Crustacean
Guides
Aegidae
aegid isopods
Aegidae is a family of marine and freshwater isopod crustaceans characterized by temporary parasitic relationships with fish hosts. Adults attach to hosts to feed on blood or tissue, then detach to digest meals. The family is distinguished from related Cirolanidae by having only three pairs of hook-like pereiopods rather than seven. Members occur in diverse aquatic habitats from shallow coastal waters to deep ocean environments, with some species documented at depths exceeding 2000 meters.
Aeginina
skeleton shrimp
Aeginina is a genus of caprellid amphipods containing at least two described species: Aeginina longicornis and Aeginina aenigmatica. These small crustaceans are commonly known as skeleton shrimp due to their elongated, stick-like appearance. The genus was established by Norman in 1905 and occurs in marine environments of the North Atlantic.
Alloniscus mirabilis
Wonderful Wracklouse
Alloniscus mirabilis is a terrestrial isopod (woodlouse) in the family Alloniscidae. The species epithet "mirabilis" (Latin for "wonderful" or "extraordinary") reflects its distinctive characteristics. As a member of the suborder Oniscidea, it is a fully terrestrial crustacean adapted to life on land. The species has been documented in North America with 81 observations recorded on iNaturalist.
Americorchestia longicornis
Common Atlantic sandhopper
Americorchestia longicornis, the common Atlantic sandhopper, is a beach-dwelling amphipod in the family Talitridae. It inhabits sandy coastal environments along the Atlantic seaboard, where it functions as a detritivore and scavenger. The species is distinguished from similar beach hoppers by its elongated antennae, as reflected in its specific epithet.
Amphibalanus
acorn barnacle
Amphibalanus is a genus of acorn barnacles in the family Balanidae, established by Pitombo in 2004 to accommodate species formerly assigned to Balanus. The genus contains multiple species including the widespread and economically significant Amphibalanus amphitrite and A. improvisus. These barnacles are characterized by their conical calcareous shells, cemented base, and planktonic larval stages culminating in a settlement-competent cyprid stage. Several species have become established outside their native ranges as invasive biofouling organisms in ports and harbors worldwide.
Anomopoda
water fleas
Anomopoda is a group of small aquatic crustaceans commonly known as water fleas, classified within Branchiopoda and Diplostraca. The group includes several families of ecological and scientific importance, with some species widely used as model organisms in evolutionary biology, ecology, and toxicology. Anomopods exhibit remarkable reproductive flexibility, alternating between parthenogenetic and sexual reproduction. They occupy diverse freshwater habitats across the globe and serve as critical components of aquatic food webs.
Arguloida
Fish Lice
Arguloida is an order of parasitic crustaceans commonly known as fish lice. The order contains a single family, Argulidae, whose members are obligate ectoparasites of freshwater and marine fishes. These organisms have an uncertain phylogenetic position within Maxillopoda and lack any known fossil record. They are distributed globally across temperate and tropical waters.
Argulus
Fish Lice, Carp Lice
Argulus is a genus of ectoparasitic crustaceans commonly known as fish lice, comprising approximately 130–140 accepted species. They are obligate parasites of fish, inhabiting marine, brackish, and freshwater environments worldwide. The genus exhibits low host specificity and can infest diverse fish species, with documented impacts on host health including immunosuppression and facilitation of secondary bacterial infections.
Armases
square-back American marsh crabs
Armases is a genus of sesarmid crabs comprising approximately 13 described species distributed across tropical and subtropical coastal regions of the Americas. These semi-terrestrial crabs inhabit salt marshes, mangroves, and estuarine environments, with some species exhibiting notable movement between marine and terrestrial habitats. Several species have been extensively studied for their larval development, metabolic ecology, and role in ecosystem energy transfer. The genus includes both species with larval export strategies to continental shelves and those breeding in supratidal rock pools.
Artemia franciscana
San Francisco brine shrimp
Artemia franciscana is a small crustacean native to hypersaline environments of the Americas, now widely introduced globally for aquaculture. The species exhibits exceptional reproductive plasticity, switching between ovoviviparity (live birth of nauplii) and oviparity (production of dormant cysts) based on environmental conditions. It matures rapidly, reaching reproductive age in under 20 days, and serves as a critical live food source in commercial fish and shellfish farming. The species shows pronounced phenotypic plasticity in response to salinity and temperature stress.
Artemiidae
Brine Shrimp
Artemiidae is a family of branchiopod crustaceans containing the single genus Artemia, commonly known as brine shrimp. These organisms inhabit hypersaline inland waters worldwide where their extreme salinity tolerance excludes most predators. The family has remained morphologically unchanged since the Triassic period. Artemiidae species serve as important food sources for waterbirds and as intermediate hosts for avian cestodes. Their desiccation-resistant cysts have enabled commercial harvest and widespread use in aquaculture as live feed.
Aselloidea
Waterslaters and allies
Aselloidea is a superfamily of freshwater and subterranean isopods within the suborder Asellota. Members are primarily aquatic, with many lineages adapted to life in groundwater, caves, and karst systems. The superfamily includes families such as Asellidae (common freshwater isopods), Stenasellidae, and Atlantasellidae. Some representatives exhibit remarkable morphological specializations for subterranean existence, including reduced eyes and elongated appendages.
Asellota
Asellotes
Asellota is a suborder of isopod crustaceans comprising approximately one-quarter of all marine isopods. The group exhibits remarkable ecological diversity, occurring in marine, freshwater, and subterranean habitats from shallow coastal waters to abyssal depths, including hydrothermal vents. Members possess distinctive morphological specializations including a complex copulatory apparatus that distinguishes them from other isopods. The suborder has undergone multiple independent colonizations of deep-sea environments, with some lineages showing extensive radiation in these habitats.
Astacoidea
Northern Hemisphere Crayfishes
Astacoidea is a superfamily of freshwater crayfish restricted to the Northern Hemisphere. It comprises three families: Astacidae (Europe and western North America), Cambaridae (eastern North America), and Cambaroididae (eastern Asia). Members are distinguished from the Southern Hemisphere superfamily Parastacoidea by geographic distribution. Crayfish in this group possess ten walking legs, feather-like gills for respiration, and a segmented body with a hard exoskeleton. Many species construct burrows for shelter, with complexity varying from simple tunnels to elaborate multi-chambered systems.
Barce husseyi
Barce cf-husseyi is an amphipod crustacean in the family Phliantidae. The 'cf.' designation indicates the specimen resembles Barce husseyi but definitive identification requires further verification. Amphipods in this genus are typically marine, benthic organisms associated with hard substrates or sediments.
Bathyporeiidae
Bathyporeiidae is a family of amphipod crustaceans containing two genera: Amphiporeia and Bathyporeia. These small, laterally compressed marine invertebrates are primarily known from shallow coastal waters of northern Europe. The family was formally established by d'Udekem d'Acoz in 2011.
Bosmina freyi
Bosmina freyi is a small cladoceran crustacean in the family Bosminidae, described by De Melo and Hebert in 1994. It inhabits freshwater environments, with documented populations in tropical eutrophic reservoirs. Research has examined morphological plasticity in this species, particularly variation in body size, mucron length, and antennule morphology in response to environmental conditions.
Branchiopoda
Branchiopods
Branchiopoda is a class of small, primarily freshwater crustaceans unified by the presence of gills on their appendages—giving the group its name from Greek 'bránkhia' (gill) and 'poús' (foot). The class comprises fairy shrimp (Anostraca), tadpole shrimp (Notostraca), clam shrimp (Spinicaudata, Laevicaudata, Cyclestherida), and water fleas (Cladocera/Diplostraca), plus the extinct Devonian Lepidocaris. Most are filter-feeders on plankton and detritus, though notostracans are opportunistic omnivores. Many species inhabit temporary pools and produce desiccation-resistant resting eggs, allowing survival through dry periods.
Branchiura
Branchiurans, Fish lice
Branchiura is a subclass of crustaceans within the class Ichthyostraca, comprising approximately 170 species of ectoparasitic fish lice. The group contains two extant families: Argulidae (fish lice) and Chonopeltidae, plus the extinct Cyclida. Branchiurans are obligate ectoparasites of freshwater and marine fishes, characterized by a flattened body adapted for clinging to host surfaces and specialized mouthparts for feeding on host blood, mucus, and tissues.
Bythotrephes longimanus
Spiny Water Flea, Spiny Waterflea
Bythotrephes longimanus is a predatory planktonic cladoceran crustacean native to northern Europe and Asia that has become a significant invasive species in North America since its introduction to the Great Lakes in the 1980s. Adults reach up to 15 mm in length, with females growing substantially larger than males. The species exhibits cyclic parthenogenesis and produces distinctive morphological forms depending on reproductive mode and season. Its invasion has caused substantial ecological disruption through direct predation on native zooplankton and non-lethal effects that alter prey behavior and population dynamics.
Caecidotea communis
Caecidotea communis is a freshwater isopod in the family Asellidae. It inhabits ponds and exhibits cathemeral activity patterns—maintaining consistent movement rates across day and night periods. The species shows insensitivity to kairomones from predatory fish, representing the first documented case of cathemerality in crustaceans.
Calappa flammea
Flame Streaked Box Crab
Calappa flammea is a marine crab species in the family Calappidae, commonly known as the Flame Streaked Box Crab. It is distributed in the Western Atlantic Ocean. The species was first described by Herbst in 1794 as Cancer flammeus.
Calliopiidae
Calliopiidae is a family of hyperbenthic amphipods distributed across the North Atlantic and North Pacific oceans. Members inhabit diverse marine environments including subtidal waters, hydrothermal vents, and the hyperbenthic zone immediately above the seafloor. The family includes the newly described genus Bathya from deep-sea hydrothermal vents and Calliopius species associated with macroalgae.
Cambarus dubius
Upland Burrowing Crayfish
Cambarus dubius, commonly known as the Upland Burrowing Crayfish, is a burrowing crayfish species native to the central and southern Appalachian region of the eastern United States. The species has a complex taxonomic history with multiple distinct color phases historically recognized across different geographic areas. Recent taxonomic work has restricted C. dubius sensu stricto to populations with orange dorsal and lateral coloration and cream ventral surfaces, found in the central and northern Allegheny Mountains and high elevations of the Appalachian Plateau. The species constructs distinctive burrow systems and faces conservation concerns due to limited distribution data and habitat alterations.
Cambarus speciosus
Beautiful Crayfish
Cambarus speciosus, commonly known as the beautiful crayfish, is a species of freshwater crayfish in the family Cambaridae. It is endemic to Georgia, United States. The species is currently listed as Near Threatened (NT) by the IUCN, with a stable population as of the last review in 2010. The specific epithet 'speciosus' refers to its attractive appearance.
Cancer borealis
Jonah crab
Cancer borealis, commonly known as the Jonah crab, is a marine brachyuran crab native to the western Atlantic Ocean. It inhabits waters from Newfoundland to Florida, primarily in rocky marine environments. The species possesses a rounded, rough-edged carapace with small light spots and robust claws with dark brown-black tips. Males reach larger sizes than females, with maximum carapace widths of 222 mm versus approximately 150 mm. The Jonah crab has been extensively studied as a model organism for neurophysiology, particularly for its stomatogastric nervous system, which has contributed to understanding neural circuit function and neuromuscular control.
