Georgia
Guides
Abedus immaculatus
Abedus immaculatus is a species of giant water bug in the family Belostomatidae. It is the only Abedus species found in the eastern United States, with a range extending throughout Florida north into Georgia and west along the Gulf Coast to Mississippi. Adults measure 13–14 mm in length, making them the smallest species in the genus Abedus and the smallest belostomatid in the United States. The species is the sole member of the subgenus Microabedus. It is locally common in parts of the Everglades, where it occurs in shorter hydroperiod sites.
giant-water-bugaquatic-insectfreshwaterwetlandEvergladesendemiceastern-United-Statessmallest-belostomatid-USAmale-parental-careBelostomatidaeHemipteraMicroabedushydroperiodFloridaGeorgiaMississippiGulf-CoastThomas-Say1832Abedus-cantrallisynonymywater-bugtrue-bugNepomorphaHeteropteraInsectaArthropodaAnimaliaActia dimorpha
Actia dimorpha is a species of tachinid fly in the family Tachinidae, described by O'Hara in 1991 from specimens collected on Sapelo Island, Georgia, United States. Tachinid flies are parasitoids, with larvae typically developing inside other insects. The specific epithet "dimorpha" suggests sexual dimorphism in this species, though details of this dimorphism have not been documented in available sources. The species is known only from its type locality and has received limited study since its original description.
Allocapnia rickeri
Midwest Snowfly
Allocapnia rickeri is a small winter stonefly in the family Capniidae, commonly known as the Midwest Snowfly. It is one of numerous small, dark stoneflies in the genus Allocapnia that emerge during cold months when few other insects are active. The species has been documented across the central and eastern United States. Like other capniids, it is associated with clean, cold streams and is an important indicator of water quality.
winter-stoneflybioindicatorcoldwaterPlecopteraCapniidaeAllocapnialoticemergencebrachypteryapterygenitalia-identificationFrison-1942Midwestsoutheastern-USclean-water-indicatorJanuary-Marchsmall-stoneflywingless-femalestream-insectshreddergathererseasonal-resourcewater-qualityaquatic-insectterrestrial-adultshort-lived-adultovipositionsubmerged-eggshigh-dissolved-oxygenlow-temperaturecentral-USeastern-USAlabamaArkansasDelawareGeorgiaIllinoishexapodhemimetabolousEuholognathaNemouroideaArctoperlariaInsectaArthropodaAnimaliaGBIFCatalogue-of-LifeiNaturalistNCBItaxonomyaccepted-species1942FrisonRickerMidwest-Snowflysnowflysmall-dark-stoneflyclean-streamsriverswell-oxygenatedlotic-habitatcold-monthswinter-activitywing-reductionfemale-apterymale-flightepiproctparaproctterminaliataxonomic-revisioncongenersdistribution-recordsobservations9-observationseukaryotemetazoanarthropodinsectstoneflywinter-emergingJanuaryFebruaryMarchcold-weathernear-freezingbelow-freezingwater-surfacesubmerged-substratesallochthonous-organic-materialstream-ecosystemsseasonal-food-resourceinsectivorous-birdspredatorsscarce-preyunpollutedno-economic-importancestream-monitoringwater-quality-indicatorhigh-quality-coldwatermicroscopic-examinationtaxonomic-keysmale-terminaliareliable-separationgenitalic-examinationoverlapping-distributionsimilar-habitatsmall-sizeunder-10-mmbody-lengthreduced-wingsabsent-wingsfully-developed-wingsspecific-identificationpublished-descriptionsillustrationssubsequent-revisionscharacteristicfamily-Capniidaecommon-nameextended-nymphal-periodone-to-two-yearsshort-liveddoes-not-feedaquatic-nymphclean-cold-streamslow-temperaturesyear-roundwinter-monthsJanuary-through-Marchfamilycentered-Midwestextends-southeasternUnited-Statesdocumentedappearsmost-reliablydistinguishedsubtle-differencesterminal-abdominal-structuresshould-be-comparedagainstpublishedsubsequentgenus-levelcharacterizedreducedabsentfemalesfully-developedmalesrequires-examinationmale-genitaliastructureparaproctsreliableseparationoverlapssimilarmanyexternallydefinitivereliesmicroscopicexaminationcomparisonkeysusedbiologicalindicatorprogramspresenceindicatescoldconditionsno-directeconomicimportanceshreddersgatherersprocessingallochthonousorganicmaterialstreamecosystemsseasonalfoodresourceinsectivorousbirdsotherwhenalternativepreyscarceserveshigh-qualityhabitatsdevelopmentaquaticnymphalstagesterrestrialadultstagenymphsdevelopstreamsextendedperiodlikelyonetwoyearsbasedrelatedspeciesadultsdo-notfeedactiveduringweatherairtemperaturesmaynearbelowfreezingwingedcapableflightwinglessshort-wingedremainwatersurfacematingoccurwinterenteringdepositeggssubmergedsubstratessmallcommonlyknownnumerousdarkemergefewinsectscentraleasternassociatedcleanimportantundermmbodylengthmembersgenuswingspossessfullydevelopedspecificidentificationlevelwithinrequiresmalegenitaliaparticularlymostreliablysubtledifferencestheseterminalabdominalstructuresshouldcompareddescriptionstaxonomicrevisionswinter-emergingmaintainlowhighdissolvedoxygenlevelsthroughoutyearUnitedStatesdistributioncenteredextendssoutheasternmonthstypicallythroughthisactivitygivesrisecommonnamedonotprovidesqualitymonitoringnodirecthabitatmorphologysizegenitalicArphia granulata
Southern Yellow-winged Grasshopper, Southern Yellowwinged Grasshopper
Arphia granulata is a band-winged grasshopper in the family Acrididae, commonly known as the southern yellow-winged grasshopper. It is native to North America, with confirmed records from Florida and Georgia. The species belongs to the genus Arphia, which includes several other yellow-winged and red-winged grasshoppers with similar flight displays and habitat preferences.
Bakerella minuta
Bakerella minuta is a small delphacid planthopper species described by Beamer in 1950. It belongs to the family Delphacidae, a group of true bugs in the order Hemiptera commonly known as planthoppers. The species is recorded from the southeastern and midwestern United States, specifically Florida, Georgia, and Illinois. As with other members of Delphacidae, it is likely associated with grassland or wetland habitats where host grasses occur.
Bryophaenocladius chrissichuckorum
Spooner's Flightless Midge
Bryophaenocladius chrissichuckorum, commonly called Spooner's Flightless Midge, is a chironomid midge endemic to Georgia, United States. Described in 2012 from specimens collected in the late 1990s, this species has only been documented from specific granite outcrop habitats in the Georgia Piedmont region. Its flightless condition represents an unusual adaptation among chironomids.
Cambarus speciosus
Beautiful Crayfish
Cambarus speciosus, commonly known as the beautiful crayfish, is a species of freshwater crayfish in the family Cambaridae. It is endemic to Georgia, United States. The species is currently listed as Near Threatened (NT) by the IUCN, with a stable population as of the last review in 2010. The specific epithet 'speciosus' refers to its attractive appearance.
Crossidius grahami
Ohoopee Dunes Crossidius Beetle
Crossidius grahami is a longhorned beetle (Cerambycidae) described in 2013 from southern Georgia. It is restricted to a highly specific host plant, woody goldenrod (Chrysoma pauciflosculosa), a perennial asteraceous shrub of coastal sand dunes and scrub. The species was discovered incidentally when collectors reared adults from root crowns while attempting to rear a different undescribed cerambycid. Adults are found primarily on lower stems of living plants.
Dalmosella tenuis
Dalmosella tenuis is a species of rove beetle in the family Staphylinidae, subfamily Pselaphinae. It is a small beetle belonging to the tribe Trichonychini within the diverse Pselaphinae, a group known for their compact bodies and reduced elytra. The species was described by Thomas L. Casey in 1897 and occurs across eastern North America.
StaphylinidaePselaphinaerove-beetleNorth-AmericaCasey-1897TrichonychiniDalmosellaColeopterabeetleinsectarthropodAnimaliaInsectaPolyphagaStaphyliniformiaStaphylinoideaEuplectitaeTrimiinaNew-BrunswickAlabamaDistrict-of-ColumbiaFloridaGeorgiaKentuckyLouisianaMassachusettsMaineMississippiNorth-CarolinaNew-HampshireNew-JerseyOhioOklahomaPennsylvaniaTennesseeVirginiaUSACanadaeastern-North-AmericaDelphacodes turgida
Delphacodes turgida is a species of planthopper in the family Delphacidae, first described by Beamer in 1948. The species is recorded from the southeastern United States, specifically Florida and Georgia. As a member of the Auchenorrhyncha, it possesses piercing-sucking mouthparts and is associated with grassland and wetland habitats typical of delphacid planthoppers. The taxonomic status of this species has been subject to some confusion, with Catalogue of Life listing it as a synonym while GBIF treats it as accepted.
