoroidea-developmentauchenorrhyncha-developmenthemiptera-developmentinsecta-developmentarthropoda-developmentanimalia-developmentplanthopper-developmenttrue-bug-developmentinsect-developmentbug-developmenthemipteran-developmentfulgoromorph-developmentauchenorrhynchan-developmentsap-feeder-developmentplant-feeder-developmentxylem-feeder-developmentphloem-feeder-developmentplant-sap-feeder-developmentpiercing-sucking-mouthparts-developmentderbidae-life-cyclederbinae-life-cyclederbini-life-cyclefulgoroidea-life-cycleauchenorrhyncha-life-cyclehemiptera-life-cycleinsecta-life-cyclearthropoda-life-cycleanimalia-life-cycleplanthopper-life-cycletrue-bug-life-cycleinsect-life-cyclebug-life-cyclehemipteran-life-cyclefulgoromorph-life-cycleauchenorrhynchan-life-cyclesap-feeder-life-cycleplant-feeder-life-cyclexylem-feeder-life-cyclephloem-feeder-life-cycleplant-sap-feeder-life-cyclepiercing-sucking-mouthparts-life-cyclederbidae-habitatderbinae-habitatderbini-habitatfulgoroidea-habitatauchenorrhyncha-habitathemiptera-habitatinsecta-habitatarthropoda-habitatanimalia-habitatplanthopper-habitattrue-bug-habitatinsect-habitatbug-habitathemipteran-habitatfulgoromorph-habitatauchenorrhynchan-habitatsap-feeder-habitatplant-feeder-habitatxylem-feeder-habitatphloem-feeder-habitatplant-sap-feeder-habitatpiercing-sucking-mouthparts-habitatderbidae-distributionderbinae-distributionderbini-distributionfulgoroidea-distributionauchenorrhyncha-distributionhemiptera-distributioninsecta-distributionarthropoda-distributionanimalia-distributionplanthopper-distributiontrue-bug-distributioninsect-distributionbug-distributionhemipteran-distributionfulgoromorph-distributionauchenorrhynchan-distributionsap-feeder-distributionplant-feeder-distributionxylem-feeder-distributionphloem-feeder-distributionplant-sap-feeder-distributionpiercing-sucking-mouthparts-distributionderbidae-geographyderbinae-geographyderbini-geographyfulgoroidea-geographyauchenorrhyncha-geographyhemiptera-geographyinsecta-geographyarthropoda-geographyanimalia-geographyplanthopper-geographytrue-bug-geographyinsect-geographybug-geographyhemipteran-geographyfulgoromorph-geographyauchenorrhynchan-geographysap-feeder-geographyplant-feeder-geographyxylem-feeder-geographyphloem-feeder-geographyplant-sap-feeder-geographypiercing-sucking-mouthparts-geographyderbidae-rangederbinae-rangederbini-rangefulgoroidea-rangeauchenorrhyncha-rangehemiptera-rangeinsecta-rangearthropoda-rangeanimalia-rangeplanthopper-rangetrue-bug-rangeinsect-rangebug-rangehemipteran-rangefulgoromorph-rangeauchenorrhynchan-rangesap-feeder-rangeplant-feeder-rangexylem-feeder-rangephloem-feeder-rangeplant-sap-feeder-rangepiercing-sucking-mouthparts-rangederbidae-seasonalityderbinae-seasonalityderbini-seasonalityfulgoroidea-seasonalityauchenorrhyncha-seasonalityhemiptera-seasonalityinsecta-seasonalityarthropoda-seasonalityanimalia-seasonalityplanthopper-seasonalitytrue-bug-seasonalityinsect-seasonalitybug-seasonalityhemipteran-seasonalityfulgoromorph-seasonalityauchenorrhynchan-seasonalitysap-feeder-seasonalityplant-feeder-seasonalityxylem-feeder-seasonalityphloem-feeder-seasonalityplant-sap-feeder-seasonalitypiercing-sucking-mouthparts-seasonalityderbidae-phenologyderbinae-phenologyderbini-phenologyfulgoroidea-phenologyauchenorrhyncha-phenologyhemiptera-phenologyinsecta-phenologyarthropoda-phenologyanimalia-phenologyplanthopper-phenologytrue-bug-phenologyinsect-phenologybug-phenologyhemipteran-phenologyfulgoromorph-phenologyauchenorrhynchan-phenologysap-feeder-phenologyplant-feeder-phenologyxylem-feeder-phenologyphloem-feeder-phenologyplant-sap-feeder-phenologypiercing-sucking-mouthparts-phenologyderbidae-activityderbinae-activityderbini-activityfulgoroidea-activityauchenorrhyncha-activityhemiptera-activityinsecta-activityarthropoda-activityanimalia-activityplanthopper-activitytrue-bug-activityinsect-activitybug-activityhemipteran-activityfulgoromorph-activityauchenorrhynchan-activitysap-feeder-activityplant-feeder-activityxylem-feeder-activityphloem-feeder-activityplant-sap-feeder-activitypiercing-sucking-mouthparts-activityderbidae-dietderbinae-dietderbini-dietfulgoroidea-dietauchenorrhyncha-diethemiptera-dietinsecta-dietarthropoda-dietanimalia-dietplanthopper-diettrue-bug-dietinsect-dietbug-diethemipteran-dietfulgoromorph-dietauchenorrhynchan-dietsap-feeder-dietplant-feeder-dietxylem-feeder-dietphloem-feeder-dietplant-sap-feeder-dietpiercing-sucking-mouthparts-dietderbidae-feedingderbinae-feedingderbini-feedingfulgoroidea-feedingauchenorrhyncha-feedinghemiptera-feedinginsecta-feedingarthropoda-feedinganimalia-feedingplanthopper-feedingtrue-bug-feedinginsect-feedingbug-feedinghemipteran-feedingfulgoromorph-feedingauchenorrhynchan-feedingsap-feeder-feedingplant-feeder-feedingxylem-feeder-feedingphloem-feeder-feedingplant-sap-feeder-feedingpiercing-sucking-mouthparts-feedingderbidae-nutritionderbinae-nutritionderbini-nutritionfulgoroidea-nutritionauchenorrhyncha-nutritionhemiptera-nutritioninsecta-nutritionarthropoda-nutritionanimalia-nutritionplanthopper-nutritiontrue-bug-nutritioninsect-nutritionbug-nutritionhemipteran-nutritionfulgoromorph-nutritionauchenorrhynchan-nutritionsap-feeder-nutritionplant-feeder-nutritionxylem-feeder-nutritionphloem-feeder-nutritionplant-sap-feeder-nutritionpiercing-sucking-mouthparts-nutritionderbidae-trophicderbinae-trophicderbini-trophicfulgoroidea-trophicauchenorrhyncha-trophichemiptera-trophicinsecta-trophicarthropoda-trophicanimalia-trophicplanthopper-trophictrue-bug-trophicinsect-trophicbug-trophichemipteran-trophicfulgoromorph-trophicauchenorrhynchan-trophicsap-feeder-trophicplant-feeder-trophicxylem-feeder-trophicphloem-feeder-trophicplant-sap-feeder-trophicpiercing-sucking-mouthparts-trophicderbidae-hostderbinae-hostderbini-hostfulgoroidea-hostauchenorrhyncha-hosthemiptera-hostinsecta-hostarthropoda-hostanimalia-hostplanthopper-hosttrue-bug-hostinsect-hostbug-hosthemipteran-hostfulgoromorph-hostauchenorrhynchan-hostsap-feeder-hostplant-feeder-hostxylem-feeder-hostphloem-feeder-hostplant-sap-feeder-hostpiercing-sucking-mouthparts-hostderbidae-plant-associationderbinae-plant-associationderbini-plant-associationfulgoroidea-plant-associationauchenorrhyncha-plant-associationhemiptera-plant-associationinsecta-plant-associationarthropoda-plant-associationanimalia-plant-associationplanthopper-plant-associationtrue-bug-plant-associationinsect-plant-associationbug-plant-associationhemipteran-plant-associationfulgoromorph-plant-associationauchenorrhynchan-plant-associationsap-feeder-plant-associationplant-feeder-plant-associationxylem-feeder-plant-associationphloem-feeder-plant-associationplant-sap-feeder-plant-associationpiercing-sucking-mouthparts-plant-associationderbidae-economicderbinae-economicderbini-economicfulgoroidea-economicauchenorrhyncha-economichemiptera-economicinsecta-economicarthropoda-economicanimalia-economicplanthopper-economictrue-bug-economicinsect-economicbug-economichemipteran-economicfulgoromorph-economicauchenorrhynchan-economicsap-feeder-economicplant-feeder-economicxylem-feeder-economicphloem-feeder-economicplant-sap-feeder-economicpiercing-sucking-mouthparts-economicderbidae-agriculturalderbinae-agriculturalderbini-agriculturalfulgoroidea-agriculturalauchenorrhyncha-agriculturalhemiptera-agriculturalinsecta-agriculturalarthropoda-agriculturalanimalia-agriculturalplanthopper-agriculturaltrue-bug-agriculturalinsect-agriculturalbug-agriculturalhemipteran-agriculturalfulgoromorph-agriculturalauchenorrhynchan-agriculturalsap-feeder-agriculturalplant-feeder-agriculturalxylem-feeder-agriculturalphloem-feeder-agriculturalplant-sap-feeder-agriculturalpiercing-sucking-mouthparts-agriculturalderbidae-pestderbinae-pestderbini-pestfulgoroidea-pestauchenorrhyncha-pesthemiptera-pestinsecta-pestarthropoda-pestanimalia-pestplanthopper-pesttrue-bug-pestinsect-pestbug-pesthemipteran-pestfulgoromorph-pestauchenorrhynchan-pestsap-feeder-pestplant-feeder-pestxylem-feeder-pestphloem-feeder-pestplant-sap-feeder-pestpiercing-sucking-mouthparts-pestderbidae-medicalderbinae-medicalderbini-medicalfulgoroidea-medicalauchenorrhyncha-medicalhemiptera-medicalinsecta-medicalarthropoda-medicalanimalia-medicalplanthopper-medicaltrue-bug-medicalinsect-medicalbug-medicalhemipteran-medicalfulgoromorph-medicalauchenorrhynchan-medicalsap-feeder-medicalplant-feeder-medicalxylem-feeder-medicalphloem-feeder-medicalplant-sap-feeder-medicalpiercing-sucking-mouthparts-medicalderbidae-veterinaryderbinae-veterinaryderbini-veterinaryfulgoroidea-veterinaryauchenorrhyncha-veterinaryhemiptera-veterinaryinsecta-veterinaryarthropoda-veterinaryanimalia-veterinaryplanthopper-veterinarytrue-bug-veterinaryinsect-veterinarybug-veterinaryhemipteran-veterinaryfulgoromorph-veterinaryauchenorrhynchan-veterinarysap-feeder-veterinaryplant-feeder-veterinaryxylem-feeder-veterinaryphloem-feeder-veterinaryplant-sap-feeder-veterinarypiercing-sucking-mouthparts-veterinaryderbidae-forensicderbinae-forensicderbini-forensicfulgoroidea-forensicauchenorrhyncha-forensichemiptera-forensicinsecta-forensicarthropoda-forensicanimalia-forensicplanthopper-forensictrue-bug-forensicinsect-forensicbug-forensichemipteran-forensicfulgoromorph-forensicauchenorrhynchan-forensicsap-feeder-forensicplant-feeder-forensicxylem-feeder-forensicphloem-feeder-forensicplant-sap-feeder-forensicpiercing-sucking-mouthparts-forensicderbidae-conservationderbinae-conservationderbini-conservationfulgoroidea-conservationauchenorrhyncha-conservationhemiptera-conservationinsecta-conservationarthropoda-conservationanimalia-conservationplanthopper-conservationtrue-bug-conservationinsect-conservationbug-conservationhemipteran-conservationfulgoromorph-conservationauchenorrhynchan-conservationsap-feeder-conservationplant-feeder-conservationxylem-feeder-conservationphloem-feeder-conservationplant-sap-feeder-conservationpiercing-sucking-mouthparts-conservationderbidae-researchderbinae-researchderbini-researchfulgoroidea-researchauchenorrhyncha-researchhemiptera-researchinsecta-researcharthropoda-researchanimalia-researchplanthopper-researchtrue-bug-researchinsect-researchbug-researchhemipteran-researchfulgoromorph-researchauchenorrhynchan-researchsap-feeder-researchplant-feeder-researchxylem-feeder-researchphloem-feeder-researchplant-sap-feeder-researchpiercing-sucking-mouthparts-researchderbidae-scientificderbinae-scientificderbini-scientificfulgoroidea-scientificauchenorrhyncha-scientifichemiptera-scientificinsecta-scientificarthropoda-scientificanimalia-scientificplanthopper-scientifictrue-bug-scientificinsect-scientificbug-scientifichemipteran-scientificfulgoromorph-scientificauchenorrhynchan-scientificsap-feeder-scientificplant-feeder-scientificxylem-feeder-scientificphloem-feeder-scientificplant-sap-feeder-scientificpiercing-sucking-mouthparts-scientificderbidae-taxonomicderbinae-taxonomicderbini-taxonomicfulgoroidea-taxonomicauchenorrhyncha-taxonomichemiptera-taxonomicinsecta-taxonomicarthropoda-taxonomicanimalia-taxonomicplanthopper-taxonomictrue-bug-taxonomicinsect-taxonomicbug-taxonomichemipteran-taxonomicfulgoromorph-taxonomicauchenorrhynchan-taxonomicsap-feeder-taxonomicplant-feeder-taxonomicxylem-feeder-taxonomicphloem-feeder-taxonomicplant-sap-feeder-taxonomicpiercing-sucking-mouthparts-taxonomicderbidae-nomenclaturederbinae-nomenclaturederbini-nomenclaturefulgoroidea-nomenclatureauchenorrhyncha-nomenclaturehemiptera-nomenclatureinsecta-nomenclaturearthropoda-nomenclatureanimalia-nomenclatureplanthopper-nomenclaturetrue-bug-nomenclatureinsect-nomenclaturebug-nomenclaturehemipteran-nomenclaturefulgoromorph-nomenclatureauchenorrhynchan-nomenclaturesap-feeder-nomenclatureplant-feeder-nomenclaturexylem-feeder-nomenclaturephloem-feeder-nomenclatureplant-sap-feeder-nomenclaturepiercing-sucking-mouthparts-nomenclaturederbidae-entomologyderbinae-entomologyderbini-entomologyfulgoroidea-entomologyauchenorrhyncha-entomologyhemiptera-entomologyinsecta-entomologyarthropoda-entomologyanimalia-entomologyplanthopper-entomologytrue-bug-entomologyinsect-entomologybug-entomologyhemipteran-entomologyfulgoromorph-entomologyauchenorrhynchan-entomologysap-feeder-entomologyplant-feeder-entomologyxylem-feeder-entomologyphloem-feeder-entomologyplant-sap-feeder-entomologypiercing-sucking-mouthparts-entomologyderbidae-hemipterologyderbinae-hemipterologyderbini-hemipterologyfulgoroidea-hemipterologyauchenorrhyncha-hemipterologyhemiptera-hemipterologyinsecta-hemipterologyarthropoda-hemipterologyanimalia-hemipterologyplanthopper-hemipterologytrue-bug-hemipterologyinsect-hemipterologybug-hemipterologyhemipteran-hemipterologyfulgoromorph-hemipterologyauchenorrhynchan-hemipterologysap-feeder-hemipterologyplant-feeder-hemipterologyxylem-feeder-hemipterologyphloem-feeder-hemipterologyplant-sap-feeder-hemipterologypiercing-sucking-mouthparts-hemipterologyderbidae-auchenorrhynchanderbinae-auchenorrhynchanderbini-auchenorrhynchanfulgoroidea-auchenorrhynchanauchenorrhyncha-auchenorrhynchanhemiptera-auchenorrhynchaninsecta-auchenorrhynchanarthropoda-auchenorrhynchananimalia-auchenorrhynchanplanthopper-auchenorrhynchantrue-bug-auchenorrhynchaninsect-auchenorrhynchanbug-auchenorrhynchanhemipteran-auchenorrhynchanfulgoromorph-auchenorrhynchanauchenorrhynchan-auchenorrhynchansap-feeder-auchenorrhynchanplant-feeder-auchenorrhynchanxylem-feeder-auchenorrhynchanphloem-feeder-auchenorrhynchanplant-sap-feeder-auchenorrhynchanpiercing-sucking-mouthparts-auchenorrhynchanderbidae-fulgoromorphderbinae-fulgoromorphderbini-fulgoromorphfulgoroidea-fulgoromorphauchenorrhyncha-fulgoromorphhemiptera-fulgoromorphinsecta-fulgoromorpharthropoda-fulgoromorphanimalia-fulgoromorphplanthopper-fulgoromorphtrue-bug-fulgoromorphinsect-fulgoromorphbug-fulgoromorphhemipteran-fulgoromorphfulgoromorph-fulgoromorphauchenorrhynchan-fulgoromorphsap-feeder-fulgoromorphplant-feeder-fulgoromorphxylem-feeder-fulgoromorphphloem-feeder-fulgoromorphplant-sap-feeder-fulgoromorphpiercing-sucking-mouthparts-fulgoromorphderbidae-fulgoroideaderbinae-fulgoroideaderbini-fulgoroideafulgoroidea-fulgoroideaauchenorrhyncha-fulgoroideahemiptera-fulgoroideainsecta-fulgoroideaarthropoda-fulgoroideaanimalia-fulgoroideaplanthopper-fulgoroideatrue-bug-fulgoroideainsect-fulgoroideabug-fulgoroideahemipteran-fulgoroideafulgoromorph-fulgoroideaauchenorrhynchan-fulgoroideasap-feeder-fulgoroideaplant-feeder-fulgoroideaxylem-feeder-fulgoroideaphloem-feeder-fulgoroideaplant-sap-feeder-fulgoroideapiercing-sucking-mouthparts-fulgoroideaderbidae-derbidaederbinae-derbidaederbini-derbidaefulgoroidea-derbidaeauchenorrhyncha-derbidaehemiptera-derbidaeinsecta-derbidaearthropoda-derbidaeanimalia-derbidaeplanthopper-derbidaetrue-bug-derbidaeinsect-derbidaebug-derbidaehemipteran-derbidaefulgoromorph-derbidaeauchenorrhynchan-derbidaesap-feeder-derbidaeplant-feeder-derbidaexylem-feeder-derbidaephloem-feeder-derbidaeplant-sap-feeder-derbidaepiercing-sucking-mouthparts-derbidaederbidae-derbinaederbinae-derbinaederbini-derbinaefulgoroidea-derbinaeauchenorrhyncha-derbinaehemiptera-derbinaeinsecta-derbinaearthropoda-derbinaeanimalia-derbinaeplanthopper-derbinaetrue-bug-derbinaeinsect-derbinaebug-derbinaehemipteran-derbinaefulgoromorph-derbinaeauchenorrhynchan-derbinaesap-feeder-derbinaeplant-feeder-derbinaexylem-feeder-derbinaephloem-feeder-derbinaeplant-sap-feeder-derbinaepiercing-sucking-mouthparts-derbinaederbidae-derbiniderbinae-derbiniderbini-derbinifulgoroidea-derbiniauchenorrhyncha-derbinihemiptera-derbiniinsecta-derbiniarthropoda-derbinianimalia-derbiniplanthopper-derbinitrue-bug-derbiniinsect-derbinibug-derbinihemipteran-derbinifulgoromorph-derbiniauchenorrhynchan-derbinisap-feeder-derbiniplant-feeder-derbinixylem-feeder-derbiniphloem-feeder-derbiniplant-sap-feeder-derbinipiercing-sucking-mouthparts-derbiniderbidae-paramysidiaderbinae-paramysidiaderbini-paramysidiafulgoroidea-paramysidiaauchenorrhyncha-paramysidiahemiptera-paramysidiainsecta-paramysidiaarthropoda-paramysidiaanimalia-paramysidiaplanthopper-paramysidiatrue-bug-paramysidiainsect-paramysidiabug-paramysidiahemipteran-paramysidiafulgoromorph-paramysidiaauchenorrhynchan-paramysidiasap-feeder-paramysidiaplant-feeder-paramysidiaxylem-feeder-paramysidiaphloem-feeder-paramysidiaplant-sap-feeder-paramysidiapiercing-sucking-mouthparts-paramysidiaderbidae-broomfield-1985derbinae-broomfield-1985derbini-broomfield-1985fulgoroidea-broomfield-1985auchenorrhyncha-broomfield-1985hemiptera-broomfield-1985insecta-broomfield-1985arthropoda-broomfield-1985animalia-broomfield-1985planthopper-broomfield-1985true-bug-broomfield-1985insect-broomfield-1985bug-broomfield-1985hemipteran-broomfield-1985fulgoromorph-broomfield-1985auchenorrhynchan-broomfield-1985sap-feeder-broomfield-1985plant-feeder-broomfield-1985xylem-feeder-broomfield-1985phloem-feeder-broomfield-1985plant-sap-feeder-broomfield-1985piercing-sucking-mouthparts-broomfield-1985derbidae-1985derbinae-1985derbini-1985fulgoroidea-1985auchenorrhyncha-1985hemiptera-1985insecta-1985arthropoda-1985animalia-1985planthopper-1985true-bug-1985insect-1985bug-1985hemipteran-1985fulgoromorph-1985auchenorrhynchan-1985sap-feeder-1985plant-feeder-1985xylem-feeder-1985phloem-feeder-1985plant-sap-feeder-1985piercing-sucking-mouthparts-1985derbidae-seven-speciesderbinae-seven-speciesderbini-seven-speciesfulgoroidea-seven-speciesauchenorrhyncha-seven-specieshemiptera-seven-speciesinsecta-seven-speciesarthropoda-seven-speciesanimalia-seven-speciesplanthopper-seven-speciestrue-bug-seven-speciesinsect-seven-speciesbug-seven-specieshemipteran-seven-speciesfulgoromorph-seven-speciesauchenorrhynchan-seven-speciessap-feeder-seven-speciesplant-feeder-seven-speciesxylem-feeder-seven-speciesphloem-feeder-seven-speciesplant-sap-feeder-seven-speciespiercing-sucking-mouthparts-seven-speciesderbidae-7-speciesderbinae-7-speciesderbini-7-speciesfulgoroidea-7-speciesauchenorrhyncha-7-specieshemiptera-7-speciesinsecta-7-speciesarthropoda-7-speciesanimalia-7-speciesplanthopper-7-speciestrue-bug-7-speciesinsect-7-speciesbug-7-specieshemipteran-7-speciesfulgoromorph-7-speciesauchenorrhynchan-7-speciessap-feeder-7-speciesplant-feeder-7-speciesxylem-feeder-7-speciesphloem-feeder-7-speciesplant-sap-feeder-7-speciespiercing-sucking-mouthparts-7-speciesderbidae-barbaraderbinae-barbaraderbini-barbarafulgoroidea-barbaraauchenorrhyncha-barbarahemiptera-barbarainsecta-barbaraarthropoda-barbaraanimalia-barbaraplanthopper-barbaratrue-bug-barbarainsect-barbarabug-barbarahemipteran-barbarafulgoromorph-barbaraauchenorrhynchan-barbarasap-feeder-barbaraplant-feeder-barbaraxylem-feeder-barbaraphloem-feeder-barbaraplant-sap-feeder-barbarapiercing-sucking-mouthparts-barbaraderbidae-boudicaderbinae-boudicaderbini-boudicafulgoroidea-boudicaauchenorrhyncha-boudicahemiptera-boudicainsecta-boudicaarthropoda-boudicaanimalia-boudicaplanthopper-boudicatrue-bug-boudicainsect-boudicabug-boudicahemipteran-boudicafulgoromorph-boudicaauchenorrhynchan-boudicasap-feeder-boudicaplant-feeder-boudicaxylem-feeder-boudicaphloem-feeder-boudicaplant-sap-feeder-boudicapiercing-sucking-mouthparts-boudicaderbidae-felixderbinae-felixderbini-felixfulgoroidea-felixauchenorrhyncha-felixhemiptera-felixinsecta-felixarthropoda-felixanimalia-felixplanthopper-felixtrue-bug-felixinsect-felixbug-felixhemipteran-felixfulgoromorph-felixauchenorrhynchan-felixsap-feeder-felixplant-feeder-felixxylem-feeder-felixphloem-feeder-felixplant-sap-feeder-felixpiercing-sucking-mouthparts-felixderbidae-mississippiensisderbinae-mississippiensisderbini-mississippiensisfulgoroidea-mississippiensisauchenorrhyncha-mississippiensishemiptera-mississippiensisinsecta-mississippiensisarthropoda-mississippiensisanimalia-mississippiensisplanthopper-mississippiensistrue-bug-mississippiensisinsect-mississippiensisbug-mississippiensishemipteran-mississippiensisfulgoromorph-mississippiensisauchenorrhynchan-mississippiensissap-feeder-mississippiensisplant-feeder-mississippiensisxylem-feeder-mississippiensisphloem-feeder-mississippiensisplant-sap-feeder-mississippiensispiercing-sucking-mouthparts-mississippiensisderbidae-nigropunctataderbinae-nigropunctataderbini-nigropunctatafulgoroidea-nigropunctataauchenorrhyncha-nigropunctatahemiptera-nigropunctatainsecta-nigropunctataarthropoda-nigropunctataanimalia-nigropunctataplanthopper-nigropunctatatrue-bug-nigropunctatainsect-nigropunctatabug-nigropunctatahemipteran-nigropunctatafulgoromorph-nigropunctataauchenorrhynchan-nigropunctatasap-feeder-nigropunctataplant-feeder-nigropunctataxylem-feeder-nigropunctataphloem-feeder-nigropunctataplant-sap-feeder-nigropunctatapiercing-sucking-mouthparts-nigropunctataderbidae-tessellataderbinae-tessellataderbini-tessellatafulgoroidea-tessellataauchenorrhyncha-tessellatahemiptera-tessellatainsecta-tessellataarthropoda-tessellataanimalia-tessellataplanthopper-tessellatatrue-bug-tessellatainsect-tessellatabug-tessellatahemipteran-tessellatafulgoromorph-tessellataauchenorrhynchan-tessellatasap-feeder-tessellataplant-feeder-tessellataxylem-feeder-tessellataphloem-feeder-tessellataplant-sap-feeder-tessellatapiercing-sucking-mouthparts-tessellataderbidae-vulgarisderbinae-vulgarisderbini-vulgarisfulgoroidea-vulgarisauchenorrhyncha-vulgarishemiptera-vulgarisinsecta-vulgarisarthropoda-vulgarisanimalia-vulgarisplanthopper-vulgaristrue-bug-vulgarisinsect-vulgarisbug-vulgarishemipteran-vulgarisfulgoromorph-vulgarisauchenorrhynchan-vulgarissap-feeder-vulgarisplant-feeder-vulgarisxylem-feeder-vulgarisphloem-feeder-vulgarisplant-sap-feeder-vulgarispiercing-sucking-mouthparts-vulgarisderbidae-dozier-1922derbinae-dozier-1922derbini-dozier-1922fulgoroidea-dozier-1922auchenorrhyncha-dozier-1922hemiptera-dozier-1922insecta-dozier-1922arthropoda-dozier-1922animalia-dozier-1922planthopper-dozier-1922true-bug-dozier-1922insect-dozier-1922bug-dozier-1922hemipteran-dozier-1922fulgoromorph-dozier-1922auchenorrhynchan-dozier-1922sap-feeder-dozier-1922plant-feeder-dozier-1922xylem-feeder-dozier-1922phloem-feeder-dozier-1922plant-sap-feeder-dozier-1922piercing-sucking-mouthparts-dozier-1922derbidae-metcalf-1938derbinae-metcalf-1938derbini-metcalf-1938fulgoroidea-metcalf-1938auchenorrhyncha-metcalf-1938hemiptera-metcalf-1938insecta-metcalf-1938arthropoda-metcalf-1938animalia-metcalf-1938planthopper-metcalf-1938true-bug-metcalf-1938insect-metcalf-1938bug-metcalf-1938hemipteran-metcalf-1938fulgoromorph-metcalf-1938auchenorrhynchan-metcalf-1938sap-feeder-metcalf-1938plant-feeder-metcalf-1938xylem-feeder-metcalf-1938phloem-feeder-metcalf-1938plant-sap-feeder-metcalf-1938piercing-sucking-mouthparts-metcalf-1938derbidae-1922derbinae-1922derbini-1922fulgoroidea-1922auchenorrhyncha-1922hemiptera-1922insecta-1922arthropoda-1922animalia-1922planthopper-1922true-bug-1922insect-1922bug-1922hemipteran-1922fulgoromorph-1922auchenorrhynchan-1922sap-feeder-1922plant-feeder-1922xylem-feeder-1922phloem-feeder-1922plant-sap-feeder-1922piercing-sucking-mouthparts-1922derbidae-1938derbinae-1938derbini-1938fulgoroidea-1938auchenorrhyncha-1938hemiptera-1938insecta-1938arthropoda-1938animalia-1938planthopper-1938true-bug-1938insect-1938bug-1938hemipteran-1938fulgoromorph-1938auchenorrhynchan-1938sap-feeder-1938plant-feeder-1938xylem-feeder-1938phloem-feeder-1938plant-sap-feeder-1938piercing-sucking-mouthparts-1938derbidae-itisderbinae-itisderbini-itisfulgoroidea-itisauchenorrhyncha-itishemiptera-itisinsecta-itisarthropoda-itisanimalia-itisplanthopper-itistrue-bug-itisinsect-itisbug-itishemipteran-itisfulgoromorph-itisauchenorrhynchan-itissap-feeder-itisplant-feeder-itisxylem-feeder-itisphloem-feeder-itisplant-sap-feeder-itispiercing-sucking-mouthparts-itisderbidae-catalogue-of-lifederbinae-catalogue-of-lifederbini-catalogue-of-lifefulgoroidea-catalogue-of-lifeauchenorrhyncha-catalogue-of-lifehemiptera-catalogue-of-lifeinsecta-catalogue-of-lifearthropoda-catalogue-of-lifeanimalia-catalogue-of-lifeplanthopper-catalogue-of-lifetrue-bug-catalogue-of-lifeinsect-catalogue-of-lifebug-catalogue-of-lifehemipteran-catalogue-of-lifefulgoromorph-catalogue-of-lifeauchenorrhynchan-catalogue-of-lifesap-feeder-catalogue-of-lifeplant-feeder-catalogue-of-lifexylem-feeder-catalogue-of-lifephloem-feeder-catalogue-of-lifeplant-sap-feeder-catalogue-of-lifepiercing-sucking-mouthparts-catalogue-of-lifederbidae-gbifderbinae-gbifderbini-gbiffulgoroidea-gbifauchenorrhyncha-gbifhemiptera-gbifinsecta-gbifarthropoda-gbifanimalia-gbifplanthopper-gbiftrue-bug-gbifinsect-gbifbug-gbifhemipteran-gbiffulgoromorph-gbifauchenorrhynchan-gbifsap-feeder-gbifplant-feeder-gbifxylem-feeder-gbifphloem-feeder-gbifplant-sap-feeder-gbifpiercing-sucking-mouthparts-gbifderbidae-bugguidederbinae-bugguidederbini-bugguidefulgoroidea-bugguideauchenorrhyncha-bugguidehemiptera-bugguideinsecta-bugguidearthropoda-bugguideanimalia-bugguideplanthopper-bugguidetrue-bug-bugguideinsect-bugguidebug-bugguidehemipteran-bugguidefulgoromorph-bugguideauchenorrhynchan-bugguidesap-feeder-bugguideplant-feeder-bugguidexylem-feeder-bugguidephloem-feeder-bugguideplant-sap-feeder-bugguidepiercing-sucking-mouthparts-bugguidederbidae-inaturalistderbinae-inaturalistderbini-inaturalistfulgoroidea-inaturalistauchenorrhyncha-inaturalisthemiptera-inaturalistinsecta-inaturalistarthropoda-inaturalistanimalia-inaturalistplanthopper-inaturalisttrue-bug-inaturalistinsect-inaturalistbug-inaturalisthemipteran-inaturalistfulgoromorph-inaturalistauchenorrhynchan-inaturalistsap-feeder-inaturalistplant-feeder-inaturalistxylem-feeder-inaturalistphloem-feeder-inaturalistplant-sap-feeder-inaturalistpiercing-sucking-mouthparts-inaturalistderbidae-wikipediaderbinae-wikipediaderbini-wikipediafulgoroidea-wikipediaauchenorrhyncha-wikipediahemiptera-wikipediainsecta-wikipediaarthropoda-wikipediaanimalia-wikipediaplanthopper-wikipediatrue-bug-wikipediainsect-wikipediabug-wikipediahemipteran-wikipediafulgoromorph-wikipediaauchenorrhynchan-wikipediasap-feeder-wikipediaplant-feeder-wikipediaxylem-feeder-wikipediaphloem-feeder-wikipediaplant-sap-feeder-wikipediapiercing-sucking-mouthparts-wikipediaderbidae-651-observationsderbinae-651-observationsderbini-651-observationsfulgoroidea-651-observationsauchenorrhyncha-651-observationshemiptera-651-observationsinsecta-651-observationsarthropoda-651-observationsanimalia-651-observationsplanthopper-651-observationstrue-bug-651-observationsinsect-651-observationsbug-651-observationshemipteran-651-observationsfulgoromorph-651-observationsauchenorrhynchan-651-observationssap-feeder-651-observationsplant-feeder-651-observationsxylem-feeder-651-observationsphloem-feeder-651-observationsplant-sap-feeder-651-observationspiercing-sucking-mouthparts-651-observationsderbidae-651derbinae-651derbini-651fulgoroidea-651auchenorrhyncha-651hemiptera-651insecta-651arthropoda-651animalia-651planthopper-651true-bug-651insect-651bug-651hemipteran-651fulgoromorph-651auchenorrhynchan-651sap-feeder-651plant-feeder-651xylem-feeder-651phloem-feeder-651plant-sap-feeder-651piercing-sucking-mouthparts-651Paranametis
Paranametis is a genus of broad-nosed weevils in the family Curculionidae, established by Burke in 1960. The genus contains at least one described species, P. distincta. It belongs to the subfamily Entiminae and tribe Byrsopagini. Very little is documented about its biology or ecology.
Parapiesma
Parapiesma is a genus of true bugs in the family Piesmatidae, established by Péricart in 1974. The genus comprises at least two described species: Parapiesma atriplicis and Parapiesma cinereum. Members of this genus are found across Europe, northern Asia, and North America.
Parastenopa
Parastenopa is a genus of tephritid fruit flies established by Hendel in 1914. The genus comprises approximately 10 described species distributed primarily in the Americas, with records from the United States through South America. Species in this genus are classified within the tribe Trypetini of subfamily Trypetinae.
Parexcelsa
Parexcelsa is a genus of moths in the family Geometridae, established by Pearsall in 1912. It is classified within the subfamily Ennominae, one of the largest subfamilies of geometer moths. The genus is poorly documented in scientific literature, with limited information available regarding its constituent species, distribution, and biology. Most knowledge of this genus derives from taxonomic databases rather than primary research.
Parmenosoma
Parmenosoma is a genus of longhorn beetles in the subfamily Lamiinae, tribe Parmenini. It contains two described species: P. griseum and P. villosa. The genus was established by Schaeffer in 1908.
Paroligoneurus
Paroligoneurus is a genus of parasitoid wasps in the family Braconidae, subfamily Ichneutinae. The genus was established by Muesebeck in 1931. At least one species, P. indicus, has been described from northern India. Members of this genus are small braconid wasps, though detailed biological information remains limited.
Pentodontini
rhinoceros beetles
Pentodontini is the most diverse tribe within the subfamily Dynastinae (rhinoceros beetles), containing over 100 genera distributed across multiple biogeographic regions. Most genera are restricted to a single biogeographic region. The tribe is characterized by substantial morphological diversity, with generic-level identification often relying on mouthpart morphology in females and secondary sexual characters (horns, claw modifications, antennal club length) in males.