model-organismneurophysiologystomatogastric-ganglioncommercial-fisheryrocky-intertidalAtlantic-Oceandecapodcrustaceanion-channel-researchtemperature-adaptationpH-adaptationneural-circuitneuromuscularcompetitionfisheriesmarine-biologycell-identitytranscriptomicspotassium-channelsK2P-channelsmuscle-physiologystomatogastric-nervous-systembiogenic-amine-receptorsGABA-receptorsglutamate-receptorsacetylcholine-receptorsgap-junctionsinnexinsWnt-signalingobesity-researchcolon-cancer-researchsoluble-epoxide-hydrolasesEH-inhibitoromega-3-fatty-acidsDHA-metabolitesEDPsanti-angiogenictumor-growthmetastasispain-researchinflammatory-diseasediabetic-neuropathycancer-therapychemotherapy-side-effectsdebris-stimulated-metastasiscytokine-stormmacrophageinflammation-resolutioneicosanoid-pathwayprostaglandin-receptorEP4-antagonistclinical-trialsEicOsisacademic-industry-collaborationtranslational-researchfundamental-scienceinsect-metamorphosiscaterpillarbutterflygreen-insecticideblood-pressurefibrosisimmunitytissue-growthchronic-painnon-opiate-analgesiccompanion-animalhuman-healthdistinguished-professorNational-Academy-of-SciencesNational-Academy-of-InventorsUC-DavisSuperfund-ProgramNIHNIEHSRIVER-programbiotechnology-trainingpeer-reviewed-publicationslipidomicsfatty-acid-diolshigh-fat-dietknockout-mousepharmacological-inhibitionmolecular-analysessignaling-pathwaymechanistic-studiesUSDANational-Natural-Science-Foundation-of-Chinamass-spectrometrycompound-developmentPTUPBCOX-2-inhibitordual-inhibitorsurge-protectortumor-recurrencetreatment-resistanceovarian-cancerbreast-cancerpancreatic-cancerliver-cancercolon-cancerobesity-enhanced-cancerangiogenesismetastasis-preventiontumor-microenvironmentpositive-feedback-cycledormancy-escapesurgical-tumor-resectionperi-chemotherapeutic-managementdebris-clearancemacrophage-derived-stormpro-inflammatory-mediatorspro-angiogenic-mediatorslipid-autacoidcytokine-mediatorsresolution-mediatorsEETsnatural-pro-resolving-mediatorsholistic-modulationupstream-regulationdownstream-effectsnovel-therapeuticdrug-candidatePhase-I-clinical-trialPhase-II-clinical-trialhome-carecancer-centercomprehensive-cancer-centertransdisciplinary-researchsector-researchassistance-networkshared-protocolsorganizational-innovationpatient-centered-caremultidimensionalitypsychological-sufferingphysical-sufferingquality-of-lifetreatment-adherenceKarnofsky-performance-scorecomplete-blood-countblood-biochemistryblood-urea-nitrogenactivities-of-daily-livingindependenceprobioticsmulti-strain-probioticschemotherapy-related-side-effectsfatiguenauseaweaknessproneness-to-infectionsemerging-alternative-supplementspilot-trialopen-access-journalsedation-led-chemotherapyS.L.E.E.P.sleep-during-treatmentnight-administrationbed-allocationspecialized-nursinghome-visitseconomic-investmentfunding-prioritycardiovascular-diseasehealthcare-systemresearch-collaborationexcellence-centersscientific-contributionorganizational-ideascolleague-oncologistsfight-against-cancercurse-metaphorSleeping-Beauty-metaphorspinning-wheel-metaphorevil-witch-metaphorfairy-godmothers-metaphorpatient-narrativedoctor-patient-relationshipempathycare-extensionhospital-adaptationlife-derailmentdisease-integrationeveryday-lifenormalizationtolerance-improvementovercoming-chancespractical-limitationsresearch-ideaResearch-Ideas-and-OutcomesRIO-Journalfeature-storygraduate-studentUC-BerkeleySarjeet-GillUC-Riverside50-years-research900-peer-reviewed-papers17,000-peer-reviewed-papersenzyme-importance-recognitionmammalian-biologyregulatory-moleculesdegradation-controlbiosynthesis-controlepoxy-fatty-acid-chemical-mediatorsblood-pressure-controlfibrosis-controlimmunity-controltissue-growth-controlpain-controlinflammation-controlnon-addictive-drugorally-activeseed-fund-grantsNIH/NINDS-Blueprint-Development-Granthuman-clinical-trials2019-scheduleWilliam-Schmidtvice-president-clinical-developmentlarge-NIH-grantdiabetic-neuropathic-painJun-Yan-Liuhuman-sample-collectionWeicang-WangJianan-ZhangJun-YangJia-SunSung-Hee-HwangDebin-WanYuxin-WangWiepeng-QiHaixia-YangYeonhwa-ParkKatherine-SanidadDaeyoung-KimZhang-labUniversity-of-Massachusettsassistant-professor-food-sciencecolonic-inflammation-preventioninflammatory-bowel-disease-preventioncolon-cancer-prevention30-percent-Americans-obese30-60-percent-higher-colon-cancer-riskthird-most-common-cancersecond-leading-cause-cancer-deathmechanisms-not-well-understoodfew-effective-strategiessEH-over-expression-obese-micepharmacological-inhibition-abolishes-obesity-induced-inflammationgenetic-deletion-abolishes-obesity-induced-inflammationactivation-pro-tumorigenic-pathwaysessential-enzymenovel-agentsWnt-pathway90-percent-sporadic-colorectal-cancersactivating-mutationsobesity-increases-Wnt-activationabolished-by-inhibitors-and-knockoutblocked-obesity-induced-colon-inflammationmeticulous-jobbiologically-active-fatsblocking-diol-production-blocks-inflammationlipidomics-techniqueconsistent-resultssignaling-pathway-mechanistic-studiespotential-treatmenthuman-clinical-trials-this-yearUSDA-National-Institute-Food-AgricultureNIH-NIEHSNIEHS-Superfund-Research-ProgramNational-Natural-Science-Foundation-ChinaZuodong-Zhangpostdoctoral-researcher16-scientistsdietary-omega-3-fatty-acidsfish-oilstumor-growth-reductioncancer-spread-reduction580,000-Americans-die-annuallycytochrome-P450-epoxygenase-metabolitesDHAepoxy-docosapentaenoic-acidsblood-supply-blockadetumor-inhibitionmetastasis-inhibitionnatural-EDP-stabilizationsoluble-epoxide-hydrolase-inhibitorpain-control-developmenthypertension-control-developmenthuman-studies-cancer-risk-reductionmechanism-poorly-understoodnovel-mechanism-provisionpotent-anti-cancer-effectspotent-anti-metastatic-effectscurrent-anti-cancer-drugsangiogenesis-blockadehypertension-side-effectsnew-mechanism-angiogenesis-blockadeblood-vessel-wideningreduced-side-effectsmice-studiessorafenib-combinationefficacy-improvementside-effect-reductionfood-science-doctorateUniversity-of-Wisconsin-MadisonLisa-MahakianKatherine-FerraraXiaowen-Hupromise-demonstrationepoxides-DHA-strongly-anti-angiogenicepoxides-ARA-mildly-angiogenictumor-encouragementwound-healing-encouragementopposite-effects-background-lipidshumans-as-mice-assumptionhigh-omega-3-low-omega-6-backgroundsorafenib-regorafenib-potentiationCharles-SerhanHarvard-Medical-Schoolomega-3-autacoid-expertSimon-Gelman-ProfessorAnesthesia-Perioperative-Pain-Medicinefull-appreciation-stepbioactive-products-DHA-metabolomemetabolic-conversion-pivotalvascular-mechanismscancer-biologyvascular-biologytranslation-to-humansevidence-based-treatmentsJonathan-LindnerOregon-Health-Science-Universitycardiologistnew-drug-strategiesnutrition-knowledgediet-influence-susceptibilitytumor-progression-ratechemotherapy-responsereasonable-recommendationspathway-uncoveringtumor-development-influencetumor-growth-influencebeneficial-pathwayspreviously-unrecognized-anti-cancer-effectimportant-lipid-componentheart-disease-prevention-dietcancer-prevention-dietnew-blood-vessel-growth-suppressiontumor-blood-supply-shutdowndramatic-tumor-growth-slowingUC-Davis-Department-Entomology-websiteco-author-photosJianjun-DengHarvard-Medical-School-lead-author16-member-international-teamDipak-Panigrahy-laboratoriesBruce-Hammock-laboratoryinflammatory-response-controlchemotherapy-treatmentspancreatic-cancer-patientsliver-cancer-patientsdecades-old-drug-candidatebody's-raging-inflammatory-responsedeadly-inflammatory-responseProceedings-National-Academy-SciencesPNAS-publicationrodent-modelstwo-drug-combinationinflammation-reductiondebris-from-dying-tumor-cellsmetastasis-triggercancer-spreadsEH-enzyme-inhibitionEP4-prostaglandin-receptor-blockingeicosanoid-pathway-blockingcompound-synergypancreas-cancer-metastasis-preventionliver-cancer-metastasis-preventiondebris-clearance-stimulationINV-1120highly-potent-selective-EP4-antagonistPhase-I-clinical-trial-Texasmonotherapy-effectstrong-synergy-anti-PD-1sEH-candidate-synergygemcitabine-synergypreclinical-animal-modelsYongkui-SunIonova-Life-Science-chairmanbiotechnology-company-Chinabasic-biomedical-research-translationnovel-therapeuticsHammock-lab-co-lead-authorNational-Academy-EngineeringMerck-research-and-development-teamfruitful-academic-industry-collaborationexcessive-inflammationlipid-stormhuman-body-reactionpancreatic-cancer-therapydebris-increase-sEH-EP4-proteinspro-inflammatory-lipid-autacoidpro-angiogenic-lipid-autacoidinflammatory-response-control-importanceupstream-cytokine-modulationdownstream-cytokine-blockingholistic-eicosanoid-modulationinsidious-cancer-characteristicsdying-cells-immune-system-trainingtumor-microenvironment-favorabilitytherapy-combattingeffectiveness-renderingdouble-edged-sword-cancer-therapyinflammatory-immunosuppressive-injury-responsedormancy-escape-promotiontumor-recurrence-promotionVictoria-HaakUniversity-Buffalo-first-year-medical-studentChina-Agricultural-University-researchercompound-synthesisnovel-simple-effective-approachinflammation-turning-downcytokine-storm-preventiontumor-resection-consequencenatural-pro-resolving-mediator-concentration-increasebiological-system-actionpro-resolution-mediator-productioninflammation-modulationactive-resolution-processEicOsis-Human-Health-LLCUC-Davis-based-companyinhibitor-human-clinical-trialsTexas-trialsupstream-actioneicosanoid-down-regulationcytokine-storm-down-regulationpatient-help-optimismtremendous-clinic-translation-potentialPanigrahy-quote60,430-pancreatic-cancer-diagnoses-annually31,950-male28,480-female48,220-pancreatic-cancer-deaths-annually25,270-male22,950-female42,230-liver-cancer-diagnoses-annually29,890-male12,340-female30,230-liver-cancer-deaths-annually20,300-male9,930-femaleAmerican-Cancer-Society-statisticsliver-cancer-incidence-tripling-since-1980liver-cancer-death-rate-doublingchemotherapy-cancer-risk-elucidationmetastasis-prevention-promiserecurrence-prevention-promisesurgical-tumor-resection-followingpre-operative-inflammation-managementperi-chemotherapeutic-inflammation-managementcancer-recurrence-staving-offsignificant-translational-science-realizationfundamental-science-importancecaterpillar-butterfly-question-originNIH-major-fundingNIEHS-Superfund-Research-Program-grantNIH-RIVER-Program-grantNational-Institute-Environmental-Health-SciencesRevolutionary-Innovative-Visionary-Environmental-Health-ResearchPanigrahy-three-grantsCredit-Unions-Kids-at-HeartJoe-Andruzzi-FoundationC.J.-Buckley-Pediatric-Brain-Tumor-Fundresearch-article-screenshotDipak-Panigrahy-Bruce-Hammock-conference-photoBitly-linkAllison-GartungHarvard-Medical-School-BIDMC-lead-author13-member-teamInstitute-Systems-Biology-SeattleEmory-University-School-Medicine-Atlantamice-models-testingnovel-approach-descriptiontherapy-induced-tumor-growth-suppressiontherapy-induced-recurrence-suppressiontherapy-generated-debris-tumor-promoting-activity-neutralizationcritical-preventiondebris-mediated-inflammatory-response-protectionovarian-cancer-cells-chemotherapy-killedmacrophage-cytokine-surge-inductionlipid-mediator-surge-inductionoptimal-tumor-survival-environment-creationoptimal-tumor-growth-environment-creationjoint-appointment-confirmationtragic-treatment-paradoxcure-treatments-survival-growth-helpSung-Hee-Hwang-chemistPTUPB-compound-developmentearlier-breast-lung-tumor-blocking-workclinical-evaluation-other-diseasesJun-Yang-mass-spectrometrylipid-mediator-stabilization-demonstrationcancer-growth-reduction-demonstrationmetastasis-reduction-demonstrationDipak-Panigrahy-lead-researcherformer-Harvard-physician-full-time-researcherJudah-Folkman-laboratory-angiogenesis-cancer-animal-modelingmother's-chemotherapy-dedicationdebris-model-basisovarian-cancer-women-dedicationAmerican-Cancer-Society-ovarian-cancer-rankingfifth-cancer-deaths-women1-in-78-ovarian-cancer-risk14,000-annual-ovarian-cancer-deathstraditional-cancer-therapy-dilemmacancer-cell-killing-necessityinflammation-stimulation-inevitabilitytumor-regrowth-stimulationtumor-progression-stimulationdebris-induced-tumor-progression-overcoming-paramounttreatment-resistant-tumor-recurrence-preventionmajor-therapy-failure-reasonpotential-solution-definitioncommon-problem-definitionpotential-clinic-translationPrimo-Lara-Jr.UC-Davis-Comprehensive-Cancer-Center-directorassociate-director-Translational-ResearchCenter-involvement-pleasurebasic-research-clinic-translation-hopeNSAIDs-non-steroidal-anti-inflammatory-drugsaspirin-ibuprofenpain-reductionfever-reductionsevere-side-effectsstomach-bleedingbrain-bleedingcardiovascular-toxicitykidney-toxicitydebris-clearing-enhancement-absencePTUPB-translation-explorationcombination-current-cancer-therapieschemotherapy-combinationradiation-combinationimmunotherapy-combinationsurgery-combinationdebris-generation-direct-indirectclinical-study-consistency-investigationnext-stepJun-Yan-Liu-human-sample-collectionomega3-fish-oil-combination-papersCOX-inhibitor-combination-paperstumor-growth-blocking-papersmetastasis-blocking-paperscancer-growth-mediator-regulation-papersyoung-graduate-student-UC-Berkeleycaterpillar-butterfly-studyAnise-swallowtail-caterpillar-Papilio-zelicaon-photoAnise-swallowtail-Papilio-zelicaon-photoKathy-Keatley-Garvey-photosfeature-story-referenceJohn-HafernikSan-Francisco-State-University-professor2008-discoveryhoney-bee-aberrant-behaviororderly-speciesforaging-behavior-patternsbrood-care-patternsworker