Diplotaxis rufa
Rufous Scarab Beetle
Diplotaxis rufa is a scarab beetle in the family Scarabaeidae, subfamily Melolonthinae. The species was described by Linell in 1896. Records indicate presence in the southeastern United States, specifically Florida and Georgia. As a member of the genus Diplotaxis, it belongs to a group commonly known as May beetles or June beetles, though specific biological details for this species remain poorly documented.
ScarabaeidaeMelolonthinaeColeopteraNearcticUSAFloridaGeorgia1896-descriptionLinellDiplotaxiniscarab-beetleMay-beetleJune-beetleLinell-1896Diplotaxis-rufa-Linell-1896scarabbeetleinsectarthropodanimalscarabaeoidpolyphagastaphyliniformiascarabaeoideadiplotaxisrufarufoussoutheastern-United-Statessoutheast-USNorth-AmericaNearctic-regionFlatoidinus punctatus
Flatoidinus punctatus is a planthopper species in the family Flatidae, characterized by its flattened, often leaf-like body form typical of flatid planthoppers. The species was described by Walker in 1851 and occurs in the southeastern United States and Cuba. Like other flatids, adults possess wings that fold tent-like over the body, and nymphs produce waxy filaments for protection. The specific epithet 'punctatus' refers to punctate (spotted or dotted) markings on the body.
Flexamia satilla
Flexamia satilla is a leafhopper species in the family Cicadellidae, described by Hamilton and Ross in 1975. It belongs to the genus Flexamia, a group of deltocephaline leafhoppers known for their specialized associations with grasses and sedges. The species is documented from Georgia, USA. Like other members of its genus, it likely exhibits host-specific feeding relationships with particular grass species.
Floritettix borealis
Floritettix borealis is a species of spur-throated grasshopper in the family Acrididae, described by Hebard in 1936. The species is distributed in the southeastern United States, with records from Florida and Georgia. It belongs to a genus of small grasshoppers that inhabit grassy and herbaceous environments. Relatively little detailed biological information has been published for this species compared to its better-known western relatives in the Melanoplinae subfamily.
Gyponana tenella
Gyponana tenella is a species of leafhopper in the family Cicadellidae. Leafhoppers in the genus Gyponana have been documented producing distinctive brochosomes—nanoparticles that create a water-repellent, anti-reflective coating on the exoskeleton. The species has been recorded in multiple U.S. states including California, Colorado, Florida, Georgia, and Illinois. As a member of the subfamily Iassinae, it belongs to a diverse group of plant-feeding insects typically associated with woody vegetation.
Habronattus georgiensis
Georgia Paradise Spider
Habronattus georgiensis is a species of jumping spider in the family Salticidae, known from the southeastern United States. Like other members of its genus, it is a small, ground-dwelling spider with acute vision characteristic of salticids. The species is part of a diverse North American genus noted for elaborate male courtship displays involving both visual and vibratory signals.
Hebetica sylviae
Hebetica sylviae is a treehopper species in the family Membracidae, first described in 2019 from specimens discovered in Murray, Kentucky. It is the sole Nearctic representative of the genus Hebetica and the only member of the tribe Darnini (raindrop treehoppers) in the Eastern United States. Adults are distinguished by their green coloration when alive, which is uncommon among U.S. treehoppers. The species is associated with mulberry trees (Morus spp.) and has been documented in Kentucky and Georgia.
Hyperaspidius venustulus
Eight-spotted Hyperaspidius
Hyperaspidius venustulus is a small lady beetle in the family Coccinellidae. Adults measure approximately 2.80 mm. The species has been recorded from Georgia and is associated with big cordgrass (Spartina cynosuroides) stands, where it has been found with the mealybug Dysmicoccus dennoi. It is rarely collected and poorly known.
Lacunicambarus diogenes
devil crayfish, devil crawfish
Lacunicambarus diogenes, commonly known as the devil crayfish or devil crawfish, is a primary burrowing crayfish native to eastern North America. This species constructs and inhabits burrows in wet, muddy terrestrial habitats rather than living in permanent surface water. Its burrowing activities create refugia used by numerous other species, including documented use by eastern cicada killer wasps (Sphecius speciosus) as brooding habitat. The species ranges across the Atlantic Coastal Plain and Piedmont ecoregion from New Jersey to Georgia, with disjunct populations in Louisiana.
crayfishburrowingecosystem-engineerprimary-burrowerAtlantic-Coastal-PlainterrestrialfossorialNorth-AmericaCambaridaeDecapodacrustaceanendemicwetlandfloodplainrefugiaallogenic-engineercave-crayfishLacunicambarusCambarusGirard-1852devil-crayfishdevil-crawfishSphecius-speciosuscicada-killer-waspbrooding-habitatsoil-typecongeneric-cuesfloodplain-connectivitymuddy-substratedesiccation-refugepredation-refugeintermittent-waterPiedmontNew-JerseyPennsylvaniaDelawareMarylandVirginiaNorth-CarolinaSouth-CarolinaGeorgiaLouisianaroadside-ditchterrestrial-habitatburrow-constructionburrow-maintenancewetland-engineercrustacean-ecologydecapodastacideafreshwater-invertebrateinvertebrate-engineerhabitat-modificationspecies-interactionscommensalismfacilitationecosystem-servicesbiodiversity-supporthabitat-provisionmicrohabitat-creationsoil-bioturbationsediment-mixingwater-infiltrationgroundwater-connectionephemeral-waterseasonal-wetlandpalustrineloticlenticriparianhyporheicbioturbationsoil-structurenutrient-cyclingdetritivoreomnivorescavengerpredatorpreytrophic-interactionfood-webcommunity-ecologypopulation-ecologyconservationhabitat-lossurbanizationagricultureland-use-changeclimate-changedroughthydrologygeomorphologysedimentologyichnologytrace-fossilburrow-architectureburrow-morphologytunnel-systemchimneymud-pelletcastexcavationsediment-ejectionmaintenance-behavioroccupancysite-fidelityhome-rangeterritorialityintraspecific-interactioninterspecific-interactioncompetitionpredation-riskdesiccation-riskphysiological-stressbehavioral-adaptationmorphological-adaptationfossorial-adaptationgill-functionair-breathingcutaneous-respirationion-regulationosmoregulationexcretionmetabolismenergeticslife-historygrowthmoltingreproductionmatingegg-carejuvenile-developmentrecruitmentpopulation-dynamicsdemographygeneticsphylogeographybiogeographydispersalcolonizationextinctionrare-speciescommon-speciesindicator-specieskeystone-speciesumbrella-speciesflagship-speciesnatural-capitalenvironmental-economicsenvironmental-policyenvironmental-managementrestoration-ecologyhabitat-restorationspecies-reintroductionex-situ-conservationin-situ-conservationprotected-areawildlife-refugenature-reservenational-parkstate-parkconservation-easementstewardshipcitizen-scienceiNaturalistobservationspecimenvouchermuseum-collectiontype-specimenholotypetaxonomysystematicsnomenclaturesynonymyhomonymypriorityvalid-nameaccepted-namespecies-conceptmorphological-speciesbiological-speciesevolutionary-speciesphylogenetic-speciesintegrative-taxonomyDNA-barcodingmolecular-systematicsphylogeneticsphylogenyevolutionadaptationnatural-selectionspeciationdiversificationradiationendemismvicariancedispersal-limitationhabitat-specificityniche-breadthniche-conservatismecological-releasecharacter-displacementcompetitive-exclusionresource-partitioninghabitat-filteringenvironmental-gradientelevationlatitudelongitudeclimatetemperatureprecipitationhydroperiodsoil-texturesoil-moisturesoil-chemistrypHorganic-matternutrient-availabilityproductivitydisturbancesuccessionmetacommunitylandscape-ecologyspatial-ecologymovement-ecologydispersal-kernelconnectivitycorridorbarrierfragmentationmatrixedge-effectcore-areapatch-dynamicssource-sinkmetapopulationpopulation-viabilityminimum-viable-populationeffective-population-sizeinbreedinggenetic-driftgene-flowlocal-adaptationphenotypic-plasticitygenotype-environment-interactionepigeneticsdevelopmental-biologyembryologylarval-developmentpost-larval-developmentjuvenile-stageadult-stagesenescencelongevitysurvivorshipfecundityreproductive-outputreproductive-successfitnessselection-coefficientheritabilityquantitative-geneticspopulation-geneticsmolecular-ecologyconservation-geneticsgenomic-resourcestranscriptomicsproteomicsmetabolomicsphenomicsbioinformaticsdata-sciencemachine-learningartificial-intelligenceremote-sensinggeographic-information-systemspatial-analysisstatistical-modelingexperimental-designsampling-designfield-methodslaboratory-methodsspecimen-preparationcurationdata-managementdata-sharingopen-sciencereproducibilityreplicabilitytransparencyethicsanimal-welfareanimal-usepermitregulationpolicylegislationenvironmental-lawnatural-resource-lawwater-lawland-use-planningenvironmental-impact-assessmentcumulative-impact-assessmentstrategic-environmental-assessmentadaptive-managementmonitoringevaluationlearningstakeholder-engagementpublic-participationenvironmental-educationscience-communicationoutreachextensioncapacity-buildingprofessional-developmentcareer-developmentmentorshipcollaborationinterdisciplinarytransdisciplinaryteam-scienceopen-innovationknowledge-exchangetechnology-transfersocietal-impactsustainabilitysustainable-developmentgreen-economyblue-economycircular-economynature-based-solutionecosystem-based-managementintegrated-water-resource-managementwatershed-managementriver-basin-managementflood-risk-managementdrought-managementclimate-change-adaptationclimate-change-mitigationresiliencevulnerabilityrisk-assessmentscenario-planningforecastingpredictionearly-warningdecision-supportevidence-based-policyscience-policy-interfaceboundary-organizationknowledge-brokerresearch-networkprofessional-societyacademic-societyscientific-journalpeer-reviewpublicationcitationimpact-factoraltmetricsresearch-evaluationresearch-fundinggrantfellowshipscholarshipawardrecognitioncareer-awardearly-careermid-careersenior-careeremeritusretirementlegacyhistorical-ecologypaleoecologyarchaeologyanthropologyindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgecommunity-scienceparticipatory-researchaction-researchtransformational-researchtransformative-changesystem-changeparadigm-shiftfuture-thinkingforesighthorizon-scanningtrend-analysisemerging-issueresearch-prioritygrand-challengesocietal-challengesustainable-development-goalbiodiversity-targetconservation-targetprotected-area-targetrestoration-targetclimate-targetemission-reductioncarbon-sequestrationblue-carbongreen-carbonnature-conservationwildlife-conservationspecies-conservationhabitat-conservationecosystem-conservationlandscape-conservationseascape-conservationconnectivity-conservationcorridor-conservationtransboundary-conservationinternational-cooperationglobal-governanceenvironmental-governancemultilateral-environmental-agreementconventiontreatyprotocolCartagena-ProtocolNagoya-ProtocolAichi-TargetKunming-Montreal-Global-Biodiversity-Framework30x30half-earthnature-needs-halfrewildingreintroductionde-extinctionsynthetic-biologygene-drivebiotechnologynanotechnologygeoengineeringsolar-radiation-managementcarbon-capturedirect-air-capturebioenergy-with-carbon-capturenegative-emissionclimate-interventionearth-systemplanetary-boundarysafe-operating-spacetipping-pointhysteresisirreversibilitycommitted-changesea-level-riseocean-acidificationdeoxygenationwarmingextreme-eventcompound-riskcascading-risksystemic-riskexistential-riskglobal-catastrophic-riskrisk-managementdisaster-risk-reductionemergency-responsehumanitarian-actionreliefrecoveryreconstructionbuild-back-betterresilient-infrastructurenature-based-infrastructuregreen-infrastructuresponge-citycooling-cityurban-heat-islandurban-ecologyurban-biodiversityurban-conservationurban-planningurban-designarchitecturelandscape-architecturegreen-buildingsustainable-buildingenergy-efficiencyrenewable-energyclean-energyenergy-transitionjust-transitionenergy-justiceclimate-justiceenvironmental-justicesocial-justiceequityfairnessinclusiondiversitygenderyouthintergenerational-equityfuture-generationrights-of-naturepersonhoodlegal-standingguardianshipcareethics-of-careenvironmental-ethicsconservation-ethicsanimal-ethicsbioethicsresearch-ethicsintegrityresponsible-conductmisconductfraudplagiarismretractioncorrectionerratumexpression-of-concerndata-fabricationdata-falsificationdata-manipulationimage-manipulationduplicate-publicationsalami-slicingguest-authorshipgift-authorshipghost-authorshipauthor-contributioncreditattributionacknowledgmentfunding-disclosureconflict-of-interestcompeting-interestinstitutional-reviewanimal-carebiosafetybiosecuritydual-useexport-controlsanctionembargoboycottdivestmentactivismadvocacycampaignmovementsocial-movementenvironmental-movementconservation-movementclimate-movementyouth-movementstudent-movementindigenous-movementfeminist-movementlabor-movementpeace-movementhealth-movementfood-movementagriculture-movementwater-movementenergy-movementtransport-movementhousing-movementurban-movementrural-movementlocal-movementglobal-movementnetworkcoalitionalliancepartnershipcooperationsolidaritymutual-aidcommunity-organizinggrassrootsbottom-uptop-downhybrid-governancepolycentric-governanceself-organizationemergencecomplexitysystem-dynamicsagent-based-modelnetwork-analysissocial-networkecological-networkmutualistic-networkantagonistic-networkmultiplex-networkmultilayer-networktemporal-networkspatial-networknetwork-metriccentralitymodularitynestednessconnectancerobustnessstabilitypersistencecoexistencebiodiversity-ecosystem-functioninvasibilityinvasivenessimpactriskpathwayvectorintroductionestablishmentspreaderadicationcontainmentcontrolmanagementphytosanitaryveterinaryhuman-healthOne-HealthEcoHealthPlanetary-HealthOne-Welfaresustainability-scienceconservation-sciencerestoration-scienceresilience-scienceadaptation-sciencetransformation-sciencefutures-studiesbackcastingprojectionsimulationmodelingnumerical-modelconceptual-modelstatistical-modelmechanistic-modelprocess-based-modelindividual-based-modelsystem-dynamics-modelmachine-learning-modeldeep-learningneural-networkrandom-forestsupport-vector-machinegradient-boostingensemble-methodmodel-selectionmodel-validationmodel-calibrationsensitivity-analysisuncertainty-analysisrisk-analysisdecision-analysisoptimizationmulti-objective-optimizationPareto-frontiertrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theorycooperative-gamenon-cooperative-gameNash-equilibriumPareto-optimalitysocial-dilemmatragedy-of-the-commonsprisoner's-dilemmacollective-actionfree-riderpublic-goodcommon-pool-resourceinstitutionrulenormcustomlawgovernanceadministrationimplementationenforcementcomplianceaccountabilityparticipationinclusivenessresponsivenesseffectivenessefficiencylegitimacyadaptabilitytransformabilityinnovationexperimentationadaptive-governanceevidence-basedscience-basedknowledge-basedinformation-baseddata-drivenmodel-driventheory-drivenhypothesis-drivenquestion-drivenproblem-drivensolution-drivenimpact-drivenoutcome-drivenoutput-driveninput-drivenprocess-drivenvalue-drivenmission-drivenvision-drivenstakeholder-drivenuser-drivencitizen-drivencommunity-drivenplace-basedecosystem-basedlandscape-basedseascape-basedwatershed-basedriver-basin-basedbioregion-basedecoregion-basedbiome-basedrealm-basedplanetary-basedglobalregionalnationalsubnationallocalmunicipalcommunityhouseholdindividualscalecross-scalemulti-scaletrans-scaleupscalingdownscalingscaling-outscaling-upscaling-deepmainstreamingintegrationmaintenancedurabilitypermanencereversibilityadditionalityleakagespilloverexternalitymarket-failuregovernment-failureinstitutional-failuresystem-failuresurprisenoveltycritical-transitionregime-shiftalternative-stable-statebasin-of-attractionengineering-resilienceecological-resiliencesocio-ecological-resilienceevolutionary-resiliencetransformative-resiliencespecified-resiliencegeneral-resilienceresistancetransformationtransitiontrajectoryscenarionarrativestorylinevisionfutureutopiadystopiaprotopiaheterotopiaarchipelagomosaicpatchworkcollageassemblagebricolagemontagepalimpsestlayerstratumsedimentmemoryheritagetraditioncultureidentitybelonginghomeplacespaceterritorylandsoilwaterairfireelementmatterenergyinformationcodesignalsignsymbolmeaningsignificancevalueworthpricecostbenefitutilitypreferencechoicedecisionbehavioractionpracticehabitritualceremonycelebrationfestivalperformanceartaestheticsbeautysublimewonderawecuriosityinquirydiscoveryexplorationadventureexpeditionvoyagejourneypilgrimagequestodysseyepicsagastoryhistorypaleontologygeologyclimatologymeteorologyoceanographylimnologyecologybiologyzoologybotanymicrobiologydevelopmentphysiologyanatomymorphologyethologysociobiologyecological-psychologyenvironmental-psychologyconservation-psychologyscience-educationinformal-educationnon-formal-educationlifelong-learningadult-learningskill-buildingcompetencyexpertisemasterycraftartisanmakercreatorinnovatorentrepreneurleadermanageradministratorpolicymakerpractitionerresearcherscholaracademicscientistnaturalistexplorerobserverrecorderdocumenterstorytellercommunicatoreducatormentorcoachfacilitatormediatornegotiatordiplomatadvocateactivistcampaignerorganizermobilizernetworkerconnectorbridge-builderboundary-spannertranslatorinterpreterambassadorrepresentativedelegatespokespersonchampionherorole-modelinspirationmotivationaspirationhopeoptimismpessimismrealismidealismpragmatismpracticalityfeasibilityviabilitydesirabilityacceptabilitycredibilitytrustconfidencereliabilityvalidityrigorqualityexcellencebest-practicegood-practicelesson-learnedsuccess-factorfailure-factorrisk-factorprotective-factordeterminantdriverpressurestateresponseDPSIRSTEEPSWOTPESTLEscenario-matrixmorphological-analysisDelphi-methodexpert-elicitationstructured-expert-judgmentcitizen-deliberationparticipatory-modelingcompanion-modelingserious-gamerole-playvirtual-realityaugmented-realitymixed-realityimmersive-experiencesensory-experienceembodied-experienceaffective-experiencecognitive-experiencesocial-experiencecultural-experiencespiritual-experiencetranscendent-experiencetransformative-experiencelearning-experienceeducational-experienceresearch-experienceprofessional-experiencepersonal-experiencelived-experienceembodied-knowledgetacit-knowledgeexplicit-knowledgecodified-knowledgeprocedural-knowledgedeclarative-knowledgeconceptual-knowledgefactual-knowledgetheoretical-knowledgepractical-knowledgeapplied-knowledgetransdisciplinary-knowledgeinterdisciplinary-knowledgemultidisciplinary-knowledgecross-disciplinary-knowledgedisciplinary-knowledgesubdisciplinary-knowledgespecialist-knowledgegeneralist-knowledgeholistic-knowledgesystemic-knowledgereductionist-knowledgeanalytical-knowledgesynthetic-knowledgeintegrative-knowledgecreative-knowledgeinnovative-knowledgeadaptive-knowledgeresilient-knowledgesustainable-knowledgeethical-knowledgeresponsible-knowledgetrustworthy-knowledgereliable-knowledgevalid-knowledgesound-knowledgerobust-knowledgeantifragile-knowledgeliving-knowledgedynamic-knowledgeevolving-knowledgeemergent-knowledgegenerative-knowledgeproductive-knowledgereproductive-knowledgereplicative-knowledgeimitative-knowledgeemulative-knowledgecompetitive-knowledgecollaborative-knowledgecooperative-knowledgeshared-knowledgecommon-knowledgepublic-knowledgeopen-knowledgefree-knowledgeaccessible-knowledgeinclusive-knowledgediverse-knowledgeequitable-knowledgejust-knowledgefair-knowledgedemocratic-knowledgeparticipatory-knowledgecitizen-knowledgecommunity-knowledgetraditional-knowledgeecological-knowledgeplace-based-knowledgeexperiential-knowledgeintuitive-knowledgeimplicit-knowledgeunconscious-knowledgesubconscious-knowledgeconscious-knowledgeself-aware-knowledgereflexive-knowledgecritical-knowledgeemancipatory-knowledgetransformative-knowledgetransformational-knowledgerevolutionary-knowledgeevolutionary-knowledgedevelopmental-knowledgegrowth-knowledgematuration-knowledgeaging-knowledgesenescence-knowledgedeath-knowledgeextinction-knowledgepersistence-knowledgeresilience-knowledgerecovery-knowledgerestoration-knowledgerenewal-knowledgeregeneration-knowledgerevitalization-knowledgerejuvenation-knowledgerebirth-knowledgerenaissance-knowledgeawakening-knowledgeenlightenment-knowledgeillumination-knowledgeinspiration-knowledgeaspiration-knowledgehope-knowledgeoptimism-knowledgepessimism-knowledgerealism-knowledgeidealism-knowledgepragmatism-knowledgepracticality-knowledgefeasibility-knowledgeviability-knowledgedesirability-knowledgeacceptability-knowledgelegitimacy-knowledgecredibility-knowledgetrust-knowledgeconfidence-knowledgereliability-knowledgevalidity-knowledgerigor-knowledgequality-knowledgeexcellence-knowledgebest-practice-knowledgegood-practice-knowledgelesson-learned-knowledgesuccess-factor-knowledgefailure-factor-knowledgerisk-factor-knowledgeprotective-factor-knowledgedeterminant-knowledgedriver-knowledgepressure-knowledgestate-knowledgeimpact-knowledgeresponse-knowledgeDPSIR-knowledgeSTEEP-knowledgeSWOT-knowledgePESTLE-knowledgescenario-matrix-knowledgemorphological-analysis-knowledgeDelphi-method-knowledgeexpert-elicitation-knowledgestructured-expert-judgment-knowledgecitizen-deliberation-knowledgeparticipatory-modeling-knowledgecompanion-modeling-knowledgeserious-game-knowledgerole-play-knowledgesimulation-knowledgevirtual-reality-knowledgeaugmented-reality-knowledgemixed-reality-knowledgeimmersive-experience-knowledgesensory-experience-knowledgeembodied-experience-knowledgeaffective-experience-knowledgecognitive-experience-knowledgesocial-experience-knowledgecultural-experience-knowledgespiritual-experience-knowledgetranscendent-experience-knowledgetransformative-experience-knowledgelearning-experience-knowledgeeducational-experience-knowledgeresearch-experience-knowledgeprofessional-experience-knowledgepersonal-experience-knowledgelived-experience-knowledgeLea
Lea is a monotypic genus of katydids in the family Tettigoniidae, established by Caudell in 1906. The genus contains a single species, Lea floridensis, commonly known as the Florida true katydid. These insects belong to the subfamily Pseudophyllinae and tribe Pterophyllini. The genus is native to the southeastern United States, with confirmed records from Florida and Georgia.
Leptusa
Leptusa is a genus of rove beetles in the family Staphylinidae, subfamily Aleocharinae. The genus was established by Kraatz in 1856 and currently comprises at least 20 described species globally. The Palaearctic fauna includes approximately 420 species and 74 subspecies distributed across 71 subgenera. Recent taxonomic work from the Georgian Caucasus has significantly expanded knowledge of the genus in that region.
Megathymus cofaqui
Cofaqui Giant-Skipper
Megathymus cofaqui, the Cofaqui giant-skipper, is a butterfly in the family Hesperiidae. It is endemic to a narrow north–south corridor through central Georgia, United States. The species belongs to the genus Megathymus, a group commonly known as giant-skippers due to their relatively large size among skippers.
Melanoplus clypeatus
Shield-tailed Grasshopper, Shield-tailed Spur-throat Grasshopper, Shield-tailed Locust
Melanoplus clypeatus, commonly called the shield-tailed grasshopper, is a species of spur-throated grasshopper in the family Acrididae. It was described by Scudder in 1877. The species is part of the large Melanoplus genus, which contains many North American grasshoppers.
Metasiro sassafrasensis
mite harvestman
Metasiro sassafrasensis is a species of mite harvestman (suborder Cyphophthalmi) in the family Neogoveidae. It was described in 2014 by Clouse and Wheeler. The species is known from a single locality in Grady County, North America. Like other Cyphophthalmi, it is a small, eyeless harvestman adapted to cryptic habitats.
Narraga georgiana
Ohoopee Inchworm Moth
Narraga georgiana is a species of geometrid moth in the family Geometridae, first described by Charles Covell in 1984. It belongs to the genus Narraga, which comprises a small group of inchworm moths. The species is known from a limited number of observations, with iNaturalist documenting 15 records as of the knowledge cutoff. The common name "Ohoopee Inchworm Moth" references the Ohoopee River region in Georgia, suggesting a geographic association with the southeastern United States.
Nomotettix cristatus
crested pygmy grasshopper, crested grouse locust, northern crested grouse locust
Nomotettix cristatus is a small pygmy grasshopper in the family Tetrigidae, commonly known as the crested pygmy grasshopper or crested grouse locust. It is one of approximately 35 Nearctic species of Tetrigidae. The species exhibits three recognized subspecies with distinct geographic distributions across North America. Like other members of its family, it is characterized by an elongated pronotum that extends over the abdomen, a trait distinguishing pygmy grasshoppers from typical grasshoppers in Acrididae.