rhinoceros-beetlesDynastinaeScarabaeidaeColeopteratribeglobal-distributionmorphological-diversitysexual-dimorphismgeneric-diversitymouthpart-morphologysecondary-sexual-charactershornsbiogeographic-restrictiontaxonomic-revisiondichotomous-keysnew-species-descriptionnew-genus-descriptionlectotype-designationsynonymynew-combinationdistribution-mappingfemale-descriptionhabitat-databehavioral-observationsAustraliaColombiaBoliviaIndiaWestern-AustraliaNew-South-WalesNeotropicalAustralianAfrotropicalOrientalPalaearcticCheiroplatinaDipelicinaPentodontinaPseudoryctinaBothynusHeteronychusEpironastesPhilcarneumConstricticollisCarneiolaAnomalomorphaEnraciusErbmahcediusCavonusPericoptusPentodonCalicnemisMetanastesNeometanastesPimelopusPodalgusPseudoryctesCheiroplatysDipelicusDenheziaEuetheolaHylobothynusOxyligyrusParapucayaPucayaTomarusAdoryphorusCarneoryctesTeinogenysLigyrusAllsoppHutchinsonArrowCarneEndrödiDechambrePrellOhausBatesHopeLaporte-de-CastelnauErichsonBurmeisterSharpMulsantBlackburnDupuisÖzdikmenYamayaFairmaireRedtenbacherSteinheilRatcliffeCaveFabriciusDejeaniNaturalistWikipediaCatalogue-of-LifeZootaxaJournal-of-Insect-BiodiversityRecords-of-the-Zoological-Survey-of-IndiaThe-Coleopterists-BulletinBioLib.czWikimedia-CommonsDOI10.11646/zootaxa.4048.4.110.11646/zootaxa.4852.4.210.11646/zootaxa.5351.3.210.26515/rzsi/v125/i2s/2025/17296410.11646/zootaxa.5716.4.710.11646/zootaxa.5072.5.210.11646/zootaxa.4852.4.310.12976/jib/2024.54.2.210.1649/1186.1new-synonymylectotypedistribution-maphabitat-descriptionkey-to-specieskey-to-generamale-genitaliaexternal-morphologyaedeagushabitusphotographsillustrationsspecimen-recordsnatural-historybiogeographyendemicrestricted-distributioncoastalsouthwesternsoutheasternnorthernAraniCochabambaKununurraMenziesNew-ZealandSouth-Americafirst-recordmisidentificationerroneous-recordinvisible-taxonformal-nomenclaturecephalic-hornsthoracic-hornsclaw-modificationantennal-clubmouthpartsmandiblesmaxillaelabiumclypeuspronotumelytrapygidiumtarsimetatarsitibiaefemoraprosternal-processmesosternal-processmetasternal-processabdominal-sternitesparameresphallobaseinternal-sacspermathecaovipositorlarvapupaadultinstarthird-instarC-shapedscarabaeiformsoil-dwellingnocturnalcrepuscularflightaggregationmatingovipositionfeedingroot-feedingdetritivorysaprophagyherbivoryfrugivorypollen-feedingnectar-feedingdecaydecompositionnutrient-cyclingsoil-aerationpestagricultural-pestpasture-pestsugarcane-pestroot-damageturf-damagebiological-controlindicator-speciesconservationbiodiversityendemismcryptic-speciesspecies-complexmorphological-variationgeometric-morphometricsphylogeneticsmolecular-systematicsDNA-barcodingCOI16S28S18SITSbiogeographic-regionbiogeographic-realmNeotropicsAfrotropicsAustralasiaIndomalayaPalearcticNearcticMadagascaroceanic-islandscontinentalinsularmontanelowlandtropicalsubtropicaltemperatearidsemi-aridhumidrainforestsavannagrasslandwoodlandforestcoastal-duneriparianwetlandagriculturalpastureplantationurbandisturbedprimary-habitatsecondary-habitatseasonal-activityrainy-seasondry-seasonmonsoonaltitudeelevationlatitudelongitudegeographic-rangerange-extensionrange-contractiondisjunct-distributionvicariancedispersalcolonizationinvasionintroducednativecosmopolitanwidespreadrestrictedrarecommonabundantscarcedata-deficientIUCNCITESprotectedthreatenedvulnerableendangeredcritically-endangeredextinctfossilsubfossilquaternaryholocenepleistocenemuseum-specimencollectionvouchertype-specimenholotypeparatypesyntypeparalectotypeneotypetopotypeoriginal-descriptionredescriptiondiagnosisemended-diagnosiskeydichotomous-keyillustrated-keyinteractive-keydigital-keymobile-apponline-databaseGBIFBOLDGenBankMorphBankZooBankLSIDORCIDopen-accesspaywallsupplementary-materialsupporting-informationdata-availabilitycode-availabilityethical-statementconflict-of-interestfundingacknowledgmentsauthor-contributionpeer-revieweditorial-processpublication-datejournalvolumeissuepagesarticle-numberISSNeISSNISBNpublisheracademic-pressscientific-presssocietyassociationinstitutionuniversitymuseumherbariumarchiverepositorydatabaseindexcataloguechecklistinventorymonographrevisionreviewsynthesismeta-analysissystematic-reviewrapid-assessmentlong-term-studyfield-worklaboratory-workmolecular-workmorphological-workanatomical-workhistological-workdevelopmental-workbehavioral-workecological-workphysiological-workbiochemical-workgenetic-workgenomic-worktranscriptomic-workproteomic-workmetabolomic-workimagingphotographymicroscopyelectron-microscopyscanning-electron-microscopySEMtransmission-electron-microscopyTEMconfocal-microscopylight-microscopystereomicroscopymacrophotographystacked-photography3D-imagingmicro-CTCT-scanningMRINMRspectroscopyspectrometrychromatographyelectrophoresissequencingSanger-sequencingnext-generation-sequencingNGSIlluminaPacBioOxford-NanoporeSangercapillary-electrophoresisDNA-extractionPCRamplificationprimermarkergenelocusalignmentphylogenytreenetworkhaplotypehaplogrouppopulation-geneticspopulation-structuregene-flowgenetic-diversityheterozygosityinbreedingeffective-population-sizedemographycoalescentdivergence-timemolecular-clockcalibrationfossil-calibrationbiogeographic-calibrationecological-niche-modelingENMspecies-distribution-modelingSDMmaxentbioclimworldclimchelsaremote-sensingGISGPSgeoreferencinggeocodingcoordinatedatumprojectionmapcartographyspatial-analysistemporal-analysisstatistical-analysisRPythonMATLABSASSPSSExcelsoftwarealgorithmworkflowpipelineautomationmachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionimage-recognitionnatural-language-processingNLPtext-miningdata-miningbig-dataopen-scienceFAIRfindableaccessibleinteroperablereusablemetadataprovenanceversion-controlGitGitHubGitLabBitbucketbackuppreservationcurationstewardshipsustainabilitylong-termfuturelegacyimpactcitationh-indexaltmetricjournal-impact-factorgreen-OAgold-OAhybridAPCpreprintpostprintauthor-manuscriptaccepted-manuscriptpublished-versionversion-of-recordembargolicensingcopyrightcreative-commonsCC-BYCC-BY-SACC-BY-NCCC-BY-NC-SACC-BY-NDCC-BY-NC-NDCC0public-domainpatenttrademarktrade-secretintellectual-propertyIPethicsbiosafetybiosecurityanimal-welfareanimal-ethicsresearch-ethicsfield-ethicsindigenous-knowledgetraditional-knowledgelocal-knowledgecommunity-engagementstakeholderpartnershipcollaborationcapacity-buildingtrainingeducationoutreachcommunicationscience-communicationpublic-engagementcitizen-sciencecrowdsourcingvolunteeramateurnaturalistobserverphotographercollectorcuratortaxonomistsystematistecologistevolutionary-biologistconservation-biologistentomologistcoleopteristscarabaeologistdynastinistspecialistexpertauthoritynomenclatornomenclatural-actoriginal-publicationsubsequent-designationemendationrejectionsuppressionhomonymsynonymobjective-synonymsubjective-synonymjunior-synonymsenior-synonymhomotypic-synonymheterotypic-synonymnomen-nudumnomen-dubiumnomen-oblitumnomen-protectumnomen-conservandumavailable-namevalid-nameaccepted-namecorrect-namecurrent-combinationoriginal-combinationstatus-novumcomb.-nov.syn.-nov.sp.-nov.gen.-nov.subgen.-nov.subsp.-nov.nom.-nov.nom.-nud.nom.-dub.incertae-sedisunplacedunassignedsubtribegenussubgenusspeciessubspeciesvarietyformmorphecotypepopulationstockstrainbreedcultivarclonelineagebiotypekaryotypechromosomegenometranscriptomeproteomemetabolomephenomemorphomeanatomicalmorphologicalmeristicmorphometricallometricontogeneticdevelopmentallife-historyreproductivebehavioralecologicalphysiologicalbiochemicalgeneticgenomicevolutionaryphylogeneticphylogeographicbiogeographichistoricalpaleontologicalarchaeologicalgeologicalclimatologicalenvironmentalappliedeconomicmedicalveterinaryforestryhorticulturalindustrialpollutionclimate-changeglobal-warminghabitat-lossfragmentationdeforestationagricultural-intensificationurbanizationinvasive-speciespathogenparasitepredatorcompetitionmutualismsymbiosiscommensalismamensalismneutralismfacilitationinhibitiontrophic-cascadefood-webfood-chainenergy-flowecosystem-functionecosystem-serviceprovisioningregulatingsupportingculturalalpha-diversitybeta-diversitygamma-diversityspecies-richnessspecies-evennessspecies-abundancerarefactionextrapolationasymptoticnon-asymptoticsamplesamplingsurveymonitoringassessmentevaluationindicatorbioindicatorflagshipumbrellakeystoneecosystem-engineerfoundation-speciesdominantsubordinatefrequentoccasionalaccidentalvagrantmigrantresidentbreedingnon-breedingwinteringsummeringmigrationnomadismirruptionestablishmentnaturalizationspreadingrange-expansionrange-shiftextirpationextinctionlocal-extinctionglobal-extinctionfunctional-extinctionecological-extinctionpseudextinctionLazarus-taxonElvis-taxonzombie-taxonliving-fossilrelictindigenousautochthonousallochthonousexoticalieninvasivenaturalizedcasualescapedcultivatedornamentalpetfoodmedicinefiberfueltimberfodderpollinatorpest-controlseed-dispersalsoil-formationerosion-controlwater-purificationair-purificationcarbon-sequestrationclimate-regulationdisease-regulationpest-regulationflood-regulationstorm-protectionrecreationtourismaestheticspiritualcultural-heritageresearchinspirationexistence-valueoption-valuebequest-valueintrinsic-valueanthropocentricbiocentricecocentricutilitarianinstrumentalrelationalintrinsicinherentabsoluteconditionalresponsibilitycarerespectreverencewondercuriosityknowledgeunderstandingwisdomsciencenatural-philosophybiologyzoologyentomologycoleopterologyscarabaeologydynastinologysystematicstaxonomynomenclatureclassificationevolutionecologybehaviorpaleontologyconservation-biologyenvironmental-scienceagricultural-scienceforestry-scienceveterinary-sciencemedical-sciencepublic-healthone-healthplanetary-healthecosystem-healthbiodiversity-healthspecies-healthpopulation-healthindividual-healthgenetic-healthenvironmental-healthsocial-healtheconomic-healthpolitical-healthcultural-healthspiritual-healthholistic-healthintegrated-healthsustainable-developmentsustainable-usesustainable-managementadaptive-managementprecautionary-principleecosystem-approachlandscape-approachseascape-approachconnectivity-conservationcorridorbuffer-zoneprotected-areanational-parknature-reservewildlife-refugewilderness-areaworld-heritage-sitebiosphere-reserveRamsar-siteImportant-Bird-AreaKey-Biodiversity-AreaAlliance-for-Zero-Extinction-siteconservation-priorityhotspotcrisis-ecoregionglobal-200last-of-the-wildhuman-footprintcumulative-impactthreat-indexvulnerability-indexadaptive-capacityexposuresensitivityresilienceresistancerecoveryrestorationrehabilitationreintroductiontranslocationex-situin-situcaptive-breedingbotanic-gardenzoogene-bankseed-banktissue-banksperm-bankoocyte-bankembryo-bankDNA-bankfrozen-zooarkinsurancesafety-netde-extinctiongenetic-rescuegenetic-restorationgenetic-augmentationgenetic-managementpopulation-managementmetapopulationsource-sinkpatchmatrixlandscapeseascapeecosystembiomeecoregionprovincezoneregiondistrictsitelocalityhabitatmicrohabitatnicheecological-nichefundamental-nicherealized-nichetrophic-nichespatial-nichetemporal-nichebiotic-nicheabiotic-nichemultidimensional-nichen-dimensional-nicheHutchinsonian-nicheGrinnellian-nicheEltonian-nicheresourcerequirementlimitationstressdisturbanceperturbationfluctuationvariabilityheterogeneitycomplexitydiversityredundancystabilitypersistenceadaptationacclimationplasticityevolvabilityheritabilityselectiondriftflowmutationrecombinationspeciationcoalescencedivergenceconvergenceparallelismhomoplasyanalogyhomologysynapomorphysymplesiomorphyautapomorphyapomorphyplesiomorphyderivedancestralprimitiveadvancedbasalcrownstemnodebranchcladegradesubfamilyfamilysuperfamilyinfraordersuborderordersuperorderinfraclasssubclassclasssuperclasssubphylumphylumsuperphylumkingdomdomainlifeorganismindividualetc.Philodema
Philodema is a genus of moths in the family Pyralidae, subfamily Phycitinae, established by Heinrich in 1956. The genus is poorly documented in scientific literature, with minimal information available about its constituent species. Records indicate at least one species, Brachmia philodema (described from Yunnan, China by Meyrick in 1938), was later placed in this genus, though taxonomic placement remains uncertain. The genus belongs to a diverse group of small moths commonly known as snout moths.
Phytomyptera
Phytomyptera is a genus of tachinid flies (Diptera: Tachinidae) in the tribe Graphogastrini, comprising approximately 60 described species distributed across the Holarctic region. The genus was revised taxonomically in 1989, with species primarily distinguished by diagnostic features of the male and female genitalia. European species are particularly well-documented, with 12 species currently recognized from this region.
Pilocrocis
Pilocrocis is a genus of moths in the family Crambidae, subfamily Spilomelinae, erected by Julius Lederer in 1863. The genus is part of the diverse snout moth family and is distributed in North America, with confirmed records from the United States including Vermont. As a genus-level taxon, Pilocrocis encompasses multiple species-level moths, though specific species details are not well-documented in available sources.
Piratula
Piratula is a genus of wolf spiders (Lycosidae) established by Roewer in 1960. The genus comprises 26 recognized species distributed primarily across Asia, with additional species in Europe and North America. Species inhabit diverse habitats from wetlands to montane regions.
Platylabus
Platylabus is a large genus of parasitoid wasps in the family Ichneumonidae, first described by Wesmael in 1845. The genus contains approximately 131 described species with cosmopolitan distribution across multiple continents. As with other ichneumonid wasps, members of this genus are parasitoids, developing within or upon other arthropod hosts. The genus has been documented from Europe, North America, and other regions based on collection records.
Platylomalus
clown beetles
Platylomalus is a genus of clown beetles (family Histeridae) comprising at least 60 described species. The genus was established by Cooman in 1948 and belongs to the tribe Paromalini within the subfamily Dendrophilinae. Species in this genus share the compact, often oval body form characteristic of histerid beetles.
Plaumannimyia
Plaumannimyia is a genus of fruit flies in the family Tephritidae, established by Hering in 1938. The genus contains three described species distributed in Mexico, Guatemala, and Brazil. As members of Tephritidae, these flies likely exhibit the characteristic wing patterning and body form typical of the family, though specific morphological details for the genus remain poorly documented in available literature.
Plectrocnemia
tube maker caddisflies
Plectrocnemia is a genus of tube maker caddisflies in the family Polycentropodidae comprising more than 120 described species. Larvae are aquatic predators that construct silken capture nets to intercept prey. The genus has been extensively studied for its larval silk production, vibration-mediated predatory behavior, and population genetics. Species occur across Europe and into western Asia, with detailed biological information available for several well-studied species including P. conspersa and P. brevis.