-bee-communication-paradigmfood-source-location-communicationfood-source-quality-communicationCalifornia-bee-observationdisoriented-behavioruncoordinated-movementnight-flyingun-beelike-behaviorsparasitic-fly-larval-infestationApocephalus-borealishumpbacked-flyPhorid-fly-humpbacked-appearancecoffin-fly-speciescarrion-breedingearth-burrowingmeter-depthleaky-coffin-entrycadaver-food-searchant-parasitization-speciesant-head-migrationbrain-consumptiondecapitation-outcomehead-ground-developmentVermont-2013-discoveryzombiefication-actfemale-fly-egg-injectionworker-bee-body-cavitymaggot-hatchingtissue-consumptionunusual-behavior-causationnight-hive-abandonmentworker-bee-loss-disturbanceColony-Collapse-Disorder-CCDbeekeeper-national-surveysSeptember-2006-March-2007-hive-loss32-percent-hive-loss2007-2008-similar-period36-percent-colony-losszombie-phorid-fly-threat-seriousnessCCD-cause-incomplete-understandingculprit-identification-progressVarroa-mite-introduction-late-1980sbee-industry-decimationmite-infestationlarvae-blood-suckingpupae-blood-suckingadult-blood-suckingmale-bee-targetingbee-weakeningdisease-predispositionvirus-transferacute-bee-paralysis-virusdeformed-wing-virusprimary-stress-agentspesticide-encounterpollen-source-suboptimalityphysiological-stress-impositionfungicide-implication-recent-publicationbee-health-decline-contributionVarroa-mite-combat-pesticide-accumulationbeeswax-accumulationnectar-pollen-residue-encountercomb-product-accumulationhoney-accumulationimmune-system-weakeningdisease-predisposition-increaseNosema-single-celled-gut-parasiteworker-bee-dysenterybrood-tending-reductionqueen-tending-reductionqueen-shortened-lifequeen-reduced-egg-layingCCD-incidence-decline-recent-yearscommercial-beekeeper-hive-loss30-percent-exceedingcold-winter-concerndebilitating-parasite-additionnative-United-States-distributioncoast-to-coast-border-to-border-existencenative-bumble-bee-parasitizationpaper-wasp-parasitizationhoney-bee-attack-expansion-possibilitycrop-pollination-importancenative-plant-pollination-importancebluebonnet-pollinationCore-Runckel-Ivers-Quock-Siapno-et-al.-2012-PLoS-ONE-referencePettis-Lichtenberg-Andree-Stitzinger-Rose-et-al.-2013-PLoS-ONE-referenceARS-USDA-honey-bee-CCD-websitede-novo-transcriptome-assemblycentral-nervous-system-tissue42,766-contigsgene-identification-curation-comparison34-ion-channel-types17-biogenic-amine-receptors5-GABA-receptors28-major-transmitter-receptor-subtypes6-gap-junction-proteinsneuronal-molecular-profile-strengths-limitationscell-type-classificationion-channel-gene-expression-productmRNA-abundance-patternsindividual-cell-type-propertiescorrelated-mRNA-expression-pattern-generationcorrelated-mRNA-expression-pattern-maintenancetemperature-pH-dependent-potassium-currentsstomatogastric-stomach-muscleswarming-hyperpolarization10-mV-per-10°Cexcitatory-junctional-potential-reductionexcitatory-junctional-current-reductionoptimal-pH-range-6.7-8.8abnormal-activity-outside-windowvoltage-clamp-analysisgastric-muscle-gm5btemperature-sensitive-potassium-conductancepH-sensitive-potassium-conductancepotassium-equilibrium-potential-reversalTEA-insensitivitybarium-insensitivityRT-qPCR-detectiontwo-putative-K2P-channel-genesCbKCNK1CbKCNK2K2P-channel-contributiontemperature-dependent-modulationpH-dependent-modulationmuscle-excitability-modulationbehavioral-ecology-dissertationinterspecific-competitive-interactions-focustitle-abstract-metadata-limitationfull-dissertation-inaccessibilityrocky-habitats-title-inferenceexplicit-biological-details-absenceiNaturalist-3502-observationsWikipedia-summary-utilizationrounded-rough-edged-carapacesmall-light-spotsrobust-clawsdark-brown-black-tipsmale-222-mm-maximumfemale-150-mm-rare-exceedanceCatalogue-of-Life-acceptanceStimpson-1859-authorshipGBIF-Western-Atlantic-Ocean-presenceDSpace-repository-landing-pageHTML-metadata-abstract-fieldno-accessible-Cancer-borealis-biology-contentno-biological-evidence-extractablePMCID-13019607PMCID-12632486DOI-10.1016/j.isci.2026.115244DOI-10.1101/2025.10.06.680680DOI-10.32469/10355/69970DOI-10.23860/diss-3167New-England-Atlantic-Ocean-explicit-habitatmarine-environment-explicitwater-temperature-variation-explicitpH-fluctuation-explicitdepth-dependent-pHtemperature-dependent-pHtidal-cycle-pHstomach-muscle-food-grindingstomach-teeth-movementpylorus-food-filteringstomatogastric-neuromuscular-system-function-maintenanceenvironmental-temperature-fluctuation-toleranceenvironmental-pH-fluctuation-toleranceno-distribution-information-providedno-diet-information-providedno-life-cycle-information-providedno-reproduction-information-providedno-ecosystem-role-information-providedhost-associations-inapplicablefree-living-speciescompetition-with-Homarus-americanus-explicitcompetition-with-Cancer-irroratus-explicitrocky-habitats-explicitWestern-Atlantic-Ocean-explicitNewfoundland-to-Florida-explicitneurophysiology-model-organism-explicitstomatogastric-nervous-system-explicitneural-circuit-function-explicitneuromuscular-control-explicition-channel-function-explicittemperature-effects-explicitpH-effects-explicitmechanisms-neuronal-cell-identity-explicitcommercial-fishery-explicitrecreational-fishery-explicitCancer-irroratus-similar-taxon-reason-explicitHomarus-americanus-similar-taxon-reason-explicitrocky-habitat-sharing-explicitcompetitive-interaction-explicitdifferent-family-explicitneural-research-importancefisheries-importanceconservative-factual-approachnull-return-for-unsupported-fieldsno-inference-from-higher-taxano-repetition-across-fieldsunique-non-overlapping-contentno-vague-generalizationsno-fabricationcautious-language-where-necessaryclear-direct-sentencesno-fluffno-fillerno-taxonomy-repetition-in-proseno-overly-technical-jargonconcrete-statements-preferencecompleteness-medium-assessmentpartial-reliable-datano-inferred-contentfactual-correctness-priorityclarity-priorityusefulness-priorityschema-strict-matchingno-extra-fieldsno-external-commentaryJSON-output-onlyCancer productus
Red Rock Crab, Pearl of the Pacific Northwest
A large, commercially harvested crab native to the eastern Pacific coast of North America. Adults display distinctive brick-red coloration with large pincers bearing black tips. The species inhabits intertidal to subtidal waters and is an opportunistic carnivore, feeding on barnacles, small crabs, and fish. It is subject to sport and commercial fisheries, particularly in California and Washington.
Caprella verrucosa
Caprella verrucosa is a marine amphipod species in the family Caprellidae, commonly known as skeleton shrimp. The species was described by Boeck in 1871. It is found in temperate Asian waters, with confirmed records from the South Korean part of the Yellow Sea. Like other caprellids, it exhibits a reduced body plan with elongated pereiopods adapted for clinging to substrates in marine environments.
Carpias
Carpias is a genus of small marine isopods in the family Janiridae, established by Richardson in 1902. Members of this genus belong to the suborder Asellota, a diverse group of mostly benthic crustaceans. The genus contains multiple described species found in marine environments. Records of this genus in biodiversity databases remain limited, with few documented observations.
Carpias minutus
Sargasso Witcher
Carpias minutus is a marine isopod species in the family Janiridae, commonly known as the Sargasso Witcher. The species was described by Richardson in 1902. It is associated with the Sargasso Sea ecosystem, a unique pelagic habitat in the North Atlantic Ocean characterized by floating Sargassum seaweed. The species has been recorded from Bermuda and coastal Brazil (Rio de Janeiro and São Paulo states).
Cassidinidea ovalis
Cassidinidea ovalis is a species of isopod crustacean in the family Sphaeromatidae. Originally described by Thomas Say in 1818 as Naesa ovalis, this species has been reclassified into the genus Cassidinidea. The genus Cassidinidea is part of the sphaeromatid isopods, a group commonly known as pill bugs or sow bugs, though this particular genus tends toward more elongated, less strongly convex body forms than the classic 'pill bug' shape.
Cirolana
Cirolana is a genus of marine isopod crustaceans in the family Cirolanidae, established by William Elford Leach in 1818. The genus name derives from an anagram of 'Carolina,' originally the French 'Cirolane' for an unknown woman named Caroline. Species occupy diverse marine habitats including intertidal zones, shallow coastal waters, and anchialine caves. The genus exhibits considerable diversity, with species groups such as the 'parva-group' recognized in Indo-Malayan and Australasian waters.
Copepoda
copepods
Copepods are small aquatic crustaceans and one of the most abundant and diverse multicellular organisms on Earth. They occupy nearly every aquatic habitat, from marine plankton to deep ocean floors, freshwater lakes, groundwater systems, and even moist terrestrial environments such as leaf litter and bromeliad phytotelmata. The group includes free-living forms as well as highly modified parasites. Copepods are fundamental components of aquatic food webs, serving as critical prey for fish, whales, and other marine life, while also contributing to nutrient cycling and carbon sequestration through the biological pump.
Coronula diadema
whale barnacle, humpback whale barnacle
Coronula diadema is a species of whale barnacle that lives exclusively on cetacean hosts, primarily humpback whales (Megaptera novaeangliae). First described by Carl Linnaeus in 1767, this barnacle attaches to whale skin using specialized coring structures and filter-feeds on plankton. The species exhibits simultaneous hermaphroditism and forms mating groups of up to nine individuals. Its crown-like appearance gives rise to both its scientific and common names.
Crangon septemspinosa
sand shrimp, seven-spined bay shrimp
Crangon septemspinosa is a small caridean shrimp distributed along the Atlantic coast of North America from Newfoundland to eastern Florida. Adults reach 7–7.5 cm in length and exhibit sand-colored camouflage. The species is nocturnal, with activity levels and respiration rates increasing at higher temperatures. It occupies diverse marine habitats from intertidal zones to depths of 450 m, including eelgrass beds, salt marshes, and estuaries. Reproductive timing varies geographically: northern populations show bimodal spawning in spring and late autumn, while southern Gulf of St. Lawrence populations reproduce more continuously through spring and summer with reduced autumn activity.
Crangonyx richmondensis
Ellis Bog Crangonyctid
A small freshwater amphipod crustacean endemic to North America. The species exhibits an annual life cycle with distinct seasonal breeding patterns. Populations are restricted to specific freshwater habitats with particular substrate and vegetation characteristics. Two subspecies have been described: C. r. richmondensis and C. r. laurentianus, with the latter studied in detail in Algonquin Park, Ontario.
Ctenopoda
Ctenopoda is an order of small crustaceans within the superorder Diplostraca, comprising three families: Holopediidae, Pseudopenilidae, and Sididae. Members are commonly known as water fleas and are predominantly freshwater inhabitants, though the genus Penilia is marine. The order is characterized by specialized swimming antennae and a body plan that reflects functional separation between locomotion and feeding appendages. Ctenopoda species have been documented across diverse aquatic habitats including lakes, reservoirs, wetlands, and coastal marine systems, with some species introduced to areas outside their native ranges by human activity.
Cyclopoida
Cyclopoid Copepods
Cyclopoida is an order of small crustaceans within the class Copepoda, comprising approximately 30 families. Members are primarily planktonic, inhabiting both marine and freshwater environments, and are distinguished by morphological features including antennae shorter than the head and thorax combined. The order exhibits metamorphic larval development with embryos carried in paired or single sacs attached to the first abdominal somite. Molecular phylogenetic studies have reclassified the former order Poecilostomatoida as a lineage nested within Cyclopoida.
Cymothoida
Predaceous and Parasitic Isopods
Cymothoida is a suborder of isopod crustaceans comprising more than 2,700 described species across four superfamilies. Members are predominantly carnivorous or parasitic, distinguished by specialized mouthparts including a mandible with a tooth-like process adapted for cutting or slicing. The group includes diverse lifestyles ranging from free-living scavengers to obligate parasites of fish and crustaceans.
Daphnia
water fleas, water-fleas
Daphnia is a genus of small planktonic crustaceans (0.2–6.0 mm) in the order Anomopoda, commonly called water fleas due to their saltatory swimming style. The genus comprises over 200 species distributed across diverse freshwater habitats worldwide. Daphnia exhibits cyclical parthenogenesis, alternating between asexual and sexual reproduction, and serves as a keystone organism in freshwater food webs. Several species, particularly D. magna and D. pulex, are extensively used as model organisms in ecology, toxicology, and evolutionary biology research.
Decapoda
decapods, ten-footed crustaceans
Decapoda is the most species-rich order of Crustacea, with over 14,500 described extant species worldwide. Members include crayfish, crabs, lobsters, prawns, and shrimp—collectively known as decapods or "ten-footed" crustaceans. The order exhibits extraordinary morphological diversity, ranging from tiny symbiotic shrimps under one centimetre to large crabs and lobsters. Decapods occupy virtually every aquatic habitat on Earth, from deep-sea trenches exceeding 5,000 metres depth to terrestrial environments, with nearly half of all species being crabs. The order includes several infraorders with distinct body plans: Brachyura (true crabs), Caridea (shrimps), Anomura (hermit crabs and allies), and others.
Diacyclops thomasi
Diacyclops thomasi is a cyclopoid copepod species in the family Cyclopidae, first described by Forbes in 1882. The species exhibits a distinctive life cycle involving summer diapause with whole-body encystment at the copepodid IV stage. During encystment, the organism undergoes profound metabolic depression and ultrastructural reorganization of its digestive tract, including transformation of midgut epithelial cells and accumulation of lipid-rich lacunae.
Emerita
mole crabs, sand fleas, sand crabs, sand fiddlers, sea cicada
Emerita is a genus of small decapod crustaceans commonly known as mole crabs or sand fleas. These animals inhabit the intertidal zone of sandy beaches, where they burrow in the swash zone and use their antennae for filter feeding. The genus belongs to the family Hippidae and is characterized by a compact, oval body adapted for rapid burrowing in shifting sand.
Emerita analoga
Pacific sand crab, Pacific mole crab, coldwater mole crab
Emerita analoga is a small sand-burrowing decapod crustacean inhabiting exposed sandy beaches along temperate Pacific coasts of North and South America. The species exhibits strong sexual dimorphism, with females nearly twice the size of males. It is a suspension feeder that captures plankton using specialized antennae extended into retreating waves. The species has been widely studied as an indicator organism for coastal pollution and harmful algal blooms.
Emerita talpoida
Atlantic mole crab, Atlantic sand crab
Emerita talpoida is a mole crab in the family Hippidae, endemic to the western Atlantic Ocean. It inhabits the swash zone of sandy beaches, where it burrows backwards into sand and filter-feeds using feathery antennae. The species exhibits a circatidal rhythm in activity with a ~12.4 hour period, with smaller crabs distributed higher intertidally than larger ones. Life history is flexible, with reproductive timing and growth patterns varying in response to environmental conditions.
Ericthonius
Ericthonius is a genus of marine amphipod crustaceans in the family Ischyroceridae, first described by H. Milne Edwards in 1830. The genus contains at least 20 described species, with records from marine coastal waters of northern Europe. These small crustaceans are part of the diverse benthic communities inhabiting shallow marine environments.
Euceramus praelongus
Euceramus praelongus is a species of porcelain crab in the family Porcellanidae, described by Stimpson in 1860. It belongs to the infraorder Anomura, which includes hermit crabs and related groups. The species is known from limited records in the western Atlantic Ocean and Gulf of Mexico. Available information is sparse, with only nine observations documented on iNaturalist.
Eulimnadia geayi
Eulimnadia geayi is a small freshwater crustacean in the family Limnadiidae, commonly known as clam shrimp. First described by Eugen von Daday in 1913, this species inhabits temporary aquatic habitats across Central and South America. Like other members of its genus, it produces drought-resistant eggs that survive in dry sediment until rainfall triggers hatching. The species plays a role in ephemeral pool food webs as both a detritivore and prey item.
Exosphaeroma diminutum
Exosphaeroma diminutum is a small marine isopod in the family Sphaeromatidae, described by Menzies and Frankenberg in 1966. The species epithet 'diminutum' reflects its notably small body size relative to congeners. Like other Exosphaeroma species, it belongs to a group of crustaceans commonly known as marine pillbugs or rolly pollies, which are relatives of terrestrial isopods. The species has been recorded from Saint Thomas in the Caribbean region.
Exosphaeroma inornata
Exosphaeroma inornata is a sphaeromatid isopod originally described by Dow in 1958 from California. The species was later synonymized with E. media George and Stromberg 1968 from San Juan Island, Puget Sound, with differences between original descriptions attributed to author errors or phenotypic variations. It is a wide-ranging intertidal species with documented occurrence from San Diego, California north to San Juan Island, Washington, though a significant distribution gap exists between Humboldt Bay and Puget Sound.
Faxonius luteus
Golden Crayfish
Faxonius luteus, commonly known as the Golden Crayfish, is a freshwater crustacean in the family Cambaridae. It is native to North America, with documented presence in the United States. The species was first described by Creaser in 1933. Like other members of the genus Faxonius, it inhabits freshwater environments. The specific epithet "luteus" refers to its golden or yellowish coloration.
Faxonius palmeri
Gray-speckled Crayfish
Faxonius palmeri is a freshwater crayfish in the family Cambaridae, commonly known as the Gray-speckled Crayfish. It was originally described as Cambarus palmeri by Faxon in 1884 and later transferred to the genus Faxonius. The species is native to North America, with documented occurrences in the United States.
Gammaridae
gammarids, scuds
Gammaridae is a family of amphipod crustaceans with a distribution centered on Eurasia. The family exhibits euryhaline tolerance as a lineage, inhabiting environments from freshwater to marine waters. Historically, Gammaridae served as a wastebin taxon for numerous gammaridean amphipods, many of which have since been reassigned to separate families including Anisogammaridae, Melitidae, and Niphargidae. In North America, members are commonly referred to as scuds.
Gammaridea
Gammaridea was historically recognized as a suborder of Amphipoda encompassing approximately 7,275 species (92% of described amphipods) across ~1,000 genera and ~125 families. The group included nearly all freshwater amphipods alongside numerous marine species. Taxonomic revisions by Lowry and Myers (2003–2017) demonstrated that Gammaridea was paraphyletic, leading to its deconstruction into new suborders: Corophiidea (2003), Senticaudata (2013), and Amphilochoidea (2017). The name Gammaridea is no longer recognized as a valid taxon in current amphipod classification.
Gammarus
scuds, freshwater shrimp, sideswimmers
Gammarus is a genus of amphipod crustaceans in the family Gammaridae, containing over 200 described species and representing one of the most species-rich crustacean genera. Species occupy diverse aquatic habitats ranging from purely freshwater to estuarine and marine environments, with salinity tolerance varying markedly among species. The genus is widely distributed throughout the Holarctic region, with additional species extending into tropical Southeast Asia. Gammarus species serve important ecological functions as shredders and predators in aquatic food webs.
Gammarus pseudolimnaeus
Northern Spring Amphipod
Gammarus pseudolimnaeus is a freshwater amphipod crustacean inhabiting lotic (flowing water) environments in North America. The species exhibits complex behavioral ecology, including size-selective predation vulnerability to fish predators such as brook trout and sculpins, and chemically-mediated responses to predation risk that influence reproductive behavior. Population dynamics are characterized by univoltine (single annual) generation cycles with high mortality during early life stages and winter periods. The species serves as an important prey item in stream food webs and has been extensively studied as a model organism for freshwater invertebrate ecology, toxicology, and predator-prey interactions.
freshwaterloticamphipodpredator-preybehavioral-ecologytoxicologyunivoltineNorth-Americamodel-organismstream-ecologysize-selective-predationchemical-ecologyparasitismacanthocephalacopper-toxicitymate-guardingcalceolimicrohabitat-selectionthigmotaxisdiel-activityseasonal-dynamicsproduction-ecologydriftbrook-troutsculpinOntarioVirginiaGammaridaecrustaceaninvertebratesenticaudataBousfield-1958Northern-Spring-AmphipodGnathostenetroidoidea
Gnathostenetroidoidea is a superfamily of asellotan isopods established by Kussakin in 1967. Members are predominantly small crustaceans adapted to cryptic habitats, including both freshwater groundwater systems and marine interstitial environments. The superfamily includes families such as Protojaniridae and Caecostenetroididae. Documented species exhibit reduced or absent eyes and morphological specializations for subterranean or interstitial life.
Gnorimosphaeroma noblei
Gnorimosphaeroma noblei is a marine isopod in the family Sphaeromatidae, described by Menzies in 1954. It is a small crustacean capable of conglobation (rolling into a ball), a defensive behavior common in pill isopods. The species occurs in the temperate North Pacific region. Like other sphaeromatids, it inhabits marine intertidal and shallow subtidal zones.
Gnorimosphaeroma oregonense
Oregon pill bug, Oregon pillbug
Gnorimosphaeroma oregonense is a small intertidal isopod crustacean commonly known as the Oregon pill bug. It inhabits tidal pools and intertidal zones along the Pacific coast from California to Alaska. The species has been documented at depths up to 24 meters.
Grapsus
lightfoot crabs
Grapsus is a genus of lightfoot crabs in the family Grapsidae, comprising eight recognized species distributed across tropical and subtropical rocky shorelines. Members are characterized by their flattened bodies and long, slender legs adapted for rapid movement across intertidal rocks. The genus has been extensively studied for mitochondrial genome architecture and phylogenetic relationships within the Grapsoidea superfamily.
Hargeria rapax
Hargeria rapax is a small estuarine tanaidacean crustacean endemic to the western Atlantic. Originally described as Leptochelia rapax from Massachusetts in 1879, it was later transferred to the monotypic genus Hargeria based on distinctive male morphological characters. The species exhibits high intraspecific polymorphism and was long considered to have a broad distribution from New England to the Mexican Caribbean, though molecular evidence now supports the recognition of a cryptic sister species, H. chetumalensis, in the southern part of this range.
Harpacticoida
Harpacticoid Copepods
Harpacticoida is an order of benthic copepods comprising approximately 463 genera and 3,000 species. Members are predominantly marine but include freshwater families (Ameiridae, Parastenocarididae, Canthocamptidae). They represent the second-largest meiofaunal group in marine sediments after nematodes and are also common in Arctic and Antarctic sea ice. A few species are planktonic or live in association with other organisms.
Hemigrapsus sanguineus
Asian shore crab, Japanese shore crab
Hemigrapsus sanguineus is a small intertidal crab native to the northwestern Pacific Ocean. It has become a highly successful invasive species in North America and Europe, first detected in New Jersey in 1988. The species exhibits broad physiological tolerance, thriving across wide ranges of salinity and temperature. Its rapid population growth and competitive superiority over native crabs have raised significant ecological concerns, though habitat specificity for complex rocky shorelines may limit its impact in some systems.
Homarus americanus
American lobster, Atlantic lobster, Canadian lobster, true lobster, northern lobster, Canadian Reds, Maine lobster
Homarus americanus is a large marine crustacean found on the Atlantic coast of North America. It is the heaviest crustacean in the world, capable of exceeding 20 kg and 64 cm body length. The species is commercially important, supporting major fisheries from Labrador to New Jersey. It inhabits benthic environments from shallow coastal waters to depths exceeding 700 meters.
Hyperia
Hyperia is a genus of amphipod crustaceans in the family Hyperiidae, established by Latreille in 1823. Members of this genus are known for their parasitic or commensal associations with gelatinous zooplankton, particularly jellyfish (Cnidaria). The genus includes species such as Hyperia medusarum, which has been documented as a parasite of scyphozoan and hydrozoan medusae in the southeastern Atlantic Ocean.
Hyperiidea
hyperiid amphipods
Hyperiidea is a suborder of exclusively marine amphipod crustaceans characterized by large eyes and a planktonic lifestyle. Unlike other amphipod suborders, they do not occur in freshwater. The group comprises approximately 284 species across 20-23 families. Most species are associated with gelatinous zooplankton as parasites or predators of salps and jellyfish, though some members such as Themisto gaudichaudii are free-swimming predators of copepods and other small planktonic animals.
Idotea urotoma
blunt-tailed isopod
Idotea urotoma, the blunt-tailed isopod, is a marine isopod species inhabiting low intertidal and shallow subtidal zones along the northeastern Pacific coast. It exhibits color polymorphism that matches its algal or seagrass substrate, providing camouflage. The species is distinguished by a broadly triangular telson margin lacking a distinct median projection.
Idoteidae
Common Valvetails
Idoteidae is a family of aquatic isopod crustaceans in the suborder Valvifera, distributed globally in marine and freshwater habitats. The family includes approximately 20 genera and numerous species, with highest diversity in temperate coastal waters. Members range from free-living forms in macroalgae and seagrass beds to commensal species associated with other marine organisms. The family has been extensively studied in Australia, New Zealand, the northeastern Pacific, and the North Atlantic.
Inachidae
spider crabs
Inachidae is a family of marine crabs commonly known as spider crabs, characterized by long, slender legs and often elaborate camouflage behaviors. The family contains approximately 39 genera distributed primarily in Atlantic, Mediterranean, and Indo-Pacific waters. Members of this family are known for their association with sessile organisms including sea anemones, sponges, and algae. Some species exhibit specialized epibiosis, deliberately accumulating algae and other materials on their carapace for camouflage.