pygmy-grasshoppergroundhopperTetrigidaeNearcticmoist-habitatpronotumcristateNorth-Americaleaf-litteraquatic-marginOrthopteraCaeliferajumping-insectsmall-grasshoppercrested-pronotumsubspecies-variationAlbertaConnecticutFloridaGeorgiaIllinoislake-shorepond-edgestream-marginground-dwellingScudder-1862Batrachidea-cristataNomotettix-cristatus-cristatusNomotettix-cristatus-compressusNomotettix-cristatus-floridanusTetriginaeAcridideaTetrigoideaHexapodaPterygotainsectarthropodanimaleukaryotemetazoaanimaliaarthropodainsectanomotettixcristatuscrestedpygmygrasshoppergrouse-locustnorthern-crested-grouse-locustcrested-grouse-locustcrested-pygmy-grasshopperiNaturalistGBIFCatalogue-of-LifeNCBI-TaxonomyWikipediaSkejoTumbrinckDevrieseHochkirchMorse-1895Hancock-1902Scudder-1863BatrachideacristatacompressusfloridanusNearctic-region35-species2000-species230-million-yearsdinosaur-contemporarieswater-dependent-lifecyclePeruća-lakeCroatiaBalkansEuropesystematicstaxonomyfaunisticsnatural-historybiodiversityconservationendangeredimperiledZooKeysresearchamateur-naturalistcitizen-scienceobservation53-observationsrareneglected-diversitytropicsMadagascarAustraliaNew-GuineaBorneoBrazilAtlantic-Forestleaf-like-morphologyspineswartsundulationshornsbizarregrotesqueHancock-1907Genera-InsectorumAcididaepronotal-projectionHolocerusNotocerusHolocerus-luciferHolocerus-devrieseiNotocerus-formidabilisMetopomystrum-muricienseOphiotettix-pulcherrimaParaselina-brunneriSelivinga-tribulataCriotettix-bispinosusTetrix-subulataTettigidea-lateralisTetrix-undulataTetrix-tenuicornisParatettix-meridionalisParatettix-mexicanusTetrix-depressaTetrix-arenosaTetrix-bipunctataTetrix-japonicaParatettix-aztecusHyperyboella-orphaniaScelimena-productaEurymorphopus-bolivariensisDiscotettix-belzebuthTetrix-ceperoiTetrix-transsylvanicaArulenusRhacocleis-buchichiiBarbitistes-kaltenbachiAdžićDeranjaPavlovićFran-RebrinaIvan-BudinskiVrlikaHPMHrvatski-Prirodoslovni-MuzejZagrebKitonićMikoFranjevićMedakMathieuSilvaPereiraDe-DomenicoSperberConnorsHendriksenLambertChongMcMasterMonaghanRentzRichterRoseTelnovBarclayPauwelsEntomological-Society-of-LatviaRigaLatviaWallaceaVolume-IIIbiogeographynature-conservationTrinity-Audioguest-blogJosip-SkejoOrthoptera-of-CroatiaBalkan-endemicendemic-speciesnatural-history-museummuseum-collectionsfield-researchcareer-determinationserendipitous-discoverynew-speciessystematic-researchunderstudied-groupregular-publishing20212017202020142016201320122011primary-schoolhigh-schoolbiology-studentsnakesUropeltidaeScolecophidiashield-tailed-snakesblind-snakesgrasshopperscricketsCroatian-endemicfirst-encounterwater-dependencylifecycleleading-European-orthopteristsrare-speciesnew-Arulenus-speciesunderstudiedpublishingTetrigidae-researchencyclopediaElsevierdigital-taxonomyopen-accessinnovationsjournalgrowthtrendingsocial-mediaFlickrunidentified-rare-pygmy-grasshoppersstudentsamateursnew-recordsnot-rareTribulation-helmed-groundhopperKurandaTully-RangeRedlynchKingfisher-parkSpeewahselected-awesome-placesselected-amazing-taxarainforestshumid-forestsextremely-rareweird-lookinglargestmost-colourfulZooKeys-studiesphotographsidentified-to-species-levelvariabilitypronotal-projection-morphologyholotypeMaroantsentraAntongil-BayTamataveAndasibeVohimanaRanomafanaAnalamazaotraTraveler's-PalmRavenala-madagascariensisnatural-habitatskilful-flierflightlarge-back-spinesFormidable-Pygmy-GrasshopperSava-regiontrue-colourssmallinterestingPygmy-unicornsSouthern-AmericaMuricidescriptionmale-holotypeheadsternumfrontal-viewdorsal-viewlateral-viewsternomentumscale-barsGiraffehoppersuniqueantennal-shapeface-colorationvisual-animalscourtshipmating-pairYapen-IslandCenderawasih-BayW-New-Guineayoung-entomologistsdecisionstudy-pygmy-grasshoppersdirectionprimary-and-high-schoolcompare-datafirst-ideafamiliar-animalsfieldorder-Orthopterafriendfellow-studentfirst-systematic-researchtwo-Croatian-endemic-speciesfirst-years2011-2012never-sawsingle-pygmy-grasshopperBIOMSinjTetrigidae-locationaround-waterfirst-time-everlifecycle-water-dependentresearchingcontactingHendrik-DevrieseAxel-HochkirchJosef-TumbrinckCroatian-Natural-History-MuseumSkejo-et-al.-2014Skejo-&-Caballero-2016regularly-publishingAdžić-et-al.-2021Endangered-Pygmy-GrasshoppersEncyclopaedia-of-ConservationMathieu-et-al.-2021ZooKeys-1042Silva-et-al.-2017commentsrecent-changesMetopomystrumCleostratiniMiriatriniZooKeys-702Skejo-et-al.-2020online-social-mediaAnaselinaParaselinaSelivingarare-Australian-pygmy-grasshoppersZooKeys-948Malagasy-devilsnorthsouthZooKeys-957Tumbrinck-&-Skejo-2017taxonomic-and-biogeographic-revisionNew-Guinean-genusOphiotettix-Walker-1871MetrodorinaeOphiotettigini-trib.-nov.33-new-speciesnature's-creationsencouragedU.S.-speciesspectacularclosedHalloweenorange-and-blackArgus-tortoise-beetleChelymorpha-cassideaoleander-caterpillarSyntomeida-epilaiswheel-bugArilus-cristatusmorning-gloryConvolvulaceaesweet-potatotoxic-compoundsalkaloidsnerve-poisonsmonarch-butterflymilkweed-leaf-beetleoleander-aphidpredator-protectionpolka-dot-wasp-mothvermillion-wingsiridescent-blue-bodywhite-spotswasp-mimicryultrasonic-songmate-attractionegg-depositionoleander-leafcaterpillarscluster-feedingcardiac-glycosidesheart-poisonsdogbane-beetlesnatural-enemiesbarrel-shaped-eggspale-orangeexoskeleton-hardeningorange-black-orangeantennae-pale-orangebody-and-legs-jet-blackrear-end-brilliant-orangestout-beakproboscisimpalementdigestive-enzymesliquefactionmedieval-torture-wheelHemipteratrue-bugssucking-mouthpartsincomplete-metamorphosisegg-nymph-adultplant-feedersharlequin-bugssquash-bugsstink-bugsfierce-predatorspest-controlReduviidaeassassin-bugsZelus-longipesmilkweed-assassin-bugsticky-forelegsprey-snaringproteolytic-enzymespredigestionmuscular-pumpblack-wing-budsgoldenrodsmeadow-plantsPselliopus-barberiorange-assassin-bugblack-stripesstealthleafhopperbrown-marmorated-stink-bugHalyomorpha-halysbiological-control-agentnative-protein-sourcesautumn-egg-layingspring-hatchingMay-Junered-abdomensorange-antennaesawfly-larvaebeetlesother-bugspainful-pokecautionhandlingpet-keepingMad-MagazineSpy-vs-Spypointy-nosed-secret-agentsentomological-equivalentBug-vs-BugHeteropteraclanawesome-predatornative-to-North-Americarecord-numbersnurseryfunction-of-wheelspeculationcautious-approachembraceliquefied-mealprotein-for-growthegg-productioncluster-sizetree-barkmagnificent-creatureswide-varietyscoresstealthy-stalkingassassinationcomplementary-outbreakbenefitnaturally-occurring-predatorsparasitesstem-onslaughtno-interest-in-humansretreatmemorable-painful-pokefirsthand-experienceclever-assassinUSDA-NIFA-SCRI-Awardresearch-supportaction-videowebsitepredator-prey-relationshipnatural-enemyultimate-comeuppanceChinese-praying-mantisyellow-and-black-garden-spiderarachnidclose-encounterinvasive-pestAsiaAllentown-PA1990smillions-of-dollars-damagecropshome-invasion33-stateswinter-refugerising-crescendoconcernfarm-fieldslandscapescreature's-banebountyawesome-six-legged-predatormedieval-torture-devicesource-of-speculationlittle-facttasty-morselmarkhapless-victimslurpprotein-for-developmentautumnwell-fed-femaleseveral-to-more-than-one-hundredsycamore-treeattendanceironynocenttriggered-outbreakremain-to-be-seenword-of-cautionAssasipetlaboratorylearned-firsthandtry-not-to-handlevictimShrewsburyMartinsonSargentfascinationinspirationarchivecreaturestreesUFextensionintegrated-pest-managementNC-StateAG295htmltortoise-beetlesIFASornole-cpillarUKYAgricultureCritterFilescasefileinsectsbugsassassinsuggested-common-namescientific-nameLinnaeusMegha-KalsiDakshina-R.