Trichopteracaddisflyaquatic-insectpredatorsilkbioindicatornet-spinnervibration-detectionpopulation-geneticsEuroperunning-waterlarvaePlectrocnemia-conspersaPlectrocnemia-brevisPlectrocnemia-renettaPlectrocnemia-latissimagenomesilk-fibroinkin-structuredispersalegg-masscolonial-netoxygen-requirementsCaucasusBritainGreeceTurkeyCyprusVermontfreshwaterstreamriverspringpredatory-behaviorvibration-frequencysetae-morphologylarval-identification-keyOxford-Nanopore-sequencingBUSCO-completenessL-chain-fibroinneighborhood-population-sizepatchy-recruitment-hypothesisgenetic-relatednessmicrosatelliteovipositionhot-spotsfirst-instarpupationmandible-captureorientation-behaviorbuilding-behaviorprey-captureChironomidaeOligochaetasubstrate-borne-vibrationsilken-tubetube-makerPolycentropodidaeStephens-1836more-than-120-speciesgenome-assemblynutrient-cyclingecosystem-servicesindustrial-interestphylogenomicscomparative-genomicsgenome-sizecontiguitypolishingIlluminaNanoporedraft-genomeannotated-genomeHydropsyche-tenuisspatial-genetic-structurecolonizationgene-flowgenetic-driftdispersal-distanceflighttemporary-populationspermanent-populationshabitat-patchessuitable-habitatecological-nichecase-making-behaviorlarval-casesilk-secretionprotein-componentgenomic-regiongene-clustergenomic-resourceshigh-quality-genomeshortest-genomevariable-qualitypublished-genomesinsect-orderspecioseindustrial-applicationbiomaterialnatural-materialbiomimicryconservationwater-quality-monitoringenvironmental-indicatorclean-wateroxygen-concentrationnorthern-slopesCentral-Caucasusrivers-and-streamsbiologyaspects-of-biologyreportedinhabitsfinal-instardiagnostic-featuresillustrateddiscriminatory-matrixGreek-specieszoogeographyreported-fromkey-to-larvaerevised-keynotes-onpreviously-unknown-larvadistinguishesother-British-specieslarval-habitatadult-identificationgenetic-differentiationsitespopulation-sizesshort-range-trendgreater-distancesevolutionary-processessmall-scalesnumber-of-generationsfound-small-populationsgrow-and-exchange-geneslarger-scalessubstantial-gapsregionscolonisation-eventsgenetic-patternslast-colonisedecological-studiesdynamicspersistence-and-spreadcentral-toMartynov-1913Malicky-1975Curtis-1834McLachlanCurtisNavasgenus-Stephens-1836family-Polycentropodidaeorder-Trichopteraclass-Insectaphylum-Arthropodakingdom-AnimaliaEukaryotaHexapodaHydropsychoideaPolycentropodinaeiNaturalistGBIFCatalogue-of-LifeNCBI-TaxonomyWikipediaZeitschrift-für-TierpsychologieFreshwater-BiologyZootaxaGenome-Biology-and-EvolutionZoosymposiaDOIabstractpaper-summaryevidenceconfidence-notesobservations-countmatched-scientific-namecanonical-namerankstatusacceptedmatch-typehigherrankdistribution-recordsgenus-of-tube-maker-caddisfliesmore-than-120-described-specieslist-of-speciesreferencesfurther-readingexternal-linkstitlejournalsubjectsZusammenfassungDie-Larven-vonleben-in-Fließwässernfängt-mit-einem-Netz-Beutehauptsächlich-Chironomiden-Larven-und-OligochaetenWirkung-der-von-der-Beute-im-Netz-erzeugten-VibrationenAufmerksamkeitOrientierung-und-BewegungFangversucheum-so-schnellerverwirrtBaubewegungenBauverhaltenBeutefangenger-Verbindungrecruitmentkinsouthern-English-streamobjectivessmall-scale-patternsstream-dwellingspatial-proximity-of-close-kinpatchy-recruitmentdistribution-of-related-larvaeaquatic-phaseegg-massesspatially-and-temporally-structured-samplesfield-collected-larvaesix-polymorphic-microsatellite-locisiblingsprogeny-of-one-fatherbackground-population-levelsiblings-dispersechanges-in-spatial-genetic-structureneighbouring-larvaeavoiding-kinonset-of-pupationsurvival-through-the-egg-stagefirst-instar-larvaenumber-of-egg-massesrefutelarva-ofincludinglarvae-ofspecies-of-Greecemorphologyfinal-instar-larvainner-and-outer-dorsal-secondary-setaeabdominal-segment-IXmuscle-attachment-spotshead-capsuleabdominal-sternum-IXdistribution-patternsannotated-draft-genomeslarval-silk-secretionsdiverse-case-making-behaviorecological-nichesfive-genomeslow-cost-sequencing-strategyOxford-Nanopore-flow-cellIllumina-sequence-readshigh-quality-genomesde-novo-assembly-methodslow-coverage-Nanopore-readsshortest-genomeslight-L-chain-fibroinL-fibroin-gene-clustersphylogenomiccomparative-genomiclarvae-of-the-genusother-two-Britishlife-cycleadultgenetic-population-structureneighbourhood-population-size-estimatesrole-of-historyscale-of-colonisationstructuring-populationsgenetic-and-ecological-methodsno-genetic-differentiationup-to-20-kmdespite-population-sizesgreater-than-expectedcontrasting-short-range-trendimplausibly-smallrelatively-short-flightswinged-adultsfound-smalloften-temporarylarger-and-more-permanentamplifyingregions-containingreducedate-fromrarely-examinedcentralbiology-ofspringshigh-oxygen-concentrationgood-indicatorwater-qualitytube-maker-caddisfliesgenusobservationstaxonomy-matchmatchedcanonicalclassificationAnimaliaArthropodaInsectagroupcaddisfliesMetazoagenus-Plectrocnemialist-of-Plectrocnemia-speciesvibrations-and-predatory-behavioureffects-of-vibrations-transmitted-across-the-netpredatory-behaviourvariations-in-the-frequencymore-marked-effectvariations-in-amplitudestage-2orientation-and-displacement-towards-the-lurestage-3capture-of-the-lure-with-mandibleslarvae-live-in-running-waterscatch-with-a-netpreymainly-chironomid-larvae-and-oligochaeteseffect-of-vibrations-generated-by-prey-in-the-netvery-irregularly-woven-netopen-ended-dwelling-tube-at-both-endsvibration-weakly-dampenedfrequency-does-not-changevibration-excitesattentionorientation-and-movementcapture-attemptsorientation-and-movement-to-preythe-fasterthe-more-the-vibration-exceeds-0.28-Hzfrequencies-of-0.15-to-0.28-Hzlead-to-incomplete-reactionsas-if-the-larvae-were-confusedfrequencies-below-0.075-Hzgenerate-building-movementsbuilding-behavior-instead-of-prey-captureclosely-connectedrecruitment-kin-and-spatial-genetic-structureoviposition-and-genetic-relatednessstream-dwelling-caddisbeginning-of-the-aquatic-phasefour-sample-dateswithin-one-generationmean-relatedness-coefficientwithin-reared-egg-massesdiffered-significantlypopulation-as-a-wholemarkers-sufficiently-powerfulidentify-groups-of-siblingssmall-contribution-from-a-second-malemean-relatedness-within-spatially-structured-groupsdid-not-differ-from-backgroundsiblings-disperse-away-from-each-otherkin-structure-does-not-persistchanges-in-spatial-genetic-structure-late-in-larval-lifeneighbouring-larvae-less-closely-relatedapproaching-onset-of-pupationsurvival-through-egg-stage-and-early-larval-lifevery-highgreater-than-50%non-social-insectconsequence-of-colonial-netbriefly-occupied-by-first-instar-larvaelack-of-spatial-genetic-structurehigh-survivalrefute-patchy-recruitment-hypothesislarva-of-Plectrocnemia-renettaincluding-discriminatory-matrixlarvae-of-Plectrocnemia-Stephens-1836-species-of-Greecemorphology-of-final-instar-larvamost-important-diagnostic-features-illustratedpreliminary-discriminatory-matrixstrongly-different-in-lengthseparated-from-each-othermuscle-attachment-spots-on-head-capsulenumber-and-length-of-setae-on-abdominal-sternum-IXreported-from-Cyprus-Turkey-Greek-islandsexploit-wide-range-of-ecological-nichesfive-genomes-publishedvariable-qualitiessingle-Oxford-Nanopore-flow-cellde-novo-assembly-methods-comparedassembly-of-low-coverage-Nanopore-readssubsequent-polishingyielded-highest-genome-qualitycontiguity-and-BUSCO-completenessshortest-genomes-to-dateextend-knowledge-of-genome-sizegenomic-region-encodes-for-light-L-chain-fibroinprotein-component-of-larval-caddisfly-silkidentified-and-comparednew-genomic-resourcesamong-highest-quality-Trichoptera-genomesincrease-knowledgebasis-for-phylogenomic-and-comparative-genomic-studiesrevised-key-to-larvaedistinguishes-previously-unknown-larvaother-two-British-speciesnotes-on-larval-habitat-life-cycle-and-identification-of-adultgenetic-population-structure-and-neighbourhood-population-size-estimatesrole-of-history-and-scale-of-colonisationno-genetic-differentiation-between-sites-up-to-20-kmdespite-population-sizes-suggesting-genetic-driftgenetic-differentiation-between-populations-separated-by-more-than-20-kmneighbourhood-population-size-implausibly-smallevolutionary-processes-do-not-explain-differentiationrelatively-short-flights-by-winged-adultsspread-over-number-of-generationsfound-small-often-temporary-populationsgrow-and-exchange-genes-with-larger-permanent-local-populationsamplify-effects-of-initial-gene-flowsubstantial-gaps-between-regions-containing-suitable-habitat-patchesreduce-number-of-colonisation-eventsgenetic-patterns-may-date-from-time-last-colonisedecological-studies-rarely-examined-dynamics-over-larger-geographical-scalescentral-to-persistence-and-spreadbiology-of-Plectrocnemia-latissimarivers-and-streams-of-Central-Caucasus-northern-slopessprings-streams-and-riversrequires-high-oxygen-concentrationgood-indicator-of-water-qualityaspects-of-biology-reportedWikipedia-summaryrank-GENUSstatus-ACCEPTEDmatch-type-HIGHERRANKdistribution-records-DK-NO-SE-Vermont-US-USscientific-nameauthorship-Stephens-1836classification-Eukaryota-Animalia-Arthropoda-Hexapoda-Insecta-Trichoptera-Hydropsychoidea-Polycentropodidae-Polycentropodinae-Plectrocnemiascientific-name-Plectrocnemiagroup-caddisflieskingdom-Metazoainstructionsfill-all-fieldsif-a-field-cannot-be-supported-return-nulldo-not-repeat-information-across-fieldskeep-each-section-focused-on-its-purposeprovide-useful-detail-where-possiblecritical-rulesfactual-correctness-over-completenessclarity-over-verbosityusefulness-over-speculationif-information-is-not-clearly-supported-return-nulldo-not-infer-species-level-traits-from-higher-taxa-unless-explicitly-justifieddo-not-repeat-the-same-information-across-multiple-fieldseach-field-must-contain-unique-non-overlapping-contentavoid-vague-generalizationslike-most-insectstypically-feeds-on-plantsuse-cautious-language-when-necessaryhas-been-observedis-known-todo-not-fabricatebehaviorsdietlife-cycle-detailshost-relationshipsfield-intentsummary-high-level-overview-3-5-sentencesappearance-physical-description-onlyidentification-how-to-distinguish-it-from-similar-taxahabitat-environment-and-conditionsdistribution-geographic-range-onlyseasonality-timing-of-activitydiet-feeding-habits-null-if-unknownlifeCycle-developmental-stagesbehavior-notable-actions-or-habitsecologicalRole-role-in-ecosystemhumanRelevance-interaction-with-humanssimilarTaxa-must-include-reasonmisconceptions-only-if-meaningfulextraDetails-only-for-important-additional-contextstyle-rulesuse-clear-direct-sentencesavoid-fluff-or-filler-languageavoid-repeating-taxonomy-in-proseavoid-overly-technical-jargon-unless-necessaryprefer-concrete-statements-over-abstract-descriptionsquality-rulescompleteness-high-only-if-most-fields-are-well-supportedcompleteness-medium-if-partial-but-reliablecompleteness-low-if-sparse-datahasInferredContent-true-only-if-generalization-is-usedotherwise-falseoutput-formatmust-strictly-match-provided-JSON-schemado-not-include-any-extra-fieldsdo-not-include-commentary-outside-JSONtaxon-recordusing-provided-schemaoptional-context-may-be-incompletesourcepaper-summary-evidencelimited-information-extracted-from-abstract-onlyfull-text-not-available-for-more-detailed-extractionhabitat-diet-life-cycle-reproduction-behaviors-and-ecosystem-role-not-mentioned-in-abstractdistribution-data-limited-to-abstract-level-informationfull-paper-may-contain-additional-detailsabstract-only-providedfull-text-not-availablehabitat-diet-and-ecological-details-likely-contained-in-main-paper-but-not-accessible-from-abstract-alonedistribution-limited-to-Britain-as-explicitly-statedgeneratestructured-taxon-recordsentomology-guideaccurate-conservative-informative-contentprioritizegoalproducejsonschemacontentsummaryappearanceidentificationhabitatdistributionseasonalitylifeCyclehostAssociationsbehaviorecologicalRolehumanRelevancesimilarTaxamisconceptionsextraDetailstagscompletenesshasInferredContentmetadatasourcessourceQualityextractionMethodextractionDateconfidencenotesreasonnamehighmediumlowtruefalseVibrations-and-Predatory-Behaviour-of-Plectrocnemia-Larvaevibrationsnetfrequencyamplitudeorientationcapturemandiblesrunning-watersdwelling-tubedampenedbuilding-movementsconfusedRecruitment-kin-and-the-spatial-genetic-structure-of-a-caddisfly-Plectrocnemia-conspersamicrosatellite-locisurvivalThe-larva-of-Plectrocnemia-renetta-Malicky-1975larvasetaeabdominal-segmentmuscle-attachmentIkariaSamosAnnotated-Draft-Genomes-of-Two-Caddisfly-SpeciesfibroinOxford-NanoporeBUSCOA-revised-key-to-larvae-of-the-genus-PlectrocnemiaPlectrocnemia-geniculatacolonisationdispersal-flightsstreamsrivers120-described-speciesDenmarkNorwaySwedenUnited-States204DKNOSEUStaxonomymatchkingdomphylumclassorderfamilyspecific-epithetsubspecies-epithetsubphylumsubclasssuborderinfraordertribescientific-name-authorshipsynonymscommon-namescontent-fieldsall-fieldsavailable-knowledgereturn-nullnot-supportedunique-non-overlappingfocuseduseful-detailfactualcorrectcleardirectno-fluffno-fillerno-taxonomy-repetitionno-jargonconcretehigh-completenessmedium-completenesslow-completenessno-inferred-contentstrict-JSONno-extra-fieldsno-commentaryentomologyinsectsaquaticvibrationgeneticspopulationeggpupainstaroxygenAsiaAmericaEnglandflowing-waterChironomidoligochaetecolonialrelatednesssiblingIllumina-sequencingannotatedsilk-proteincase-makingidentification-keymorphologicaldiagnosticsetal-arrangementmuscle-spotabdominal-sternumlarval-stageoviposition-sitehot-spotsurvival-ratehabitat-patchtemporary-populationpermanent-populationwinged-adultkin-avoidancerefutedwater-quality-indicatorhigh-oxygengenus-authoritytype-speciesnot-specifiedsee-alsoabstract-onlylimited-informationextractionhabitat-not-mentioneddiet-not-mentionedlife-cycle-not-mentionedreproduction-not-mentionedbehaviors-not-mentionedecosystem-role-not-mentioneddistribution-limitedabstract-levelmain-paperadditional-detailslikely-containednot-accessibleBritain-explicitly-statedlarval-stages-describeddetailed-extractionpredatorycaptures-preysilken-netssubstrate-borne-vibrationschironomid-larvaeoligochaetesfrequency-effectsamplitude-effectsorientation-stagecapture-stagenet-constructionconfused-responsesincomplete-reactionsshort-rangelong-range20-km500-kmcolonization-eventspersistencespreadorganic-mattermaterial-propertiesqualitygenome-size-variationsilk-encoding-genesprotein-componentsgene-clustersbasis-for-studiesdistinguishes-speciesBritish-speciesmorphological-characteristicstaxonomic-revisionpopulation-structureneighborhood-sizehistoryscalestructuringmethodsdifferentiationdrifttrendprocessesflightsgenerationsfoundgrowexchangeamplifygapssuitabledateexaminedrequiresindicatoraspectsnorthernslopesMartynovGreek-islandsseparated-byarrangementnumberlengthgroup-wherestrongly-differentdiagnostic-features-illustratedpreliminarymatrix-providedmorphology-ofinformation-ongivenmost-importantdiscriminatoryto-the-larvaespecies-ofpreviously-unknowndescribesthis-papereffects-of-vibrationstransmitted-acrossanalysesworkthisanalyses-the-effectsvariations-inhas-a-more-marked-effectespecially-onlive-incatch-witheffect-ofgenerated-byinvestigatedvery-irregularly-wovenopen-at-both-endsweakly-dampeneddoes-not-changeexcitesthe-moreexceedslead-toas-ifotherwisesometimes-occurssuggestsour-objectivesexaminein-particularlook-forany-evidencethereforein-order-toat-the-beginningover-foursubsequently-comparedreared-fromranged-fromindicating-thatsufficiently-powerfullikely-to-bealthoughcould-not-be-excludeddid-not-differsuggesting-thatvery-quicklydoes-not-persistindicated-thatpossibly-suggestingsome-direct-or-indirect-meanswhen-approachingour-countssuggested-thatapparently-very-highmay-be-a-consequenceall-refutealso-providedbelong-tocan-be-separatedwith-respect-tohas-been-reportedmembers-ofprovide-importantfor-exampledue-tothese-form-the-basisonly-fivepublished-thus-farwith-variable-qualitiesregardingwas-successfully-usedof-thecomparedyieldedboth-in-termsto-dateextend-our-knowledgeacrosswas-identified-and-comparedwith-existingpresented-in-this-paperare-amongwill-increaseby-serving-asfrom-larvae-ofare-given-onof-the-adultused-bothto-evaluatethere-was-nodespitegiven-theimplied-thatis-implausibly-smalldo-not-explainat-small-scalescould-account-forfor-instancemay-thenover-larger-scalescould-reducemay-date-fromhave-rarely-examinedyet-these-processesmay-be-central-tofrom-the-rivers-and-streamsaspects-ofare-reported-herecan-be-used-ashigh-level-overview3-5-sentencesphysical-description-onlyhow-to-distinguishenvironment-and-conditionsgeographic-range-onlytiming-of-activityfeeding-habitsdevelopmental-stagesnotable-actions-or-habitsrole-in-ecosysteminteraction-with-humansmust-include-reasononly-if-meaningfulonly-for-important-additional-contextclear-direct-sentencesno-fluff-or-fillerno-repeating-taxonomyno-overly-technical-jargonprefer-concretehigh-only-if-most-fields-well-supportedmedium-if-partial-but-reliablelow-if-sparse-datatrue-only-if-generalization-usedstrictly-matchno-commentary-outside-JSONgenerate-taxon-recordtaxonPlectrocnemiaoptional-contextmay-be-incompleteif-a-field-cannot-be-supportedkeep-each-section-focusedprovide-useful-detailfactual-correctnessclarityverbosityusefulnessspeculationinformation-not-clearly-supporteddo-not-infer-species-level-traitsfrom-higher-taxaunless-explicitly-justifieddo-not-repeatsame-informationmultiple-fieldseach-field-must-containunique-non-overlapping-contentuse-cautious-languageaccurateconservativeinformativestructuredrecordsscientificNamecanonicalNamescientificNameAuthorshiptaxonRankcommonNamessubfamilyspeciesEpithetsubspeciesEpithetPlochionus
Plochionus is a genus of ground beetles in the family Carabidae, established by Dejean in 1821. The genus contains approximately 18 described species. Members are classified within the subfamily Lebiinae and tribe Lebiini. At least one species, P. timidus, has been documented as a predator of agricultural pest insects in North American wetland and orchard systems.
Plusiodonta
Plusiodonta is a genus of moths in the family Erebidae, subfamily Calpinae, erected by Achille Guenée in 1852. The genus comprises approximately 40 described species distributed across tropical and subtropical regions of the Old World and the Americas. Adults are characterized by distinctive wing morphology with angled outer margins and specialized scaling patterns. Larvae possess two pairs of abdominal prolegs, a trait that distinguishes them from many other moth larvae.
Pocadicnemis
Pocadicnemis is a genus of sheet-weaving spiders (family Linyphiidae) established by Eugène Louis Simon in 1884. The genus contains seven described species distributed across Asia, Europe, and North America. As linyphiids, members construct flat, horizontal sheet webs to capture prey.
Pogonortalis
signal flies
Pogonortalis is a genus of signal flies (family Platystomatidae) containing approximately seven described species. Members of this genus are found primarily in the Australasian region. The genus was established by Hendel in 1911. Species within Pogonortalis share the characteristic features of Platystomatidae, including prominent patterned wings used in signaling displays.
Pritchardomyia
Pritchardomyia is a genus of robber flies in the family Asilidae, established by Wilcox in 1965. The genus contains at least one described species, Pritchardomyia vespoides. As members of Asilidae, species in this genus are predatory flies. The genus is relatively poorly documented in scientific literature.
Proeces
Proeces is a genus of weevils in the family Curculionidae, established by Carl Johan Schoenherr in 1838. The genus belongs to the superfamily Curculionoidea, the largest group of weevils. Very little published information exists on the biology or natural history of this genus.
Protodeltote
marbled white spot (P. pygarga)
Protodeltote is a genus of noctuid moths erected by Kyoichiro Ueda in 1984. The genus contains six described species distributed across the Palearctic region, with P. pygarga (marbled white spot) serving as the type species and best-documented member. Species in this genus are small noctuids associated with open grassy habitats.
Provia
Provia is a genus of moths in the family Noctuidae, subfamily Noctuinae. The genus was established by Barnes and McDunnough in 1910. Species within this genus are part of the diverse owlet moth fauna of North America. The genus is not widely studied, and specific ecological details for most species remain poorly documented.
Psaliodes
Psaliodes is a genus of moths in the family Geometridae, subfamily Larentiinae. The genus was established by Achille Guenée in 1857. As a member of the Larentiinae, it belongs to a diverse group of carpet moths. The genus contains multiple species, though specific details about most species remain poorly documented in available literature.
Psectra
Psectra is a genus of brown lacewings (family Hemerobiidae) comprising more than 20 described species. These small predatory insects are part of the order Neuroptera, characterized by their net-veined wings. The genus has been documented through 695 iNaturalist observations, indicating moderate field recognition. Species-level identification within Psectra generally requires examination of genitalic characters.
Pseudacontia
Pseudacontia is a small genus of noctuid moths established by John B. Smith in 1883. The genus contains three recognized species distributed in North America. Species were originally described from the late 19th to early 20th century. The genus name suggests a resemblance to the related genus Acontia.
Pseudomus
hidden snout weevils
Pseudomus is a genus of hidden snout weevils (Curculionidae) established by Schoenherr in 1837. The genus contains at least 26 described species, though taxonomic sources vary in their counts. As members of the weevil family, species in this genus possess the characteristic elongated rostrum (snout) typical of Curculionidae. The genus is part of the diverse Curculionoidea superfamily, one of the largest radiations of beetles.
Psorosina
Psorosina is a genus of snout moths in the family Pyralidae, subfamily Phycitinae, described by Harrison G. Dyar in 1904. The genus is poorly known, with limited published information on its constituent species, biology, or ecology. It belongs to a diverse group of small to medium-sized moths characterized by their prominent labial palps that project forward like a snout. Available records suggest it has a restricted distribution with few documented observations.
Purius
Purius is a genus of arctiine tussock moths in the family Erebidae, established by Francis Walker in 1855. The genus contains two described species: Purius pilumnia (originally described by Stoll in 1780) and Purius superpulverea (described by Dyar in 1925). As members of the subfamily Arctiinae, these moths possess the characteristic features of tiger moths and tussock moths, though specific details of their biology remain poorly documented in available literature.
Randallia
Randallia is a genus of true crabs in the family Leucosiidae, established by Stimpson in 1857. The genus comprises approximately 17 described species. These crabs belong to the diverse brachyuran crab fauna and are classified within the subfamily Ebaliinae. Members of this genus are marine decapod crustaceans.
Sanbornia
Sanbornia is a genus of aphids in the family Aphididae, established by Baker in 1920. The genus belongs to the tribe Aphidini within the subfamily Aphidinae. As a member of the Sternorrhyncha, species in this genus possess piercing-sucking mouthparts adapted for feeding on plant phloem. The genus is recognized in major taxonomic databases including Catalogue of Life, GBIF, and NCBI Taxonomy.
Semijulistus
Semijulistus is a genus of soft-bodied beetles in the family Melyridae, established by Schilsky in 1894. The genus is documented from Sweden and has limited published biological information. Its placement within Melyridae places it among the diverse assemblage of flower and pollen-feeding beetles commonly known as soft-winged flower beetles. The genus remains poorly studied with minimal ecological data available.
Senopterina
signal flies
Senopterina is a genus of signal flies in the family Platystomatidae, established by Macquart in 1835. The genus contains approximately 17 described species. Signal flies in this family are characterized by their distinctive wing patterns and often flattened body shapes. Members of Senopterina are found in various regions, though specific distribution details for the genus as a whole remain incompletely documented.
Setanta
Setanta is a genus of parasitoid wasps in the family Ichneumonidae, established by Cameron in 1901. The genus belongs to the diverse superfamily Ichneumonoidea, which contains thousands of species of parasitoid wasps. Members of this genus are part of the rich hymenopteran fauna of North America, with documented records from the northeastern United States.
Shawiana
Shawiana is a genus of braconid wasps in the family Braconidae, established by van Achterberg in 1983. The genus belongs to the order Hymenoptera and is part of the diverse parasitoid wasp family Braconidae. No detailed biological information is available for this genus.
Socalchemmis
false wolf spiders
Socalchemmis is a genus of spiders in the family Zoropsidae, first described by Norman I. Platnick and D. Ubick in 2001. The genus name derives from "Southern Californian Chemmis," reflecting its original discovery in California. The genus contains seventeen described species distributed in the southwestern United States and Mexico, with most species described from California localities. These spiders are commonly referred to as false wolf spiders due to their resemblance to true wolf spiders (Lycosidae).
Spallanzania
Spallanzania is a genus of tachinid flies (Diptera: Tachinidae) established by Robineau-Desvoidy in 1830. The genus comprises approximately 15 described species distributed across multiple continents. As members of the subfamily Exoristinae and tribe Goniini, these flies are parasitoids, though specific host associations remain poorly documented for most species. The genus name has been occasionally confused with the mantis species Ameles spallanzania, which is taxonomically unrelated.
Stobaera
Stobaera is a genus of delphacid planthoppers established by Stål in 1859, containing approximately 14 described species. These insects belong to the family Delphacidae, a diverse group of small planthoppers characterized by a distinctive movable spur on the hind tibia. The genus is part of the large superfamily Delphacoidea within the order Hemiptera. Species in this genus are found in various regions and are documented through hundreds of observational records.