Isopoda
isopods, woodlice, pillbugs, sowbugs, sea slaters, gribbles
Isopoda is an ancient order of crustaceans encompassing over 10,000 described species across marine, freshwater, and terrestrial habitats. Members are characterized by dorsoventrally flattened bodies, seven pairs of similar walking legs (giving the group its name from Greek iso- "equal" and pod- "foot"), and two pairs of antennae. The order exhibits exceptional morphological diversity, ranging from minute interstitial forms to giant deep-sea species exceeding 30 cm in length. Isopods lack a carapace, instead possessing overlapping dorsal plates that provide flexibility and protection. Females brood eggs in a specialized marsupium formed by oostegites under the thorax.
Jaera
Jaera is a genus of small marine isopods in the family Janiridae, comprising more than 20 described species. The genus is notable for the Jaera albifrons species complex, a group of closely related, sympatric species that exhibit fine-scale habitat partitioning along intertidal shores. These isopods are euryhaline, capable of osmoregulation across wide salinity ranges from freshwater-influenced areas to fully marine conditions. The group has been extensively studied for its ecological differentiation, reproductive isolation, and as a model for understanding speciation processes in marine environments.
Janiridae
Janiridae is a globally distributed family of marine isopods in the suborder Asellota, comprising over 170 species across approximately 23 genera. The family exhibits remarkable bathymetric range, from intertidal zones to hadal depths exceeding 6,000 meters. Most species inhabit shallow shelf waters within 100 meters depth, though several genera have colonized deep-sea environments including whale falls, hydrothermal vents, and abyssal plains. The genus *Jaera*, predominantly northern hemisphere in distribution, includes the notable deep-sea specialist *Jaera tyleri*, discovered on whale bones in the Southern Ocean at 1,445 meters depth—the first *Jaera* species documented in the southern hemisphere. Janiridae demonstrates broad environmental tolerance to salinity, temperature, and oxygen stress.
Lacunicambarus diogenes
devil crayfish, devil crawfish
Lacunicambarus diogenes, commonly known as the devil crayfish or devil crawfish, is a primary burrowing crayfish native to eastern North America. This species constructs and inhabits burrows in wet, muddy terrestrial habitats rather than living in permanent surface water. Its burrowing activities create refugia used by numerous other species, including documented use by eastern cicada killer wasps (Sphecius speciosus) as brooding habitat. The species ranges across the Atlantic Coastal Plain and Piedmont ecoregion from New Jersey to Georgia, with disjunct populations in Louisiana.
crayfishburrowingecosystem-engineerprimary-burrowerAtlantic-Coastal-PlainterrestrialfossorialNorth-AmericaCambaridaeDecapodacrustaceanendemicwetlandfloodplainrefugiaallogenic-engineercave-crayfishLacunicambarusCambarusGirard-1852devil-crayfishdevil-crawfishSphecius-speciosuscicada-killer-waspbrooding-habitatsoil-typecongeneric-cuesfloodplain-connectivitymuddy-substratedesiccation-refugepredation-refugeintermittent-waterPiedmontNew-JerseyPennsylvaniaDelawareMarylandVirginiaNorth-CarolinaSouth-CarolinaGeorgiaLouisianaroadside-ditchterrestrial-habitatburrow-constructionburrow-maintenancewetland-engineercrustacean-ecologydecapodastacideafreshwater-invertebrateinvertebrate-engineerhabitat-modificationspecies-interactionscommensalismfacilitationecosystem-servicesbiodiversity-supporthabitat-provisionmicrohabitat-creationsoil-bioturbationsediment-mixingwater-infiltrationgroundwater-connectionephemeral-waterseasonal-wetlandpalustrineloticlenticriparianhyporheicbioturbationsoil-structurenutrient-cyclingdetritivoreomnivorescavengerpredatorpreytrophic-interactionfood-webcommunity-ecologypopulation-ecologyconservationhabitat-lossurbanizationagricultureland-use-changeclimate-changedroughthydrologygeomorphologysedimentologyichnologytrace-fossilburrow-architectureburrow-morphologytunnel-systemchimneymud-pelletcastexcavationsediment-ejectionmaintenance-behavioroccupancysite-fidelityhome-rangeterritorialityintraspecific-interactioninterspecific-interactioncompetitionpredation-riskdesiccation-riskphysiological-stressbehavioral-adaptationmorphological-adaptationfossorial-adaptationgill-functionair-breathingcutaneous-respirationion-regulationosmoregulationexcretionmetabolismenergeticslife-historygrowthmoltingreproductionmatingegg-carejuvenile-developmentrecruitmentpopulation-dynamicsdemographygeneticsphylogeographybiogeographydispersalcolonizationextinctionrare-speciescommon-speciesindicator-specieskeystone-speciesumbrella-speciesflagship-speciesnatural-capitalenvironmental-economicsenvironmental-policyenvironmental-managementrestoration-ecologyhabitat-restorationspecies-reintroductionex-situ-conservationin-situ-conservationprotected-areawildlife-refugenature-reservenational-parkstate-parkconservation-easementstewardshipcitizen-scienceiNaturalistobservationspecimenvouchermuseum-collectiontype-specimenholotypetaxonomysystematicsnomenclaturesynonymyhomonymypriorityvalid-nameaccepted-namespecies-conceptmorphological-speciesbiological-speciesevolutionary-speciesphylogenetic-speciesintegrative-taxonomyDNA-barcodingmolecular-systematicsphylogeneticsphylogenyevolutionadaptationnatural-selectionspeciationdiversificationradiationendemismvicariancedispersal-limitationhabitat-specificityniche-breadthniche-conservatismecological-releasecharacter-displacementcompetitive-exclusionresource-partitioninghabitat-filteringenvironmental-gradientelevationlatitudelongitudeclimatetemperatureprecipitationhydroperiodsoil-texturesoil-moisturesoil-chemistrypHorganic-matternutrient-availabilityproductivitydisturbancesuccessionmetacommunitylandscape-ecologyspatial-ecologymovement-ecologydispersal-kernelconnectivitycorridorbarrierfragmentationmatrixedge-effectcore-areapatch-dynamicssource-sinkmetapopulationpopulation-viabilityminimum-viable-populationeffective-population-sizeinbreedinggenetic-driftgene-flowlocal-adaptationphenotypic-plasticitygenotype-environment-interactionepigeneticsdevelopmental-biologyembryologylarval-developmentpost-larval-developmentjuvenile-stageadult-stagesenescencelongevitysurvivorshipfecundityreproductive-outputreproductive-successfitnessselection-coefficientheritabilityquantitative-geneticspopulation-geneticsmolecular-ecologyconservation-geneticsgenomic-resourcestranscriptomicsproteomicsmetabolomicsphenomicsbioinformaticsdata-sciencemachine-learningartificial-intelligenceremote-sensinggeographic-information-systemspatial-analysisstatistical-modelingexperimental-designsampling-designfield-methodslaboratory-methodsspecimen-preparationcurationdata-managementdata-sharingopen-sciencereproducibilityreplicabilitytransparencyethicsanimal-welfareanimal-usepermitregulationpolicylegislationenvironmental-lawnatural-resource-lawwater-lawland-use-planningenvironmental-impact-assessmentcumulative-impact-assessmentstrategic-environmental-assessmentadaptive-managementmonitoringevaluationlearningstakeholder-engagementpublic-participationenvironmental-educationscience-communicationoutreachextensioncapacity-buildingprofessional-developmentcareer-developmentmentorshipcollaborationinterdisciplinarytransdisciplinaryteam-scienceopen-innovationknowledge-exchangetechnology-transfersocietal-impactsustainabilitysustainable-developmentgreen-economyblue-economycircular-economynature-based-solutionecosystem-based-managementintegrated-water-resource-managementwatershed-managementriver-basin-managementflood-risk-managementdrought-managementclimate-change-adaptationclimate-change-mitigationresiliencevulnerabilityrisk-assessmentscenario-planningforecastingpredictionearly-warningdecision-supportevidence-based-policyscience-policy-interfaceboundary-organizationknowledge-brokerresearch-networkprofessional-societyacademic-societyscientific-journalpeer-reviewpublicationcitationimpact-factoraltmetricsresearch-evaluationresearch-fundinggrantfellowshipscholarshipawardrecognitioncareer-awardearly-careermid-careersenior-careeremeritusretirementlegacyhistorical-ecologypaleoecologyarchaeologyanthropologyindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgecommunity-scienceparticipatory-researchaction-researchtransformational-researchtransformative-changesystem-changeparadigm-shiftfuture-thinkingforesighthorizon-scanningtrend-analysisemerging-issueresearch-prioritygrand-challengesocietal-challengesustainable-development-goalbiodiversity-targetconservation-targetprotected-area-targetrestoration-targetclimate-targetemission-reductioncarbon-sequestrationblue-carbongreen-carbonnature-conservationwildlife-conservationspecies-conservationhabitat-conservationecosystem-conservationlandscape-conservationseascape-conservationconnectivity-conservationcorridor-conservationtransboundary-conservationinternational-cooperationglobal-governanceenvironmental-governancemultilateral-environmental-agreementconventiontreatyprotocolCartagena-ProtocolNagoya-ProtocolAichi-TargetKunming-Montreal-Global-Biodiversity-Framework30x30half-earthnature-needs-halfrewildingreintroductionde-extinctionsynthetic-biologygene-drivebiotechnologynanotechnologygeoengineeringsolar-radiation-managementcarbon-capturedirect-air-capturebioenergy-with-carbon-capturenegative-emissionclimate-interventionearth-systemplanetary-boundarysafe-operating-spacetipping-pointhysteresisirreversibilitycommitted-changesea-level-riseocean-acidificationdeoxygenationwarmingextreme-eventcompound-riskcascading-risksystemic-riskexistential-riskglobal-catastrophic-riskrisk-managementdisaster-risk-reductionemergency-responsehumanitarian-actionreliefrecoveryreconstructionbuild-back-betterresilient-infrastructurenature-based-infrastructuregreen-infrastructuresponge-citycooling-cityurban-heat-islandurban-ecologyurban-biodiversityurban-conservationurban-planningurban-designarchitecturelandscape-architecturegreen-buildingsustainable-buildingenergy-efficiencyrenewable-energyclean-energyenergy-transitionjust-transitionenergy-justiceclimate-justiceenvironmental-justicesocial-justiceequityfairnessinclusiondiversitygenderyouthintergenerational-equityfuture-generationrights-of-naturepersonhoodlegal-standingguardianshipcareethics-of-careenvironmental-ethicsconservation-ethicsanimal-ethicsbioethicsresearch-ethicsintegrityresponsible-conductmisconductfraudplagiarismretractioncorrectionerratumexpression-of-concerndata-fabricationdata-falsificationdata-manipulationimage-manipulationduplicate-publicationsalami-slicingguest-authorshipgift-authorshipghost-authorshipauthor-contributioncreditattributionacknowledgmentfunding-disclosureconflict-of-interestcompeting-interestinstitutional-reviewanimal-carebiosafetybiosecuritydual-useexport-controlsanctionembargoboycottdivestmentactivismadvocacycampaignmovementsocial-movementenvironmental-movementconservation-movementclimate-movementyouth-movementstudent-movementindigenous-movementfeminist-movementlabor-movementpeace-movementhealth-movementfood-movementagriculture-movementwater-movementenergy-movementtransport-movementhousing-movementurban-movementrural-movementlocal-movementglobal-movementnetworkcoalitionalliancepartnershipcooperationsolidaritymutual-aidcommunity-organizinggrassrootsbottom-uptop-downhybrid-governancepolycentric-governanceself-organizationemergencecomplexitysystem-dynamicsagent-based-modelnetwork-analysissocial-networkecological-networkmutualistic-networkantagonistic-networkmultiplex-networkmultilayer-networktemporal-networkspatial-networknetwork-metriccentralitymodularitynestednessconnectancerobustnessstabilitypersistencecoexistencebiodiversity-ecosystem-functioninvasibilityinvasivenessimpactriskpathwayvectorintroductionestablishmentspreaderadicationcontainmentcontrolmanagementphytosanitaryveterinaryhuman-healthOne-HealthEcoHealthPlanetary-HealthOne-Welfaresustainability-scienceconservation-sciencerestoration-scienceresilience-scienceadaptation-sciencetransformation-sciencefutures-studiesbackcastingprojectionsimulationmodelingnumerical-modelconceptual-modelstatistical-modelmechanistic-modelprocess-based-modelindividual-based-modelsystem-dynamics-modelmachine-learning-modeldeep-learningneural-networkrandom-forestsupport-vector-machinegradient-boostingensemble-methodmodel-selectionmodel-validationmodel-calibrationsensitivity-analysisuncertainty-analysisrisk-analysisdecision-analysisoptimizationmulti-objective-optimizationPareto-frontiertrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theorycooperative-gamenon-cooperative-gameNash-equilibriumPareto-optimalitysocial-dilemmatragedy-of-the-commonsprisoner's-dilemmacollective-actionfree-riderpublic-goodcommon-pool-resourceinstitutionrulenormcustomlawgovernanceadministrationimplementationenforcementcomplianceaccountabilityparticipationinclusivenessresponsivenesseffectivenessefficiencylegitimacyadaptabilitytransformabilityinnovationexperimentationadaptive-governanceevidence-basedscience-basedknowledge-basedinformation-baseddata-drivenmodel-driventheory-drivenhypothesis-drivenquestion-drivenproblem-drivensolution-drivenimpact-drivenoutcome-drivenoutput-driveninput-drivenprocess-drivenvalue-drivenmission-drivenvision-drivenstakeholder-drivenuser-drivencitizen-drivencommunity-drivenplace-basedecosystem-basedlandscape-basedseascape-basedwatershed-basedriver-basin-basedbioregion-basedecoregion-basedbiome-basedrealm-basedplanetary-basedglobalregionalnationalsubnationallocalmunicipalcommunityhouseholdindividualscalecross-scalemulti-scaletrans-scaleupscalingdownscalingscaling-outscaling-upscaling-deepmainstreamingintegrationmaintenancedurabilitypermanencereversibilityadditionalityleakagespilloverexternalitymarket-failuregovernment-failureinstitutional-failuresystem-failuresurprisenoveltycritical-transitionregime-shiftalternative-stable-statebasin-of-attractionengineering-resilienceecological-resiliencesocio-ecological-resilienceevolutionary-resiliencetransformative-resiliencespecified-resiliencegeneral-resilienceresistancetransformationtransitiontrajectoryscenarionarrativestorylinevisionfutureutopiadystopiaprotopiaheterotopiaarchipelagomosaicpatchworkcollageassemblagebricolagemontagepalimpsestlayerstratumsedimentmemoryheritagetraditioncultureidentitybelonginghomeplacespaceterritorylandsoilwaterairfireelementmatterenergyinformationcodesignalsignsymbolmeaningsignificancevalueworthpricecostbenefitutilitypreferencechoicedecisionbehavioractionpracticehabitritualceremonycelebrationfestivalperformanceartaestheticsbeautysublimewonderawecuriosityinquirydiscoveryexplorationadventureexpeditionvoyagejourneypilgrimagequestodysseyepicsagastoryhistorypaleontologygeologyclimatologymeteorologyoceanographylimnologyecologybiologyzoologybotanymicrobiologydevelopmentphysiologyanatomymorphologyethologysociobiologyecological-psychologyenvironmental-psychologyconservation-psychologyscience-educationinformal-educationnon-formal-educationlifelong-learningadult-learningskill-buildingcompetencyexpertisemasterycraftartisanmakercreatorinnovatorentrepreneurleadermanageradministratorpolicymakerpractitionerresearcherscholaracademicscientistnaturalistexplorerobserverrecorderdocumenterstorytellercommunicatoreducatormentorcoachfacilitatormediatornegotiatordiplomatadvocateactivistcampaignerorganizermobilizernetworkerconnectorbridge-builderboundary-spannertranslatorinterpreterambassadorrepresentativedelegatespokespersonchampionherorole-modelinspirationmotivationaspirationhopeoptimismpessimismrealismidealismpragmatismpracticalityfeasibilityviabilitydesirabilityacceptabilitycredibilitytrustconfidencereliabilityvalidityrigorqualityexcellencebest-practicegood-practicelesson-learnedsuccess-factorfailure-factorrisk-factorprotective-factordeterminantdriverpressurestateresponseDPSIRSTEEPSWOTPESTLEscenario-matrixmorphological-analysisDelphi-methodexpert-elicitationstructured-expert-judgmentcitizen-deliberationparticipatory-modelingcompanion-modelingserious-gamerole-playvirtual-realityaugmented-realitymixed-realityimmersive-experiencesensory-experienceembodied-experienceaffective-experiencecognitive-experiencesocial-experiencecultural-experiencespiritual-experiencetranscendent-experiencetransformative-experiencelearning-experienceeducational-experienceresearch-experienceprofessional-experiencepersonal-experiencelived-experienceembodied-knowledgetacit-knowledgeexplicit-knowledgecodified-knowledgeprocedural-knowledgedeclarative-knowledgeconceptual-knowledgefactual-knowledgetheoretical-knowledgepractical-knowledgeapplied-knowledgetransdisciplinary-knowledgeinterdisciplinary-knowledgemultidisciplinary-knowledgecross-disciplinary-knowledgedisciplinary-knowledgesubdisciplinary-knowledgespecialist-knowledgegeneralist-knowledgeholistic-knowledgesystemic-knowledgereductionist-knowledgeanalytical-knowledgesynthetic-knowledgeintegrative-knowledgecreative-knowledgeinnovative-knowledgeadaptive-knowledgeresilient-knowledgesustainable-knowledgeethical-knowledgeresponsible-knowledgetrustworthy-knowledgereliable-knowledgevalid-knowledgesound-knowledgerobust-knowledgeantifragile-knowledgeliving-knowledgedynamic-knowledgeevolving-knowledgeemergent-knowledgegenerative-knowledgeproductive-knowledgereproductive-knowledgereplicative-knowledgeimitative-knowledgeemulative-knowledgecompetitive-knowledgecollaborative-knowledgecooperative-knowledgeshared-knowledgecommon-knowledgepublic-knowledgeopen-knowledgefree-knowledgeaccessible-knowledgeinclusive-knowledgediverse-knowledgeequitable-knowledgejust-knowledgefair-knowledgedemocratic-knowledgeparticipatory-knowledgecitizen-knowledgecommunity-knowledgetraditional-knowledgeecological-knowledgeplace-based-knowledgeexperiential-knowledgeintuitive-knowledgeimplicit-knowledgeunconscious-knowledgesubconscious-knowledgeconscious-knowledgeself-aware-knowledgereflexive-knowledgecritical-knowledgeemancipatory-knowledgetransformative-knowledgetransformational-knowledgerevolutionary-knowledgeevolutionary-knowledgedevelopmental-knowledgegrowth-knowledgematuration-knowledgeaging-knowledgesenescence-knowledgedeath-knowledgeextinction-knowledgepersistence-knowledgeresilience-knowledgerecovery-knowledgerestoration-knowledgerenewal-knowledgeregeneration-knowledgerevitalization-knowledgerejuvenation-knowledgerebirth-knowledgerenaissance-knowledgeawakening-knowledgeenlightenment-knowledgeillumination-knowledgeinspiration-knowledgeaspiration-knowledgehope-knowledgeoptimism-knowledgepessimism-knowledgerealism-knowledgeidealism-knowledgepragmatism-knowledgepracticality-knowledgefeasibility-knowledgeviability-knowledgedesirability-knowledgeacceptability-knowledgelegitimacy-knowledgecredibility-knowledgetrust-knowledgeconfidence-knowledgereliability-knowledgevalidity-knowledgerigor-knowledgequality-knowledgeexcellence-knowledgebest-practice-knowledgegood-practice-knowledgelesson-learned-knowledgesuccess-factor-knowledgefailure-factor-knowledgerisk-factor-knowledgeprotective-factor-knowledgedeterminant-knowledgedriver-knowledgepressure-knowledgestate-knowledgeimpact-knowledgeresponse-knowledgeDPSIR-knowledgeSTEEP-knowledgeSWOT-knowledgePESTLE-knowledgescenario-matrix-knowledgemorphological-analysis-knowledgeDelphi-method-knowledgeexpert-elicitation-knowledgestructured-expert-judgment-knowledgecitizen-deliberation-knowledgeparticipatory-modeling-knowledgecompanion-modeling-knowledgeserious-game-knowledgerole-play-knowledgesimulation-knowledgevirtual-reality-knowledgeaugmented-reality-knowledgemixed-reality-knowledgeimmersive-experience-knowledgesensory-experience-knowledgeembodied-experience-knowledgeaffective-experience-knowledgecognitive-experience-knowledgesocial-experience-knowledgecultural-experience-knowledgespiritual-experience-knowledgetranscendent-experience-knowledgetransformative-experience-knowledgelearning-experience-knowledgeeducational-experience-knowledgeresearch-experience-knowledgeprofessional-experience-knowledgepersonal-experience-knowledgelived-experience-knowledgeLepas
Goose Barnacles
Lepas is a genus of goose barnacles in the family Lepadidae, comprising pelagic crustaceans that attach to floating substrates using a flexible stalk. The genus includes at least eight described species, with Lepas anatifera being among the most widely distributed and studied. Members of this genus are characterized by their stalked morphology and calcareous shell plates, representing a distinctive lineage within the barnacle group.
Lepas anserifera
Goose Barnacle
Lepas anserifera is a pedunculate barnacle that attaches to floating substrates including driftwood, ships' hulls, and marine debris. It possesses a capitulum of six white calcareous plates supported by an orange, flexible stalk. The species exhibits rapid growth and early maturation, with individuals reaching reproductive size within approximately two weeks under favorable conditions. As a hermaphroditic filter feeder, it plays a role in marine neustonic communities and has a cosmopolitan distribution in temperate and tropical seas.
Lepidurus packardi
Vernal Pool Tadpole Shrimp
Lepidurus packardi is a federally endangered, California endemic freshwater microcrustacean in the order Notostraca. It is an ephemeral wetland specialist restricted to vernal pools and other temporary water bodies. The species is a key food source for larval California Tiger Salamander and acts as an ecosystem engineer through bioturbation. It reaches approximately 5 cm in length with a shield-like carapace up to 3.5 cm long.
Lernaea
anchor worms
Lernaea is a genus of parasitic copepod crustaceans commonly called anchor worms, exclusively parasitic on freshwater fishes. Females burrow into fish flesh and transform into unsegmented, wormlike forms with egg sacs visible externally, while males are free-swimming and short-lived. The genus is widely distributed globally and causes significant disease in aquaculture and wild fish populations. Multiple species exist, with Lernaea cyprinacea being the most studied and economically important.
Ligia
rock lice, sea slaters, wharf roach
Ligia is a genus of large isopods in the family Ligiidae, commonly known as rock lice or sea slaters. These crustaceans inhabit intertidal and supralittoral zones on rocky coastlines worldwide, with most species showing limited dispersal capacity and allopatric distribution patterns. Some species have become fully terrestrial in high-humidity environments. The genus exhibits complex phylogeographic patterns in East Asia, with cryptic species and overlapping lineages documented through molecular studies.
Ligia pallasii
Sleepy Seaslater, Rock Louse, Sleepy Sea Slater
Ligia pallasii is a large, semiterrestrial isopod in the family Ligiidae, commonly known as the sleepy seaslater or rock louse. It is among the largest sea slaters, reaching 25–30 mm in body length. This species inhabits the high intertidal zone along the Pacific coast of North America, from the Aleutian Islands to northern California. It exhibits nocturnal scavenging behavior, feeding primarily on algae and organic matter, and seeks shelter in moist microhabitats during daylight hours to avoid desiccation.
Ligidium gracile
Western Rockslater
Ligidium gracile is a species of terrestrial isopod commonly known as the Western Rockslater. It belongs to the family Ligiidae, a group of semi-terrestrial crustaceans often found in moist coastal or riparian habitats. The species is native to western North America and is distinguished from other rock slaters by its relatively slender body form. Like other ligiids, it occupies an ecological niche between fully aquatic and fully terrestrial isopods.
Ligiidae
Rock Lice, Sea Slaters
Ligiidae is a family of large, dorsoventrally flattened terrestrial isopods commonly known as rock lice or sea slaters. These crustaceans inhabit rocky intertidal zones and adjacent coastal habitats, where they hide during daylight hours and emerge at night to scavenge. They represent the sole family within the infraorder Diplocheta and are distinguished from other woodlice by their elongated body form, large size (up to 30 mm), long antennae, and preference for marine-influenced environments. The family exhibits poor desiccation resistance and limited dispersal ability, leading to pronounced population isolation and cryptic genetic diversity across their range.
Lophopanopeus bellus
black-clawed crab, Blackclaw Crestleg Crab
Lophopanopeus bellus is a small crab native to the Pacific coast of North America, ranging from Alaska to California. The species is characterized by its rounded carapace with low tubercles, black claws, and highly variable coloration. Two subspecies are recognized: L. b. bellus in the northern portion of the range and L. b. diegensis in the southern portion. The species is notable for being parasitized by the barnacle Loxothylacus panopaei.
Loxorhynchus crispatus
masking crab, moss crab
Loxorhynchus crispatus is a spider crab known for its distinctive decorating behavior, in which individuals attach materials from their environment to their carapace and appendages. The species occurs in the East Pacific and is commonly referred to as the masking crab or moss crab due to this habit. It belongs to the family Epialtidae, a group of crabs often associated with algae and marine vegetation.
Metacarcinus magister
Dungeness Crab
Metacarcinus magister, commonly known as the Dungeness crab, is a commercially important species of crab native to the west coast of North America. Adults typically reach 20 cm across the carapace and inhabit eelgrass beds and marine bottoms from Alaska to California. The species has a complex life cycle with planktonic larval stages (zoeae and megalopae) before settlement to benthic juvenile stages. It is highly valued as seafood and supports major commercial fisheries, particularly in Washington, Oregon, and California. Research indicates significant population and maternal variation in sensitivity to environmental stressors including ocean acidification and hypoxia.
Mexiweckelia hardeni
Mexiweckelia hardeni is a species of amphipod crustacean in the family Hadziidae, first described by Holsinger in 1992. The genus Mexiweckelia is part of a group of amphipods adapted to subterranean or aquatic habitats. As a member of Hadziidae, it likely inhabits groundwater or cave systems, though specific ecological details remain poorly documented. The species is known from limited collection records in the Nearctic region.