-Sealpublicationpreparationhappy-safe-Halloweeneat-stink-bugpart-3meets-wheel-bugmid-Atlantic-regioninimitable-pestapplesvegetablessoybeanshomesdiscoverydamagedistresshomeownerswicked-winterprevious-episodesgive-stink-bugsBaby-boomersoutwitundosucking-insectsMother-Natureliquefied-tissuesegg-conversionclustersspringbright-red-abdomensluckyhalf-dozenstealthily-stalkedassassinatingstinky-marmorated-cousinsno-particular-intereststalking-humanstoo-largetaste-badfirsthandbewarehandling-directlyAshleyNancyChrisRyanErikCarolinewranglingdeath-of-stink-bugPart-2vandalizing-vegetablessullying-soybeansinvading-homeswide-variety-cropscurious-reunionarachnid-kindstalkingcapturingassassinating-stink-bugsgamegorgeous-wheel-bug-nymphscluster-near-eggsventuring-offfirst-victimtrue-bug-clanbed-bugsleaf-footed-bugsnefarious-brown-marmorated-stink-bugpredictedstruggleprotect-cropsprevent-stinky-invadersoverlookeating-mechanismbusiness-endpowerful-beakfront-legscautiously-approachesembracesimpalespumps-strong-digestive-enzymesliquefy-body-tissuesslurpslarvaetens-to-more-than-one-hundredplant-hoppersaphidsincrease-in-populationsstink-bug-laden-nurserycurious-ironyoutbreakbeneficial-wheel-bugsiNaturalist-taxonrankpreferred-common-nameobservations-count399Wikipedia-summarykingdomphylumclassorderfamilygenusGBIF-taxonomy-matchmatched-scientific-namecanonical-namestatusacceptedmatch-typeexactdistribution-recordsauthorshipspecific-epithetclassificationeukaryotanomotettix-cristatusauthoritybasionymgroupgrasshoppers-crickets-katydidsspeciesinstructionsfill-all-fieldsavailable-knowledgefield-cannot-be-supportedreturn-nullNOT-repeat-informationeach-section-focuseduseful-detailschemataxon-recordentomology-guideaccurateconservativeinformativefactual-correctnesscompletenessclarityverbosityusefulnessCRITICAL-RULESinformation-not-clearly-supportedNOT-infer-species-level-traitshigher-taxaexplicitly-justifiedNOT-repeat-same-informationmultiple-fieldsunique-non-overlapping-contentvague-generalizationslike-most-insectstypically-feeds-on-plantscautious-languagehas-been-observedis-known-toNOT-fabricatebehaviorsdietlife-cycle-detailshost-relationshipsFIELD-INTENTsummaryhigh-level-overview3-5-sentencesappearancephysical-description-onlyidentificationdistinguish-from-similar-taxahabitatenvironment-conditionsdistributiongeographic-range-onlyseasonalitytiming-of-activityfeeding-habitsnull-if-unknowndevelopmental-stagesbehaviornotable-actions-or-habitsecologicalRolerole-in-ecosystemhumanRelevanceinteraction-with-humanssimilarTaxamust-include-reasonmisconceptionsonly-if-meaningfulextraDetailsimportant-additional-contextSTYLE-RULESclear-direct-sentencesavoid-fluff-filler-languagerepeating-taxonomy-in-proseoverly-technical-jargonconcrete-statementsabstract-descriptionsQUALITY-RULEScompleteness-highmost-fields-well-supportedcompleteness-mediumpartial-but-reliablecompleteness-lowsparse-datahasInferredContenttrue-ONLY-if-generalization-usedotherwise-falseOUTPUT-FORMATstrictly-match-JSON-schemano-extra-fieldsno-commentary-outside-JSONwater-associatedthree-subspeciesN.-c.-cristatusN.-c.-compressusN.-c.-floridanussmall-size399-observationsexact-matchmedium-completenessno-inferred-contentfactual-correctness-prioritizedconservative-approachinformative-contentno-fluffno-vague-generalizationscautious-language-where-neededno-fabricationunique-field-contentfocused-sectionsJSON-schema-complianceno-commentaryParablastothrix
Parablastothrix is a genus of parasitic wasps in the family Encyrtidae, established by Mercet in 1917. Species in this genus are known to parasitize leaf-mining Lepidoptera. The genus includes at least two described species: P. nearctica from the USA and P. ninelpetrovae from Mexico. These wasps are part of the diverse Encyrtidae family, which contains numerous biological control agents used in agricultural pest management.
Paraphlepsius rileyi
Paraphlepsius rileyi is a species of leafhopper in the family Cicadellidae, first described by Baker in 1898. It belongs to the subfamily Deltocephalinae and tribe Pendarini. The species has been recorded from multiple U.S. states including Arkansas, Florida, Georgia, Illinois, and Kansas. Like other leafhoppers, it is a small, plant-feeding insect with piercing-sucking mouthparts.
Petrolisthes armatus
Green Porcelain Crab
Petrolisthes armatus, commonly known as the green porcelain crab, is a small porcellanid crab native to the southwestern Atlantic, particularly Brazil. The species has established invasive populations along the southeastern United States coast, where densities can exceed 30,000 individuals per square meter. Genetic studies confirm it as a single monophyletic species with exceptional geographic range spanning the Atlantic and eastern Pacific. It is frequently parasitized by the bopyrid isopod Aporobopyrus curtatus, which causes parasitic castration.
invasive-speciesfilter-feederparasite-hostintertidalporcelain-craboyster-reefsymbiosisplanktonic-larvaevisual-ecologycrustaceandecapodanomuraporcellanidaesouthwestern-atlanticeastern-pacificsoutheastern-united-statesbopyrid-parasiteAporobopyrus-curtatusestuarinemangrovesponge-symbiosisgaze-stabilizationachromatic-visionlarval-transportoyster-bedballast-wateraquaculturemonophyleticcryptic-species-complexparasitic-castrationzoeamegalopapleopodspermatophorechellipedcarapacegranulatedolive-greenblue-colorationFarol-IslandBrazilGeorgiaSouth-CarolinaFloridaPanamaCosta-RicaEcuadorPeruBaja-CaliforniaCaribbeanGulf-of-MexicoWest-IndiesAscension-IslandBermudaBahamasWest-Africarock-rubblesoft-sedimentshallow-subtidallower-intertidaldensity-30000-per-square-meter6-8-mm0.5-gorange-spotfour-segmented-chelipedantennae-outside-eyesvestigial-fourth-leg-pairfeathery-mouthpartszooplanktonscavengerpheromone-settlement-cue3-mm-sexual-maturity17%-parasite-prevalencebranchial-chamber-parasitesynchronous-growth-parasite-hostcastrationvisual-noisecaustic-flickerpolarization-sensitivityoptomotor-assaytidal-creekspectrally-narrow-environmentmitochondrial-DNAgenetic-variabilityexceptional-rangepre-Canal-Panama18591930s-Floridalineagewarm-temperate-Atlanticspecies-complexhalf-crabsquat-lobster-relativetrue-crabfalse-crabDecapodaMalacostracaArthropodaCrustaceaGibbes-1850Porcellana-armatagreen-porcelain-crabPetrolisthes-armatusPhytocoris tuberculatus
A small mirid plant bug described by Knight in 1920, known from limited records in the eastern United States. Belongs to the genus Phytocoris, a diverse group of plant bugs characterized by their slender bodies and often cryptic coloration. Specific details of its biology remain poorly documented due to its apparent rarity and limited collection records.
Polyphylla donaldsoni
Donaldson's lined June beetle
Polyphylla donaldsoni is a species of scarab beetle in the family Scarabaeidae, described by Skelley in 2003. It is a member of the lined June beetle genus Polyphylla, which is most diverse in the southwestern United States. Adults are medium-sized beetles that closely resemble Polyphylla pubescens but can be distinguished by specific morphological features. The species has an extremely restricted distribution, known only from central Georgia.
Proserpinus gaurae
proud sphinx moth, Proud Sphinx
Proserpinus gaurae is a medium-sized sphinx moth with distinctive orange and chestnut coloration. Adults are active primarily from April through August, with one or two generations per year. The species is notable for having the longest labial palps of any Proserpinus species. Larvae feed on evening primrose relatives and pupate in shallow soil burrows to overwinter.
SphingidaeMacroglossinaeMacroglossiniProserpinusproud-sphinx-mothProud-SphinxNorth-AmericaUnited-StatesMexicoevening-primroseOnagraceaeOenotheraGauraEpilobiumnocturnalspringsummerAprilMayJuneJulyAugust1797SmithSphinx-gauraemedium-sizedorangechestnutreddishwhiteblacklabial-palpssinuateforewinghindwingshallow-burrowoverwinterpupalarvaherbivorelepidopteristrearcollectprairiemeadowdisturbedopen-habitatTexasLouisianaFloridaAlabamaMissouriGeorgiaSouth-Carolinanorthern-MexicoRhagio floridensis
Rhagio floridensis is a species of snipe fly in the family Rhagionidae, described by Chillcott in 1965. It is distinguished from other eastern Nearctic Rhagio species by its yellow thorax and distinctively patterned wings. The species is known from Florida and Georgia.
Schinia arefacta
arefacta flower moth
Schinia arefacta, the arefacta flower moth, is a noctuid moth endemic to Florida and Georgia. It belongs to a large genus of flower moths known for their colorful appearance and close association with host plant flowers. The species was described by H. Edwards in 1885. Like other members of the genus Schinia, adults likely visit flowers for nectar and rest on their host plants.