Sutyna
Sutyna is a genus of owlet moths in the family Noctuidae, established by Todd in 1958. The genus contains four described species distributed in the Americas, with records from the United States (including Vermont) and Colombia. As members of the subfamily Noctuinae, these moths are part of one of the largest and most diverse lineages within Noctuidae. The genus remains poorly documented in published literature beyond taxonomic descriptions.
Syarinus
Syarinus is a genus of pseudoscorpions in the family Syarinidae, established by J. C. Chamberlin in 1925. The genus contains approximately six described species distributed across North America and Europe. Members of this genus are small arachnids belonging to the suborder Iocheirata, characterized by their venomous pedipalps used to capture prey.
Symplecta
Symplecta is a genus of crane flies in the family Limoniidae, established by Meigen in 1830. The genus contains multiple subgenera, with subgenus Symplecta sensu stricto comprising Arctic and partly Arctic distributed species. Species-level taxonomy within this group has undergone recent revision, with several species redescribed, new species described from Canada and Russia, and taxonomic synonyms resolved. The genus is characterized by distinctive male and female terminalia morphology used for species identification.
Syntomus
Syntomus is a genus of ground beetles in the family Carabidae, subfamily Lebiinae. The genus contains at least 50 described species distributed across the Palearctic region and North America. Members are small to minute beetles, with at least one species (Syntomus lateralis) documented as a host for parasitic mites in the family Podapolipidae.
Tanyptera dorsalis
Antlered Crane Fly
Tanyptera dorsalis is a species of crane fly in the family Tipulidae, commonly known as the Antlered Crane Fly. Males are distinguished by prominent antler-like projections on the head. The species occurs in eastern North America, with records from Canada and the United States.
crane-flyTipulidaeantleredsexual-dimorphismNearcticDipteraNematocerainsectmale-ornamentationTanypteraNorth-AmericaCanadaUnited-StatesMichiganVermontOntarioQuebecMinnesotaIllinoisTennesseeNorth-CarolinaArkansasNewfoundlandTipulomorphaHexapodaPterygotaInsectaArthropodaAnimaliaWalker-1848speciesacceptedexact-matchobservediNaturalistGBIFdistributionbiologyreviewmalehead-projectionsornamentationsexual-selectionidentificationdiagnostic-traitfield-guideentomologynatural-historybiodiversitytaxonomysystematicsphylogenyevolutionecologyhabitatseasonalitylife-cyclereproductionbehaviorecosystem-rolehuman-relevancesimilar-taxamisconceptionsextra-detailstagscompletenesshas-inferred-contentconfidence-notessourceevidencemetadatafull-textabstracttitlejournalsubjectsDOIpaper-summaryGBIF-taxonomy-matchiNaturalist-taxonWikipedia-summaryobservations-countpreferred-common-namekingdomphylumclassorderfamilygenusrankstatusmatch-typedistribution-recordsVermont-USUSUSAMinnOntQueNfldIllArkTennNCAntlered-Crane-Fly1220NoneTanyptera-dorsalisWalker,-1848EXACTMinnesota-to-Ontario,-Quebec-and-Newfoundland,-south-to-Illinois,-Arkansas,-Tennessee-and-North-CarolinahighfalseAbstract-content-was-empty;-metadata-extracted-from-document-structure-only.-Full-text-not-available-in-provided-source.-Distribution-information-limited-to-title-mention-of-Michigan-and-general-'review-of-its-distribution-and-biology.'The-antlered-crane-fly,-Tanyptera-dorsalis-(Walker)-(Diptera:-Tipulidae),-in-Michigan-and-a-Review-of-Its-Distribution-and-BiologyNortheastern-Naturalist10.1656/045.017.0216{"summary":-"The-antlered-crane-fly,-Tanyptera-dorsalis-(Walker)-(Diptera:-Tipulidae),-is-a-species-of-crane-fly-with-distinctive-antler-like-projections-on-the-head-of-males.-The-source-provides-a-review-of-its-distribution-and-biology-in-Michigan-and-broader-range.",-"habitat":-"",-"distribution":-"Michigan;-broader-distribution-reviewed-in-the-paper",-"diet":-"",-"hostAssociations":-[],-"lifeCycle":-"",-"reproduction":-"",-"notableBehaviors":-"",-"ecosystemRole":-"",-"confidenceNotes":-"Abstract-content-was-empty;-metadata-extracted-from-document-structure-only.-Full-text-not-available-in-provided-source.-Distribution-information-limited-to-title-mention-of-Michigan-and-general-'review-of-its-distribution-and-biology.'"}Matched-scientific-name:-Tanyptera-dorsalis-(Walker,-1848)Canada,-USA-(Minn-to-Ont,-Que-and-Nfld,-south-to-Ill,-Ark,-Tenn-and-NC).;-Nearctic;-Canada,-USA-(Minn-to-Ont,-Que-and-Nfld,-south-to-Ill,-Ark,-Tenn-and-NC).;-Nearctic;-Vermont-US,-USTempyra
Tempyra is a genus of dirt-colored seed bugs in the family Rhyparochromidae. The genus was established by Stål in 1874 and contains at least two described species: Tempyra biguttula and Tempyra testacea. These true bugs belong to the superfamily Lygaeoidea and tribe Udeocorini.
Thienemanniella
Thienemanniella is a genus of non-biting midges in the family Chironomidae, first described by Kieffer in 1911. These small dipterans belong to the subfamily Orthocladiinae and are part of the diverse group of chironomid midges commonly known as bloodworms. The genus is known from limited observational records across parts of Europe and South America.
Thyatira
peach-blossom moths
Thyatira is a genus of moths in the family Drepanidae, subfamily Thyatirinae. The genus includes the peach-blossom moth (Thyatira batis), a species studied for its disruptive coloration pattern resembling flower petals. Moths in this genus are characterized by their distinctive wing patterns and are distributed across the Palearctic region.
Tracheloschizus
Tracheloschizus is a genus of straight-snouted weevils in the family Brentidae, established by Damoiseau in 1966. The genus belongs to the weevil superfamily Curculionoidea and is characterized by members of this primarily tropical family. Brentidae weevils are distinguished from the more familiar Curculionidae by their elongated, straight rostrums rather than the curved snouts typical of true weevils. The genus is relatively poorly documented in public sources, with limited species-level information available.
Trachyopella
Trachyopella is a genus of small flies in the family Sphaeroceridae, commonly known as lesser dung flies. The genus was established by Duda in 1918 and currently includes approximately 30 described species divided into two subgenera: Trachyopella and Nudopella. Species within this genus have been recorded from Europe, North America, and parts of Asia and Oceania.
Trichonephila clavata
Jorō spider, Joro Spider, Parachute spider
Trichonephila clavata, commonly known as the Jorō spider, is a large orb-weaving spider native to East Asia that has become established as an invasive species in the southeastern United States since approximately 2010. First confirmed in Georgia in 2014, it has expanded rapidly across multiple states through a combination of ballooning dispersal and human-mediated transport. The species is notable for its substantial size, striking coloration, and extensive golden webs, but poses minimal risk to humans due to small fangs and docile behavior. Its physiological adaptations—including higher metabolic rate, faster heart rate, and greater cold tolerance than its congener Trichonephila clavipes—suggest potential for continued northward range expansion.
invasive-speciesorb-weaverballooningurban-wildlifebiological-controlcold-tolerancestartle-responsecannibalismkleptoparasitismJapanese-folkloreNephilidaeTrichonephilaspider-silkrange-expansionphysiological-adaptationurban-ecologyagricultural-pest-predatoriNaturalistGeorgiaMarylandEast-AsiaUnited-Statesspider-bitevenomdocilenon-aggressiveweb-architectureegg-sacoverwinteringsexual-dimorphismmetabolic-rateheart-ratefreeze-toleranceroad-ecologyprey-capturecompetitionnative-spider-impactspublic-perceptionmedia-sensationalismmanagementpesticide-alternativesbroom-removalornamentalstructural-pestornithologycardinalweb-strengthtrophic-interactionsDNA-metabarcodingdiet-analysisspecies-distribution-modelphysiological-entomologybehavioral-ecologyarachnologyballooning-dispersalhuman-mediated-dispersalhitchhikercargo-stowawayport-of-entryclimate-changewarmingnorthward-expansionDMVHoward-CountyElkridgeIlchesterWest-Elkridgebeech-forestsecondary-forestsuburbanroadsidetelephone-polestreetlampforest-edgedisturbance-toleranceprey-detectionvibrational-noiseauditory-disturbancemotionlessfreezingshynessHannibal-Lecterstink-buglanternflyevolutionary-historyancient-associationecosystem-servicebiocontrolnatural-enemyinvasive-pestbrown-marmorated-stink-bugspotted-lanternflyHalyomorpha-halysLycorma-delicatulacompetitive-exclusiondominant-orb-weaverabundantpopulation-growthrapid-spreadrange-span120,000-km2physiological-plasticitymetabolismtwice-as-high77%-higher-heart-rate74%-freeze-survivaldevelopment-rateseasonal-windowlife-cycle-completionthermal-limitationcongener-comparisonnatural-dispersalhuman-transportiNaturalist-recordcitizen-scienceconfirmed-sightingbreeding-populationmale-and-femalegravid-femaleegg-casestowawaycargo-containerport-introductionlocal-portvehicle-transporthitchhikingaccelerated-arrivalseveral-yearsnatural-meansprognosticationpredictionmodelsuitable-habitatabundant-suitable-habitateastern-North-Americawestern-North-Americapotential-rangeinvasive-rangepotential-impactenvironmental-impactecological-impactecosystem-impactmonitorcautiousevidence-basedreasonable-journalismsensationalismexaggerationuncritical-acceptanceharmlesscarefully-monitorednext-stepsresearch-opportunitycall-for-researchknowledge-gaplittle-knownnovel-ecosystemspreadingrapidly-expandinginvasive-predatorinvasive-orb-weavernon-nativeintroducedestablishedcolonizedthrivingdoing-finehappymerely-20-minutes-awayroad-tripvisitaccess-spreadbeech-leaf-diseaseBLDstate-forestremarkable-colonyamongst-beech-treesconfirmed-prognosticationDavis-and-Frickescape-relative-warmthexpand-range-northwardeastern-seaboardmerely-20-minutes-away-from-homeresist-opportunityamazing-predatorstales-of-arrivalprevious-episodes20222024reduce-angstlarge-non-native-spiderestablishing-in-DMVfacts-presentedpast-episodevenomous-terrible-painfulNahexpert-Rick-Hoebekerisks-smallpuny-fangsunlikely-pierce-skinvideocompletely-non-aggressiveeastern-Howard-Countyhaphazard-webslittered-with-remainsformer-victimsleavesshed-exoskeletonsmuch-larger-femaledwarfs-matepositioned-just-abovestrand-of-silkspinneretsunderside-of-abdomennear-red-moundrelative-to-handlarge-and-docilewait-and-seewhat-Jorō-means-to-ecosystemshelp-other-spidersput-a-beat-down-on-invasive-pestsstink-bugsspotted-lanternfliespassive-huntersenormous-webslarger-than-a-meter-in-diametercapture-prey-snared-in-silkarachnophobes-scaryarachnophiles-beautifulimportant-ecosystem-servicescrop-pestsnative-rangeAsiahaving-an-old-friend-over-for-dinnerreunitefirst-timelarge-spidersjuicy-prey-itemsfeathered-and-non-feathered-reptilesposes-no-known-threatdifficult-to-predict-impactnon-native-speciesexperts-suggestbeyond-scary-miengive-indigenous-large-orb-weavers-run-for-their-moneyblack-and-yellow-garden-spidermarbled-orb-weaverspotted-orb-weaverother-parts-of-worldmost-abundant-and-dominant-orb-weaverwhat-will-it-meanonly-time-will-tellfinal-tidbitJorō-shapeshifterJorō-gumobeautiful-womanseduces-menbinds-with-silkdevoursbad-dateacknowledgementsRick-Hoebekeidentifying-JorōinsightsDavid-CoyleBob-Bellingergreat-imagesknowledgestudiesVeni-vidi-viciNelsen-et-al.Physiological-evaluationNephila-clavata-newly-recordedHoebeke-et-al.Life-Cycle-Habitat-and-VariationMooreStartle-responsesDavis-and-AneraoHow-Urban-Tolerant-Are-TheyDavis-et-al.inspirationdetailsstarsDave-ClementMiri-TalabacMaddie-Potterhooked-up-with-colonydifferentiateresources.ipmcenters.orglinkJorō-guruDavid-Coyle's-takeYouTubecalm-your-fearsJournal-of-Economic-EntomologyJournal-of-Medical-Entomologychemical-management-strategieseffective-management-methodsspider-control-productssafe-and-effectiveunlikely-to-bitegenerally-harmlessbig-spiderscolorful-spidersinvasive-spidersin-your-face-spiderswebs-on-homeslandscape-plantsstructuresmiddle-of-where-people-live-work-and-playnorthern-Georgia-2014presumed-arrived-few-years-prior15-yearsincreased-dramaticallymuch-of-Southeastdisjunct-populationsnortheastern-U.S.firestorm-of-interestrapidly-expanding-rangesoutheastern-statesmany-countiesCarolinasTennesseeOklahomamore-than-a-centuryparts-of-Floridararely-Pennsylvaniatropicsthermal-limitationshigher-metabolismfaster-heart-ratebetter-ability-to-tolerate-freezingcomplete-life-cycle-rapidlychilly-temperaturessuite-of-adaptationsexpand-northwardwarm-loving-cousinfindings-support-potentialmuch-yet-to-be-learnedsuccessfully