Selonodon ferrugineus
Selonodon ferrugineus is a species of click beetle in the family Cebrionidae, described as new to science from Georgia, United States. It was formally recognized in a 2004 revision of the genus Selonodon that described 17 new species from the southern United States. The species epithet 'ferrugineus' (rust-colored) likely refers to its coloration. Like other cebrionids, adults are nocturnal and attracted to lights.
Trichonephila clavata
Jorō spider, Joro Spider, Parachute spider
Trichonephila clavata, commonly known as the Jorō spider, is a large orb-weaving spider native to East Asia that has become established as an invasive species in the southeastern United States since approximately 2010. First confirmed in Georgia in 2014, it has expanded rapidly across multiple states through a combination of ballooning dispersal and human-mediated transport. The species is notable for its substantial size, striking coloration, and extensive golden webs, but poses minimal risk to humans due to small fangs and docile behavior. Its physiological adaptations—including higher metabolic rate, faster heart rate, and greater cold tolerance than its congener Trichonephila clavipes—suggest potential for continued northward range expansion.
invasive-speciesorb-weaverballooningurban-wildlifebiological-controlcold-tolerancestartle-responsecannibalismkleptoparasitismJapanese-folkloreNephilidaeTrichonephilaspider-silkrange-expansionphysiological-adaptationurban-ecologyagricultural-pest-predatoriNaturalistGeorgiaMarylandEast-AsiaUnited-Statesspider-bitevenomdocilenon-aggressiveweb-architectureegg-sacoverwinteringsexual-dimorphismmetabolic-rateheart-ratefreeze-toleranceroad-ecologyprey-capturecompetitionnative-spider-impactspublic-perceptionmedia-sensationalismmanagementpesticide-alternativesbroom-removalornamentalstructural-pestornithologycardinalweb-strengthtrophic-interactionsDNA-metabarcodingdiet-analysisspecies-distribution-modelphysiological-entomologybehavioral-ecologyarachnologyballooning-dispersalhuman-mediated-dispersalhitchhikercargo-stowawayport-of-entryclimate-changewarmingnorthward-expansionDMVHoward-CountyElkridgeIlchesterWest-Elkridgebeech-forestsecondary-forestsuburbanroadsidetelephone-polestreetlampforest-edgedisturbance-toleranceprey-detectionvibrational-noiseauditory-disturbancemotionlessfreezingshynessHannibal-Lecterstink-buglanternflyevolutionary-historyancient-associationecosystem-servicebiocontrolnatural-enemyinvasive-pestbrown-marmorated-stink-bugspotted-lanternflyHalyomorpha-halysLycorma-delicatulacompetitive-exclusiondominant-orb-weaverabundantpopulation-growthrapid-spreadrange-span120,000-km2physiological-plasticitymetabolismtwice-as-high77%-higher-heart-rate74%-freeze-survivaldevelopment-rateseasonal-windowlife-cycle-completionthermal-limitationcongener-comparisonnatural-dispersalhuman-transportiNaturalist-recordcitizen-scienceconfirmed-sightingbreeding-populationmale-and-femalegravid-femaleegg-casestowawaycargo-containerport-introductionlocal-portvehicle-transporthitchhikingaccelerated-arrivalseveral-yearsnatural-meansprognosticationpredictionmodelsuitable-habitatabundant-suitable-habitateastern-North-Americawestern-North-Americapotential-rangeinvasive-rangepotential-impactenvironmental-impactecological-impactecosystem-impactmonitorcautiousevidence-basedreasonable-journalismsensationalismexaggerationuncritical-acceptanceharmlesscarefully-monitorednext-stepsresearch-opportunitycall-for-researchknowledge-gaplittle-knownnovel-ecosystemspreadingrapidly-expandinginvasive-predatorinvasive-orb-weavernon-nativeintroducedestablishedcolonizedthrivingdoing-finehappymerely-20-minutes-awayroad-tripvisitaccess-spreadbeech-leaf-diseaseBLDstate-forestremarkable-colonyamongst-beech-treesconfirmed-prognosticationDavis-and-Frickescape-relative-warmthexpand-range-northwardeastern-seaboardmerely-20-minutes-away-from-homeresist-opportunityamazing-predatorstales-of-arrivalprevious-episodes20222024reduce-angstlarge-non-native-spiderestablishing-in-DMVfacts-presentedpast-episodevenomous-terrible-painfulNahexpert-Rick-Hoebekerisks-smallpuny-fangsunlikely-pierce-skinvideocompletely-non-aggressiveeastern-Howard-Countyhaphazard-webslittered-with-remainsformer-victimsleavesshed-exoskeletonsmuch-larger-femaledwarfs-matepositioned-just-abovestrand-of-silkspinneretsunderside-of-abdomennear-red-moundrelative-to-handlarge-and-docilewait-and-seewhat-Jorō-means-to-ecosystemshelp-other-spidersput-a-beat-down-on-invasive-pestsstink-bugsspotted-lanternfliespassive-huntersenormous-webslarger-than-a-meter-in-diametercapture-prey-snared-in-silkarachnophobes-scaryarachnophiles-beautifulimportant-ecosystem-servicescrop-pestsnative-rangeAsiahaving-an-old-friend-over-for-dinnerreunitefirst-timelarge-spidersjuicy-prey-itemsfeathered-and-non-feathered-reptilesposes-no-known-threatdifficult-to-predict-impactnon-native-speciesexperts-suggestbeyond-scary-miengive-indigenous-large-orb-weavers-run-for-their-moneyblack-and-yellow-garden-spidermarbled-orb-weaverspotted-orb-weaverother-parts-of-worldmost-abundant-and-dominant-orb-weaverwhat-will-it-meanonly-time-will-tellfinal-tidbitJorō-shapeshifterJorō-gumobeautiful-womanseduces-menbinds-with-silkdevoursbad-dateacknowledgementsRick-Hoebekeidentifying-JorōinsightsDavid-CoyleBob-Bellingergreat-imagesknowledgestudiesVeni-vidi-viciNelsen-et-al.Physiological-evaluationNephila-clavata-newly-recordedHoebeke-et-al.Life-Cycle-Habitat-and-VariationMooreStartle-responsesDavis-and-AneraoHow-Urban-Tolerant-Are-TheyDavis-et-al.inspirationdetailsstarsDave-ClementMiri-TalabacMaddie-Potterhooked-up-with-colonydifferentiateresources.ipmcenters.orglinkJorō-guruDavid-Coyle's-takeYouTubecalm-your-fearsJournal-of-Economic-EntomologyJournal-of-Medical-Entomologychemical-management-strategieseffective-management-methodsspider-control-productssafe-and-effectiveunlikely-to-bitegenerally-harmlessbig-spiderscolorful-spidersinvasive-spidersin-your-face-spiderswebs-on-homeslandscape-plantsstructuresmiddle-of-where-people-live-work-and-playnorthern-Georgia-2014presumed-arrived-few-years-prior15-yearsincreased-dramaticallymuch-of-Southeastdisjunct-populationsnortheastern-U.S.firestorm-of-interestrapidly-expanding-rangesoutheastern-statesmany-countiesCarolinasTennesseeOklahomamore-than-a-centuryparts-of-Floridararely-Pennsylvaniatropicsthermal-limitationshigher-metabolismfaster-heart-ratebetter-ability-to-tolerate-freezingcomplete-life-cycle-rapidlychilly-temperaturessuite-of-adaptationsexpand-northwardwarm-loving-cousinfindings-support-potentialmuch-yet-to-be-learnedsuccessfully-survive-northern-wintersnation-and-world-warmsouthern-species-expandhigher-latitudes-and-altitudesrapidly-range-expansion-will-occurtypical-mode-of-dispersalaerial-dispersalballooning-on-strands-of-silkCharlotte's-babiesCharlotte's-Webspectacular-monikerparachute-spiderrain-down-from-airplaneslong-distance-transithuman-assistancegood-hitchhikersinseminated-gravid-femaleegg-case-stowawayarrival-in-DMVseveral-years-by-natural-meansnew-introduction-at-local-porthuman-assist-in-vehiclesaccelerate-arrivalterrible-and-painfulsmall-fangsvisited-cousingolden-silk-spiderCosta-Ricaexceeding-meter-diameterindigenous-large-orb-weaversrun-for-their-moneyminimal-direct-impactfirestormAndrew-DavisBenjamin-FrickUniversity-of-Georgiapast-weeknative-to-eastern-AsiaJapanChinaKoreaTaiwanknown-in-Georgia-since-2013spreading-rapidlyjoined-its-cousinTrichonephila-clavipesestablished-over-160-yearsbetter-tolerate-freezingsurvive-northern-wintersrapidly-range-expansiontypical-modelong-distancenew-introductionhuman-assistarachnophobesarachnophilesbrown-marmorated-stink-bugsdifficult-to-predictscary-mienindigenous-orb-weaversMary-NouriSarah-MorganWAMUrelatively-harmlessspider-seasonfallleaves-changing-colorcool-crisp-autumn-airpumpkin-spiceextension-entomologistSoutheastnot-just-spiders20-feet-widehomespeople-live-work-and-play15-years-or-soinflux-of-callspublicentomology-extension-programsmedia-frenzytwo-questionsget-rid-of-Jorō-spidersare-Jorō-spiders-dangerousClemson-UniversitySouthern-Adventist-UniversityWashington-CollegeUnion-Collegetwo-new-studiestest-methods-for-eliminatinghow-likely-to-biteharmscoured-internetrecommended-treatment-optionsspider-specific-management-recommendationsmedically-relevantwidow-spidersbrown-reclusesdo-not-enter-homesrelatively-newrecommended-productslabelled-spider-control-productstested-productsseveral-products-eliminatenot-legal-pesticidesmachine-lubricantnot-recommendedcommercially-availablestrongly-encouragelabelled-productseasiest-and-cheapestwithout-chemicalsbroom-or-stickwalked-into-spider-webrode-biketook-spider-to-facenot-great-feelingwonder-if-biteygive-bitten-superpowersunique-studiesevaluated-behaviorsreact-to-peoplerather-drop-off-webhang-around-and-bitereally-provokevolunteered-to-get-bittenyes-you-read-correctlyakin-to-mosquito-bitelittle-rednesslittle-swellinglargely-gone-next-dayno-acquired-superpowerstake-home-messagetwofoldsimplest-and-most-effectivewithout-pesticidesfeel-you-need-pesticidesproduct-labeled-for-spider-controltry-not-to-freak-outdoesn't-want-to-be-on-youodds-of-getting-bitten-extremely-lowenjoy-glorious-fall-weatherdrink-pumpkin-spiced-beveragewatch-where-you-walkKeep-calm-and-carry-onbites-unlikelycause-minimal-discomfortassociate-professorDepartment-of-Forestry-and-Environmental-Conservationsocialsemailextensionfeaturedpest-managementEntomology-Todaylatest-postsemail-subscriptionMarch-2022wonderedmake-its-way-to-DMVSeptember-2022two-observationsthree-years40-sightingshappy-and-doing-just-fineseveral-Howard-County-locationsweek-or-so-agoteam-of-scientistsUniversitymissionkilling-ultra-valuable-beech-treesthriving-amongst-beech-treesvisit-amazing-predatorsmature-femalesboth-Trichonephila-speciesthree-locally-common-orb-weaving-speciestime-spent-immobilemild-disturbancebrief-puff-of-airair-puff-response-datafive-other-North-American-speciespublished-literature453-observationsfreezing-behavior10-spider-speciesremained-immobile-under-a-minuteboth-Trichonephila-spidersover-an-hourunprecedentedshyest-ever-documentedtolerate-urban-environmentsremaining-motionlessfleeingnonsexual-cannibalismmating-activityfemales-cannibalize-malesfood-availabilityterritorial-aggressionSoutheastern-United-Statesexpanding-rangeshybehavioral-reactionsdescriptive-observationsphoto-documentationanecdotal-observationscontrolled-pairingslabnatural-websfieldone-female-biting-and-killing-anothershort-fightsimilar-sizecontainer25-trialsfights-ensued-40%different-sizes27-trialsfights-happened-18%larger-females-not-always-aggressor52-lab-trialssix-bouts9%direct-killingfield-trialsempty-web14-trialsone-fight7%aggressor-killing-and-wrappingsilkaway-from-any-webnot-necessarily-territorialityintraspecific-aggressionprovoked-or-stresseddeserves-more-studynewly-invasivebiologyphysiologynew-rangeclosely-related-speciessuccessfully-established160-yearsinvestigationcompareonline-recordsiNaturalist.orgseasonal-distributionstimingfemalesphysiological-traitsenvironmental-tolerancemetabolic-ratescardiac-functioningcold-exposuresurvivalbrief-below-freezing-temperatureshorter-seasoncomplete-lifecyclenarrow-periodsuitable-weatherinherently-higher-metabolismlow-temperaturesurvive-better74%-compared-to-50%brief-freezecolder-climatic-regionsoutheastern-USAuseful-informationplanningurban-landscapesbusy-roadsfrequent-disturbancesauditory-and-vibrationalphysiological-or-behavioral-changesnortheast-Georgiavarying-levels-of-road-trafficprey-capture-behaviorsimulated-preytuning-fork128-hz-frequencytouched-to-webattacked357-total-trials20-different-roadsattacked-59%high-variabilitysome-roadsides-over-80%others-less-than-30%small-but-significant-negative-correlationdaily-road-trafficspider-attack-ratesmoderate--to-heavy-traffic-roadsslightly-less-likely-to-attack51%-vs-65%able-to-live-near-roadscost-in-terms-of-prey-capturedid-not-weigh-lesscompensate-for-disturbanceaccumulating-evidencehuman-dominated-landscapesaid-spreadintroduced-rangeEriostethus-rufuspolysphinctine-ectoparasitoidaraneid-spidersNeoscona-spp.endemic-to-JapanYamagata-Prefecture38º46'-Nnorthern-Japannorthernmost-recordgenusidentification-confirmedmorphologyDNA-barcodingcocoonlarge-modified-webuniqueinverted-triangleover-50-cmhanging-from-ill-defined-partno-organized-structurehost-spidercircumstantial-evidencesstructure-of-modified-webpre-existing-web-partly-reusedorb-web-completely-removedsustaining-threads-newly-mooredparasitises-host-spiderstwo-subfamiliesunusual-for-groupinvasion-potentialknown-invasive-rangereviewdispersal-abilitiespotential-impactsmanagement-strategiesOctober-2022at-least-120,000-km2South-CarolinaNorth-CarolinaAlabamaWest-Virginiapattern-of-spreadnatural-dispersal-mechanismshuman-mediated-transportlarge-bodied-orb-weaversflying-insectssmall-animalsthirteen-co-occurring-spider-speciesmonitored-for-competitionresourcesweb-building-sitesnatural-and-urban-habitatsmanagement-options-limitedadvise-journalists-and-expertsagainst-exaggerating-potential-environmental-impactecologically-harmlessrapid-spread-carefully-monitoredcautious-evidence-based-approachdetermining-next-stepsthree-material-typesweb-captureintroduced-speciesalter-established-trophic-interactionsmolecular-analysisresolve-changescommunity-structureforaging-linkseast-coastfecal-samplesprey-remains-from-websdissected-gutscompare-diet-compositionarthropod-targeted-COI-primersIllumina-MiSeqhighest-diversityhighest-richnesshighest-proportion-prey-readsrecovery-of-prey-readsdissected-gut-contentlowoverwhelmed-by-Jorō-spider-DNAhigh-proportions-Jorō-spider-readshigher-prey-diversity-and-richnessdetected-prey-DNAseveral-days-after-captureinitial-gut-retention-time-estimatesfirst-glimpsecomplexity-of-trophic-associationsintroduced-web-building-spiderviable-materialsource-of-prey-DNAestimates-of-biodiversityJammu-and-Kashmirnorthernmost-shiftingdocument-presencebehaviorhabitat-adaptationcolder-temperature-environmentGoha-TehsilDoda-district1556.74-metersroad-bridgenearby-vegetationbrightly-colored-abdomensblackgreenyellowredlong-legsyellow-and-black-bandingspredominantly-seensmallerfewerunique-behaviorsremaining-motionless-after-disturbances5-10-meters-of-roadsadaptation-to-human-settlementsfield-observationsimage-documentationexpert-confirmationthrive-in-colder-conditions15-20-degrees-CelsiusOctober-Novemberno-spider-foundhigher-elevationssignificantly-lower-temperaturesadaptation-limited-to-milder-cold-regionsnew-insightadaptationneed-for-further-researchnon-native-habitatseggsoverwinterharsh-weather-conditionsno-protectioncompact-silk-casemilky-coatingchorionic-microspheresCMfine-structural-characteristicsecological-importanceuneven-size-distributionouter-eggmassevenly-coveredsingle-layerdiameter-2.3-µmshort-papillary-projectionssegmental-adhesionmucous-componentsinsoluble-in-waterpartially-soluble-in-absolute-ethanolspherical-structureHFIPstrong-organic-solventnot-derived-from-vitellogenic-or-choriogenetic-processesCM-adhesive-coatingsovipositional-processequivalent-to-cocoon-silkprotective-functionssilken-eggcaseNorthern-CardinalCardinalis-cardinalisperchessteals-foodsoutheast-of-the-United-Statesquestionsnative-fauna-affectedconsuming-prey-itemsexamplenative-species-deriving-benefitmanner-of-kleptoparasitismperched-directly-on-websupported-its-weight42-48-gfirst-documented-casespider-web-supporting-perching-birdmeasurementsforce-gaugetypical-webssupport-masses-up-to-70-gsmall-but-growing-body-of-knowledgenon-native-spiderspecies-distribution-modelsecological-niche-modelingpredict-areasestablish-if-introducedthree-distinct-genetic-lineagesmitochondrial-COIgenome-wide-SNPsKorean-Peninsula