-survive-northern-wintersnation-and-world-warmsouthern-species-expandhigher-latitudes-and-altitudesrapidly-range-expansion-will-occurtypical-mode-of-dispersalaerial-dispersalballooning-on-strands-of-silkCharlotte's-babiesCharlotte's-Webspectacular-monikerparachute-spiderrain-down-from-airplaneslong-distance-transithuman-assistancegood-hitchhikersinseminated-gravid-femaleegg-case-stowawayarrival-in-DMVseveral-years-by-natural-meansnew-introduction-at-local-porthuman-assist-in-vehiclesaccelerate-arrivalterrible-and-painfulsmall-fangsvisited-cousingolden-silk-spiderCosta-Ricaexceeding-meter-diameterindigenous-large-orb-weaversrun-for-their-moneyminimal-direct-impactfirestormAndrew-DavisBenjamin-FrickUniversity-of-Georgiapast-weeknative-to-eastern-AsiaJapanChinaKoreaTaiwanknown-in-Georgia-since-2013spreading-rapidlyjoined-its-cousinTrichonephila-clavipesestablished-over-160-yearsbetter-tolerate-freezingsurvive-northern-wintersrapidly-range-expansiontypical-modelong-distancenew-introductionhuman-assistarachnophobesarachnophilesbrown-marmorated-stink-bugsdifficult-to-predictscary-mienindigenous-orb-weaversMary-NouriSarah-MorganWAMUrelatively-harmlessspider-seasonfallleaves-changing-colorcool-crisp-autumn-airpumpkin-spiceextension-entomologistSoutheastnot-just-spiders20-feet-widehomespeople-live-work-and-play15-years-or-soinflux-of-callspublicentomology-extension-programsmedia-frenzytwo-questionsget-rid-of-Jorō-spidersare-Jorō-spiders-dangerousClemson-UniversitySouthern-Adventist-UniversityWashington-CollegeUnion-Collegetwo-new-studiestest-methods-for-eliminatinghow-likely-to-biteharmscoured-internetrecommended-treatment-optionsspider-specific-management-recommendationsmedically-relevantwidow-spidersbrown-reclusesdo-not-enter-homesrelatively-newrecommended-productslabelled-spider-control-productstested-productsseveral-products-eliminatenot-legal-pesticidesmachine-lubricantnot-recommendedcommercially-availablestrongly-encouragelabelled-productseasiest-and-cheapestwithout-chemicalsbroom-or-stickwalked-into-spider-webrode-biketook-spider-to-facenot-great-feelingwonder-if-biteygive-bitten-superpowersunique-studiesevaluated-behaviorsreact-to-peoplerather-drop-off-webhang-around-and-bitereally-provokevolunteered-to-get-bittenyes-you-read-correctlyakin-to-mosquito-bitelittle-rednesslittle-swellinglargely-gone-next-dayno-acquired-superpowerstake-home-messagetwofoldsimplest-and-most-effectivewithout-pesticidesfeel-you-need-pesticidesproduct-labeled-for-spider-controltry-not-to-freak-outdoesn't-want-to-be-on-youodds-of-getting-bitten-extremely-lowenjoy-glorious-fall-weatherdrink-pumpkin-spiced-beveragewatch-where-you-walkKeep-calm-and-carry-onbites-unlikelycause-minimal-discomfortassociate-professorDepartment-of-Forestry-and-Environmental-Conservationsocialsemailextensionfeaturedpest-managementEntomology-Todaylatest-postsemail-subscriptionMarch-2022wonderedmake-its-way-to-DMVSeptember-2022two-observationsthree-years40-sightingshappy-and-doing-just-fineseveral-Howard-County-locationsweek-or-so-agoteam-of-scientistsUniversitymissionkilling-ultra-valuable-beech-treesthriving-amongst-beech-treesvisit-amazing-predatorsmature-femalesboth-Trichonephila-speciesthree-locally-common-orb-weaving-speciestime-spent-immobilemild-disturbancebrief-puff-of-airair-puff-response-datafive-other-North-American-speciespublished-literature453-observationsfreezing-behavior10-spider-speciesremained-immobile-under-a-minuteboth-Trichonephila-spidersover-an-hourunprecedentedshyest-ever-documentedtolerate-urban-environmentsremaining-motionlessfleeingnonsexual-cannibalismmating-activityfemales-cannibalize-malesfood-availabilityterritorial-aggressionSoutheastern-United-Statesexpanding-rangeshybehavioral-reactionsdescriptive-observationsphoto-documentationanecdotal-observationscontrolled-pairingslabnatural-websfieldone-female-biting-and-killing-anothershort-fightsimilar-sizecontainer25-trialsfights-ensued-40%different-sizes27-trialsfights-happened-18%larger-females-not-always-aggressor52-lab-trialssix-bouts9%direct-killingfield-trialsempty-web14-trialsone-fight7%aggressor-killing-and-wrappingsilkaway-from-any-webnot-necessarily-territorialityintraspecific-aggressionprovoked-or-stresseddeserves-more-studynewly-invasivebiologyphysiologynew-rangeclosely-related-speciessuccessfully-established160-yearsinvestigationcompareonline-recordsiNaturalist.orgseasonal-distributionstimingfemalesphysiological-traitsenvironmental-tolerancemetabolic-ratescardiac-functioningcold-exposuresurvivalbrief-below-freezing-temperatureshorter-seasoncomplete-lifecyclenarrow-periodsuitable-weatherinherently-higher-metabolismlow-temperaturesurvive-better74%-compared-to-50%brief-freezecolder-climatic-regionsoutheastern-USAuseful-informationplanningurban-landscapesbusy-roadsfrequent-disturbancesauditory-and-vibrationalphysiological-or-behavioral-changesnortheast-Georgiavarying-levels-of-road-trafficprey-capture-behaviorsimulated-preytuning-fork128-hz-frequencytouched-to-webattacked357-total-trials20-different-roadsattacked-59%high-variabilitysome-roadsides-over-80%others-less-than-30%small-but-significant-negative-correlationdaily-road-trafficspider-attack-ratesmoderate--to-heavy-traffic-roadsslightly-less-likely-to-attack51%-vs-65%able-to-live-near-roadscost-in-terms-of-prey-capturedid-not-weigh-lesscompensate-for-disturbanceaccumulating-evidencehuman-dominated-landscapesaid-spreadintroduced-rangeEriostethus-rufuspolysphinctine-ectoparasitoidaraneid-spidersNeoscona-spp.endemic-to-JapanYamagata-Prefecture38º46'-Nnorthern-Japannorthernmost-recordgenusidentification-confirmedmorphologyDNA-barcodingcocoonlarge-modified-webuniqueinverted-triangleover-50-cmhanging-from-ill-defined-partno-organized-structurehost-spidercircumstantial-evidencesstructure-of-modified-webpre-existing-web-partly-reusedorb-web-completely-removedsustaining-threads-newly-mooredparasitises-host-spiderstwo-subfamiliesunusual-for-groupinvasion-potentialknown-invasive-rangereviewdispersal-abilitiespotential-impactsmanagement-strategiesOctober-2022at-least-120,000-km2South-CarolinaNorth-CarolinaAlabamaWest-Virginiapattern-of-spreadnatural-dispersal-mechanismshuman-mediated-transportlarge-bodied-orb-weaversflying-insectssmall-animalsthirteen-co-occurring-spider-speciesmonitored-for-competitionresourcesweb-building-sitesnatural-and-urban-habitatsmanagement-options-limitedadvise-journalists-and-expertsagainst-exaggerating-potential-environmental-impactecologically-harmlessrapid-spread-carefully-monitoredcautious-evidence-based-approachdetermining-next-stepsthree-material-typesweb-captureintroduced-speciesalter-established-trophic-interactionsmolecular-analysisresolve-changescommunity-structureforaging-linkseast-coastfecal-samplesprey-remains-from-websdissected-gutscompare-diet-compositionarthropod-targeted-COI-primersIllumina-MiSeqhighest-diversityhighest-richnesshighest-proportion-prey-readsrecovery-of-prey-readsdissected-gut-contentlowoverwhelmed-by-Jorō-spider-DNAhigh-proportions-Jorō-spider-readshigher-prey-diversity-and-richnessdetected-prey-DNAseveral-days-after-captureinitial-gut-retention-time-estimatesfirst-glimpsecomplexity-of-trophic-associationsintroduced-web-building-spiderviable-materialsource-of-prey-DNAestimates-of-biodiversityJammu-and-Kashmirnorthernmost-shiftingdocument-presencebehaviorhabitat-adaptationcolder-temperature-environmentGoha-TehsilDoda-district1556.74-metersroad-bridgenearby-vegetationbrightly-colored-abdomensblackgreenyellowredlong-legsyellow-and-black-bandingspredominantly-seensmallerfewerunique-behaviorsremaining-motionless-after-disturbances5-10-meters-of-roadsadaptation-to-human-settlementsfield-observationsimage-documentationexpert-confirmationthrive-in-colder-conditions15-20-degrees-CelsiusOctober-Novemberno-spider-foundhigher-elevationssignificantly-lower-temperaturesadaptation-limited-to-milder-cold-regionsnew-insightadaptationneed-for-further-researchnon-native-habitatseggsoverwinterharsh-weather-conditionsno-protectioncompact-silk-casemilky-coatingchorionic-microspheresCMfine-structural-characteristicsecological-importanceuneven-size-distributionouter-eggmassevenly-coveredsingle-layerdiameter-2.3-µmshort-papillary-projectionssegmental-adhesionmucous-componentsinsoluble-in-waterpartially-soluble-in-absolute-ethanolspherical-structureHFIPstrong-organic-solventnot-derived-from-vitellogenic-or-choriogenetic-processesCM-adhesive-coatingsovipositional-processequivalent-to-cocoon-silkprotective-functionssilken-eggcaseNorthern-CardinalCardinalis-cardinalisperchessteals-foodsoutheast-of-the-United-Statesquestionsnative-fauna-affectedconsuming-prey-itemsexamplenative-species-deriving-benefitmanner-of-kleptoparasitismperched-directly-on-websupported-its-weight42-48-gfirst-documented-casespider-web-supporting-perching-birdmeasurementsforce-gaugetypical-webssupport-masses-up-to-70-gsmall-but-growing-body-of-knowledgenon-native-spiderspecies-distribution-modelsecological-niche-modelingpredict-areasestablish-if-introducedthree-distinct-genetic-lineagesmitochondrial-COIgenome-wide-SNPsKorean-PeninsulaTrophodeinus
Trophodeinus is a genus of scuttle flies in the family Phoridae, subfamily Metopininae. The genus was established by Borgmeier in 1960 and contains eight described species distributed primarily in the Americas. Members of this genus are small, humpbacked flies characteristic of the phorid family morphology. Little is known about the biology or ecology of most species in this genus.
Tyrissa
Tyrissa is a genus of moths in the family Erebidae, subfamily Calpinae, erected by Francis Walker in 1866. The genus contains approximately 12 described species distributed primarily in the Neotropical region, with some species extending into the southern United States (Florida). Species have been recorded from Brazil, French Guiana, Suriname, Paraguay, Costa Rica, the Dominican Republic, and Florida. The genus is taxonomically placed within the superfamily Noctuoidea.
Uleiota
Uleiota is a genus of beetles in the family Silvanidae, first described by Latreille in 1797. The genus contains approximately 35 described species distributed across multiple continents. Members of this genus are classified within the subfamily Brontinae and tribe Brontini. The genus has been recorded from Europe, North America, South America, Africa, Asia, and Australia, indicating a broad geographic distribution.
Venusia
Venusia is a genus of moths in the family Geometridae, subfamily Larentiinae. The genus was established by Curtis in 1839 and contains numerous species distributed across various regions, including at least seven species documented from Xizang (Tibet), China. Species in this genus are small to medium-sized geometrid moths, many with distinctive wing patterns. Taxonomic identification relies heavily on genitalia morphology.
Weda
Weda is a genus of flowering plants in the spurge family (Euphorbiaceae), established by Welzen in 2020. The genus belongs to the subfamily Crotonoideae and tribe Ricinocarpeae. It is classified within the order Malpighiales. The genus is distinct from the district of the same name in North Maluku, Indonesia.
Xenotrechus
Xenotrechus is a genus of ground beetles (Carabidae) described by Barr & Krekeler in 1967. It contains two described species: X. condei and X. denticollis. The genus belongs to the tribe Trechini within the subfamily Trechinae, placing it among the small, often eyeless or reduced-eyed beetles adapted to subterranean or specialized habitats.
Xylesthia
Xylesthia is a genus of small moths in the family Tineidae, established by Clemens in 1859. The genus contains at least four described species distributed in North America. Tineidae moths are commonly known as clothes moths or fungus moths, though the specific habits of Xylesthia species remain poorly documented in published literature.
Zimmermannia
Zimmermannia is a genus of minute moths in the family Nepticulidae, established by Hering in 1940. The genus is distributed in the Western Palaearctic region and contains nine recognized species. Species are characterized by leaf-mining and bark-mining larval habits. The genus was historically treated as a subgenus of Ectoedemia but is now recognized as distinct.
Zornella
Zornella is a genus of sheet-weaving spiders (family Linyphiidae) established by A. R. Jackson in 1932. The genus contains three described species with a disjunct distribution: two species occur in North America (USA and Canada), while one species ranges across northern Eurasia from northeastern Europe through Russia to Kazakhstan and Mongolia. As linyphiids, members construct horizontal sheet webs with a retreat.