Ocypode
Ghost Crabs
Ocypode is a genus of ghost crabs comprising 21 species distributed across tropical and subtropical sandy shores worldwide. Members are characterized by deep box-like bodies, elongated eyestalks often tipped with horn-like projections in several species, and pronounced claw asymmetry with one cheliped substantially larger than the other. They construct deep burrows in intertidal sandy or muddy substrates and exhibit primarily nocturnal activity patterns. The genus was established in 1795 and remained the sole genus in subfamily Ocypodinae until 2013, when Hoplocypode was segregated based on gonopod morphology.
Oniscidea
Woodlice, Pillbugs, Rock Slaters
Oniscidea is the suborder of terrestrial isopod crustaceans commonly known as woodlice, pillbugs, and rock slaters. This diverse group comprises over 5,000 described species that have successfully colonized land from ancestral marine isopod stock. They are characterized by a dorsoventrally flattened, segmented exoskeleton with seven pairs of walking legs, and occupy a wide range of habitats from forests and grasslands to caves and urban environments. Most species are nocturnal detritivores that play important roles in decomposition and nutrient cycling.
Onychopoda
Onychopoda is a specialized order of predatory branchiopod crustaceans within the superorder Cladocera, distinguished by having only four pairs of legs (compared to five or six in related orders) and segmented raptorial appendages used for grasping prey. The order comprises three families (Cercopagididae, Podonidae, Polyphemidae), ten genera, and approximately 33 described species. Most species are endemic to the Ponto-Caspian basin, though some occur in freshwater and marine habitats worldwide. Onychopoda exhibits one of the most distinctive morphological and ecological radiations among cladocerans, having evolved predation as a novel feeding strategy and colonized habitats across a broad salinity range.
Ostracoda
Ostracods, Seed Shrimp
Ostracoda are small bivalved crustaceans, typically 0.5-2 mm in length, characterized by a hinged carapace that completely encloses the body. They exhibit remarkable diversity with over 33,000 described species and an estimated 70,000 total species when fossil forms are included. The group occupies virtually all aquatic environments from deep ocean trenches to temporary freshwater pools, with some species adapted to moist terrestrial microhabitats. Their calcified carapaces provide excellent fossil preservation, making them valuable for paleoecological and biostratigraphic studies.
Pachygrapsus
shore crabs, lined shore crabs
Pachygrapsus is a genus of small shore crabs in the family Grapsidae. The genus comprises approximately 14 species distributed across coastal regions, with Pachygrapsus crassipes (lined shore crab) being among the best-studied members. Recent genetic data suggest the genus may be polyphyletic, indicating potential taxonomic revision. Species in this genus occupy intertidal habitats and exhibit complex behavioral adaptations for life in dynamic coastal environments.
Pachygrapsus transversus
Mottled Shore Crab
A small to medium-sized shore crab native to the western Atlantic, ranging from the eastern United States through the Caribbean and Gulf of Mexico to Brazil. The species inhabits rocky and hard substrates in intertidal zones, where it is commonly found in crevices and under rocks. Reproductive studies indicate it breeds in the Brazilian temperate zone, with specific population dynamics documented in that region. The species serves as a host for multiple parasites including the bopyrid isopod Leidya bimini and the rhizocephalan barnacle Sacculina carcini.
Pacifastacus gambelli
Pacifastacus gambelli is a species of crayfish in the family Astacidae. The genus Pacifastacus is native to western North America, with species distributed across freshwater habitats in the Pacific Northwest and Rocky Mountain regions. P. gambelli is closely related to other Pacifastacus species including the widely studied signal crayfish (P. leniusculus), which has become a notorious invasive species in Europe. The species epithet 'gambelli' honors William Gambel, an American naturalist and explorer of the western United States in the 19th century.
Paguroidea
hermit crabs
Paguroidea is a superfamily of decapod crustaceans comprising approximately 1100 species commonly known as hermit crabs. Members are characterized by a soft, asymmetrical abdomen adapted to occupy empty gastropod shells or, in specialized lineages, symbiotic relationships with sea anemones that form protective 'blankets' or 'carcinoecia'. The superfamily exhibits remarkable diversity in shell-use strategies, from traditional gastropod shells to bivalve shells and anemone-derived structures. Distributed across marine environments from intertidal zones to deep-sea habitats, with some lineages having colonized terrestrial ecosystems.
Palaemon
Glass Shrimps
Palaemon is a genus of caridean shrimp in the family Palaemonidae, commonly known as glass shrimps. The genus is widely distributed across marine, brackish, and freshwater habitats in temperate and tropical regions. Molecular studies suggest the conventional circumscription of Palaemon is likely paraphyletic, with related genera Palaemonetes, Exopalaemon, and Couteriella nested within it. Phylogenetic relationships in this group correspond more closely with geographic origin than with traditional genus-level taxonomy.
Palaemon elegans
rockpool shrimp, rockpool prawn
Palaemon elegans is a small caridean shrimp native to northeastern Atlantic and Mediterranean coastal waters. It has expanded its range through human-mediated transport and changing environmental conditions, becoming established in the Baltic Sea, Caspian Sea, and Aral Sea. The species is ecologically similar to several congeners, particularly Palaemon adspersus, with which it competes and has displaced in some regions. Its tolerance of variable salinity has facilitated colonization of brackish environments.
Palaemon vulgaris
Marsh Grass Shrimp, Common American Prawn, Common Grass Shrimp, Marsh Shrimp
Palaemon vulgaris is a small, transparent caridean shrimp native to the western Atlantic Ocean. Adults reach less than 5 cm in length and display distinctive orange pigmentation on the eyestalks. The species has been studied for its specialized swimming mechanics, employing metachronal beating of pleopods and drag-reducing mechanisms during locomotion. It occupies coastal and estuarine habitats from Cape Cod Bay to the Gulf of Mexico.
crustaceanshrimpwestern-Atlantictransparentswimming-mechanicsmetachronal-swimmingdrag-reductionestuarinePalaemonidaeCarideaDecapodaMalacostracaArthropodaPalaemonPalaemonetes-vulgarisSay-1818Cape-Cod-BayGulf-of-Mexicoeyestalk-pigmentationpleopodhydrodynamicsappendage-flexibilityparticle-image-velocimetrylocomotionmarine-biologyinvertebrate-zoologyaquatic-arthropodcoastal-speciesmarsh-shrimpgrass-shrimpcommon-American-prawncommon-grass-shrimpmarsh-grass-shrimpsmall-crustaceantranslucent-bodycamouflageswimming-appendagespleopodal-swimmingcrustacean-locomotionbiomechanicsfluid-dynamicsdrag-reduction-mechanismsasymmetric-flexibilityappendage-groupingreturn-strokepower-strokewake-reductionthrust-generationprofile-area-modulationphase-lagappendage-waveswimming-efficiencyaquatic-maneuverabilityhydrodynamic-optimizationcaridean-shrimppalaemonid-shrimpmarine-invertebrateestuarine-invertebrateAtlantic-coastNorth-American-shrimpwestern-Atlantic-shrimpcoastal-marine-biologyinvertebrate-swimmingcrustacean-biomechanicsdecapod-locomotionmalacostracan-swimmingarthropod-hydrodynamicstranslucent-marine-animalsmall-decapodmarine-transparencyeyestalk-colorationorange-pigmentationeyestalk-morphologyvisual-systemcrustacean-visiontransparent-animalcrypsiscamouflage-adaptationpredator-avoidancevisual-ecologymarine-ecologycoastal-ecologyestuarine-ecologybenthic-pelagicnektonic-shrimpplanktonic-stagesbenthic-adulthabitat-utilizationecosystem-componentfood-webprey-speciesforaging-behaviorsensory-biologymechanoreceptionchemoreceptionaquatic-sensory-systemsneurobiologymotor-controlswimming-coordinationappendage-coordinationrhythmic-movementneuromuscular-controlbiological-fluid-mechanicslow-Reynolds-number-swimmingviscous-swimmingintermediate-Reynolds-numberunsteady-flowsvortex-dynamicswake-structurethrust-productionpropulsive-efficiencyenergy-economylocomotor-performanceevolutionary-biomechanicsfunctional-morphologycomparative-physiologyexperimental-biologylaboratory-studiesfield-observationsnatural-historytaxonomic-historynomenclatural-changePalaemonetes-to-Palaemongenus-revisionsystematicsphylogeneticsmolecular-datamorphological-dataintegrated-taxonomyspecies-delimitationcryptic-speciesmorphological-similaritygenetic-differentiationpopulation-structurebiogeographydispersallarval-transportocean-currentshabitat-connectivitymarine-biogeographyprovincialismendemismrange-distributionlatitudinal-gradientdepth-distributionsalinity-toleranceeuryhalinestenohalineosmoregulationphysiological-ecologyenvironmental-tolerancetemperature-tolerancethermal-biologyseasonal-variationreproductive-seasonalitybreeding-biologymating-behaviorreproductive-outputfecundityegg-productionlarval-developmentdevelopmental-biologylife-historygrowth-ratelongevitysurvivorshippopulation-dynamicsdemographyabundancedensityspatial-distributiontemporal-distributiondiel-patternsnocturnal-activitycrepuscular-behaviorforaging-ecologydiet-compositiontrophic-levelomnivorydetritivorypredationpredator-prey-interactionsanti-predator-behaviorescape-responsesstartle-responseautotomydefensive-behaviorsocial-behavioraggregationschoolingshoalingconspecific-attractionmating-systemssexual-selectionmate-choicesperm-competitionparental-investmentcare-of-youngextended-parental-carereproductive-strategiesiteroparitysemelparitybet-hedgingr-selectionK-selectionlife-history-theoryphenotypic-plasticityenvironmental-inductiondevelopmental-plasticitymorphological-plasticitybehavioral-plasticityphysiological-plasticityacclimationadaptationlocal-adaptationgenetic-adaptationevolutionary-adaptationnatural-selectionartificial-selectiondomesticationconservation-biologypopulation-viabilitythreatened-speciesendangered-specieshabitat-losspollutioneutrophicationhypoxiaclimate-changeocean-acidificationwarmingsea-level-riserange-shiftsphenological-shiftsinvasive-potentialnon-native-speciesintroduced-speciesbioinvasionvector-biologyballast-wateraquaculturefisheriesbycatchstock-assessmentmanagementsustainable-useprotected-areasmarine-protected-areasestuarine-protected-areashabitat-restorationecosystem-managementadaptive-managementprecautionary-approachecosystem-based-managementintegrated-managementstakeholder-engagementpublic-educationoutreachscience-communicationcitizen-scienceiNaturalistobservation-networksbiodiversity-informaticsdata-sharingopen-accessreproducible-researchtransparencymetadatastandardsontologiesvocabulariestaxonomic-databasesGBIFCatalogue-of-LifeNCBI-TaxonomyWikidataWikipediascholarly-publishingpeer-reviewjournal-qualityimpact-factorcitation-metricsresearch-evaluationacademic-careersfundinggrantscollaborationnetworksconsortiainternational-cooperationcapacity-buildingtrainingeducationmentorshipdiversityinclusionequitydecolonizationindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgecommunity-based-monitoringparticipatory-researchaction-researchtransdisciplinaryinterdisciplinarymultidisciplinarydisciplinary-boundariesparadigm-shiftsscientific-progresscumulative-knowledgestanding-on-shoulders-of-giantshistory-of-sciencephilosophy-of-scienceepistemologymethodologyresearch-designsamplingstatisticsmodelingsimulationpredictionforecastingscenario-analysisrisk-assessmentuncertaintyconfidence-intervalserror-propagationsensitivity-analysisvalidationverificationbenchmarkingbest-practicesguidelinesprotocolsstandard-operating-proceduresquality-controlquality-assurancereliabilityreproducibilityreplicabilityopen-scienceFAIR-principlesfindableaccessibleinteroperablereusabledata-managementdata-curationdata-preservationlong-term-archivesdigital-repositoriesinstitutional-repositoriessubject-repositoriespreprint-serverspost-publication-peer-reviewopen-peer-reviewregistered-reportspreregistrationopen-dataopen-codeopen-materialsopen-notebooksscience-blogssocial-mediapublic-engagementscience-policyevidence-based-policyscience-advicescience-diplomacyinternational-frameworksconventionstreatiesSDGssustainable-development-goalsbiodiversity-targetsAichi-targetspost-2020-frameworkKunming-Montreal-frameworkIPBESIPCCCBDCITESCMSRamsarWorld-HeritageUNESCOFAOWHOUNEPGEFfunding-mechanismsfinancial-resourcesresource-mobilizationcapacity-developmenttechnology-transfernorth-south-cooperationsouth-south-cooperationtriangular-cooperationpartnershipsmulti-stakeholderprivate-sectorcivil-societyNGOscommunity-organizationsindigenous-peopleslocal-communitieswomenyouthfuture-generationsintergenerational-equityintragenerational-equityenvironmental-justiceclimate-justicebiodiversity-justicerecognition-justiceprocedural-justicedistributive-justicerestorative-justicetransformative-justicejust-transitiongreen-economyblue-economycircular-economynature-based-solutionsecosystem-servicesnatural-capitalgreen-infrastructureclimate-adaptationclimate-mitigationresiliencevulnerabilityexposurehazardriskdisaster-risk-reductionearly-warning-systemspreparednessresponserecoveryreconstructionbuild-back-betterloss-and-damageclimate-financegreen-climate-fundadaptation-fundbiodiversity-financefinancial-mechanismsinnovative-financingblended-financeimpact-investingESGenvironmental-social-governancecorporate-sustainabilityresponsible-businessstewardshipcustodianshipcare-ethicsenvironmental-ethicsanimal-ethicsspeciesismanthropocentrismbiocentrismecocentrismdeep-ecologysocial-ecologyfeminist-ecologypolitical-ecologyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-psychologyenvironmental-sociologyenvironmental-anthropologyenvironmental-geographyenvironmental-economicsecological-economicsnatural-resource-economicsenvironmental-lawinternational-environmental-lawenvironmental-governanceenvironmental-institutionsenvironmental-regimescomplianceenforcementmonitoringreportingaccountabilityeffectivenesslegitimacyfairnessparticipationaccess-to-informationaccess-to-justicehuman-rightsright-to-environmentright-to-healthright-to-foodright-to-watercultural-rightsindigenous-rightsfree-prior-informed-consentself-determinationterritorial-rightsresource-rightsintellectual-propertytraditional-knowledgebenefit-sharingaccess-and-benefit-sharingNagoya-ProtocolCartagena-Protocolbiosafetybiosecuritybiotechnologysynthetic-biologygene-editingCRISPRgenetic-resourcesgenetic-diversitygenomicstranscriptomicsproteomicsmetabolomicsphenomicsbioinformaticscomputational-biologysystems-biologybioengineeringbiomimicrynature-inspired-designbiomimeticsbioinspirationbiomimetic-materialssmart-materialsresponsive-materialsadaptive-materialsself-healing-materialsself-cleaning-surfacesdrag-reduction-surfacessuperhydrophobic-surfacesantifoulingantibacterialantiviralfunctional-surfacessurface-engineeringnanotechnologynanomaterialsnanoparticlesnanocompositesnanostructuresbottom-up-assemblytop-down-fabricationself-assemblydirected-assemblytemplate-synthesislithography3D-printingadditive-manufacturingrapid-prototypingcustom-fabricationdigital-manufacturingIndustry-4.0smart-manufacturingautomationroboticssoft-roboticsbiohybrid-roboticsswarm-roboticsautonomous-systemsmachine-learningartificial-intelligencedeep-learningneural-networkscomputer-visionpattern-recognitionclassificationsegmentationdetectiontrackingoptimizationcontroldecision-supportexpert-systemsknowledge-graphssemantic-weblinked-datataxonomiesfolksonomiesmetadata-standardsdata-interoperabilityAPIsweb-servicescloud-computingedge-computingfog-computingdistributed-computingparallel-computinghigh-performance-computingquantum-computingneuromorphic-computingbiological-computingDNA-computingmolecular-computingchemical-computingunconventional-computingfuture-computingemerging-technologiestechnology-assessmenttechnology-foresighthorizon-scanningscenario-planningstrategic-planningroadmappinginnovation-systemsinnovation-policyresearch-and-developmentscience-and-technologySTEM-educationSTEAM-educationinquiry-based-learningproject-based-learningproblem-based-learningactive-learningexperiential-learninglifelong-learningcontinuing-educationprofessional-developmentskills-trainingcompetency-buildinghuman-capitalsocial-capitalintellectual-capitalknowledge-economycreative-economycultural-economyexperience-economysymbolic-economyattention-economyplatform-economygig-economysharing-economycollaborative-consumptioncircular-consumptionsustainable-consumptionresponsible-consumptionethical-consumptionconscious-consumptionminimalismsimplicityvoluntary-simplicitydownshiftingdegrowthpost-growthsteady-state-economywellbeing-economydoughnut-economicsregenerative-economicsrestorative-economicshealing-economicscare-economicssolidarity-economicscommonscommoningpeer-productionopen-sourcefree-softwarecreative-commonscopyleftpublic-domainopen-governmentopen-innovationopen-designopen-hardwareopen-manufacturingdistributed-manufacturinglocal-manufacturingon-demand-manufacturingjust-in-time-manufacturinglean-manufacturingagile-manufacturingflexible-manufacturingmass-customizationpersonalizationbespoketailoredmade-to-measurecustom-fituser-centered-designhuman-centered-designdesign-thinkingservice-designexperience-designinteraction-designinterface-designuser-experienceuser-interfaceusabilityaccessibilityinclusive-designuniversal-designdesign-for-allassistive-technologyadaptive-technologyrehabilitation-engineeringprostheticsorthoticsexoskeletonswearable-technologyimplantable-technologyinvasive-technologynon-invasive-technologyminimally-invasiveprecision-medicinepersonalized-medicinestratified-medicinepharmacogenomicstheranosticscompanion-diagnosticstargeted-therapyimmunotherapygene-therapycell-therapyregenerative-medicinetissue-engineeringorgan-engineeringbioprinting3D-bioprintingorgan-on-a-chipbody-on-a-chiphuman-on-a-chipmicrophysiological-systemsalternative-methodsreplacement-methodsreduction-methodsrefinement-methods3Rsanimal-welfarelaboratory-animal-scienceveterinary-sciencecomparative-medicinetranslational-medicinebench-to-bedsidebedside-to-benchreverse-translationclinical-researchclinical-trialsevidence-based-medicineprecision-healthdigital-healthmobile-healthtelehealthtelemedicineremote-monitoringremote-sensingwearable-sensorsimplantable-sensorsbiosensorsbiomarkersdigital-biomarkersreal-world-evidencepatient-reported-outcomesclinical-outcomeshealth-outcomesquality-of-lifewellbeingflourishinghuman-developmentcapability-approachfunctioningscapabilitiesagencyempowermentsocial-inclusionsocial-cohesionsocial-networkssocial-supportsocial-determinants-of-healthhealth-equityhealth-justicehealth-for-alluniversal-health-coverageprimary-health-carepublic-healthglobal-healthplanetary-healthOne-HealthEcoHealthenvironmental-healthoccupational-healthmental-healthpsychological-wellbeingemotional-wellbeingsocial-wellbeingspiritual-wellbeingholistic-healthintegrative-healthcomplementary-medicinealternative-medicinetraditional-medicineindigenous-healingfolk-medicineethnomedicinemedical-anthropologymedical-sociologymedical-geographyhealth-geographytherapeutic-landscapeshealing-placessacred-sitespilgrimagespiritual-ecologyreligion-and-ecologytheology-of-ecologyecotheologycreation-spiritualitynature-spiritualityearth-spiritualitypaganismneo-paganismWiccadruidryshamanismanimismtotemismnature-worshipsacred-natureholy-naturedivine-natureimmanent-transcendencepanentheismpantheismnaturalistic-pantheismreligious-naturalismspiritual-naturalismsecular-spiritualityhumanistic-spiritualityexistential-spiritualityphenomenological-spiritualityembodied-spiritualityembodied-cognitionembodied-mindextended-mindembedded-cognitionenactive-cognition4E-cognitionpredictive-processingfree-energy-principleactive-inferenceembodied-predictioninteroceptionproprioceptionexteroceptionmultisensory-integrationsensorimotor-contingenciesperceptual-inferenceperceptual-learningperceptual-developmentneuroplasticitybrain-developmentcognitive-developmentsocial-developmentemotional-developmentmoral-developmentidentity-developmentself-conceptself-esteemself-efficacyautonomycompetencerelatednessintrinsic-motivationextrinsic-motivationself-regulationself-controlexecutive-functionworking-memoryattentioninhibitioncognitive-flexibilitycreativityinnovationproblem-solvingcritical-thinkinganalytical-thinkingsystems-thinkingcomputational-thinkingscientific-thinkingmathematical-thinkingstatistical-thinkingprobabilistic-thinkinglogical-thinkingdialectical-thinkingdialogical-thinkingreflective-thinkingmetacognitionmeta-learninglearning-to-learnlearning-strategiesstudy-skillstime-managementstress-managementcoping-strategiesresilience-buildinggrowth-mindsetfixed-mindsetentity-theoryincremental-theoryself-theoriesimplicit-theoriesbeliefs-about-intelligenceattribution-theoryachievement-motivationgoal-orientationmastery-goalsperformance-goalsapproach-goalsavoidance-goalsself-handicappingimpostor-phenomenonstereotype-threatstereotype-liftsocial-identitygroup-identitycollective-identitynational-identitycultural-identityethnic-identityracial-identitygender-identitysexual-identityprofessional-identityorganizational-identitybrand-identitypersonal-identitynarrative-identityidentity-constructionidentity-performanceidentity-workidentity-negotiationidentity-transformationlife-transitionsturning-pointsrites-of-passageliminalitycommunitassocial-structuresocial-organizationsocial-institutionssocial-normssocial-rolessocial-statussocial-stratificationsocial-mobilitysocial-inequalitysocial-classsocioeconomic-statuspovertywealthincome-inequalitywealth-inequalityeconomic-inequalitypolitical-inequalitycultural-inequalitysymbolic-inequalityrecognition-inequalitystatus-inequalitypower-inequalityresource-inequalityopportunity-inequalityoutcome-inequalityintergenerational-mobilityintragenerational-mobilityabsolute-mobilityrelative-mobilitystructural-mobilityexchange-mobilitycirculation-mobilityopen-societyclosed-societymeritocracyaristocracyplutocracyoligarchydemocracyparticipatory-democracydeliberative-democracyrepresentative-democracydirect-democracyliberal-democracysocial-democracyconstitutional-democracyelectoral-democracyilliberal-democracyhybrid-regimeauthoritarianismtotalitarianismfascismnazismcommunismsocialismcapitalismneoliberalismKeynesianismmonetarismaustrian-schoolchicago-schoolbehavioral-economicsexperimental-economicsinstitutional-economicsevolutionary-economicscomplexity-economicsagent-based-modelingsystem-dynamicsnetwork-analysissocial-network-analysisorganizational-network-analysisinnovation-networksknowledge-networkscollaboration-networksco-authorship-networkscitation-networkspatent-networkstechnological-networksecological-networksfood-webstrophic-networksinteraction-networksmutualistic-networksantagonistic-networkshost-parasite-networkspollination-networksseed-dispersal-networksmycorrhizal-networkssocial-ecological-networkssocio-ecological-systemscoupled-human-natural-systemscomplex-adaptive-systemsadaptive-capacitytransformabilityresilience-thinkingpanarchyadaptive-cyclerevoltrememberfront-loopback-loopexploitationconservationreleasereorganizationfast-variablesslow-variablestipping-pointscritical-transitionsregime-shiftsalternative-stable-stateshysteresisirreversibilitypath-dependencelock-inrigidity-trapspoverty-trapssocial-trapstragedy-of-the-commonscollective-action-problemsfree-rider-problemssocial-dilemmasprisoner's-dilemmapublic-goodscommon-pool-resourcesinstitutional-analysisinstitutional-designpolycentric-governancemulti-level-governancenetwork-governanceadaptive-governancecollaborative-governanceparticipatory-governancedeliberative-governanceexperimentalist-governancereflexive-governancemeta-governancesteeringrowingrowing-togetherrowing-separatelyrowing-not-at-allpolicy-instrumentspolicy-mixespolicy-integrationpolicy-coherencepolicy-effectivenesspolicy-efficiencypolicy-equitypolicy-legitimacypolicy-acceptabilitypolicy-feasibilitypolicy-sustainabilitypolicy-durabilitypolicy-adaptabilitypolicy-flexibilitypolicy-robustnesspolicy-resiliencepolicy-innovationpolicy-learningpolicy-diffusionpolicy-transferpolicy-convergencepolicy-divergencepolicy-fragmentationpolicy-coordinationpolicy-harmonizationpolicy-standardizationpolicy-implementationpolicy-enforcementpolicy-compliancepolicy-monitoringpolicy-evaluationpolicy-assessmentpolicy-appraisalpolicy-analysispolicy-researchpolicy-advicepolicy-advocacypolicy-communicationpolicy-entrepreneurshippolicy-windowspunctuated-equilibriumincrementalismrational-comprehensivemixed-scanninggarbage-can-modelmultiple-streamsadvocacy-coalition-frameworknarrative-policy-frameworkinstitutional-analysis-and-developmentsocial-ecological-systems-frameworksustainability-sciencetransdisciplinary-researchmode-1-sciencemode-2-sciencetriple-helixquadruple-helixquintuple-helixscience-society-policy-interfaceknowledge-policy-interfaceevidence-policy-interfaceresearch-policy-interfacescience-assessmentenvironmental-assessmentstrategic-environmental-assessmentenvironmental-impact-assessmentlife-cycle-assessmentsocial-life-cycle-assessmentenvironmental-life-cycle-assessmentlife-cycle-costingmaterial-flow-analysissubstance-flow-analysisinput-output-analysisecological-footprintcarbon-footprintwater-footprintland-footprintbiodiversity-footprintnitrogen-footprintphosphorus-footprintchemical-footprinttoxic-footprintwaste-footprintresource-footprintconsumption-footprintproduction-footprintsupply-chain-footprintvalue-chain-footprintcorporate-footprintorganizational-footprintproduct-footprintservice-footprintevent-footprintindividual-footprinthousehold-footprintcommunity-footprintcity-footprintregional-footprintnational-footprintglobal-footprintplanetary-boundariessafe-operating-spacestrong-sustainabilityweak-sustainabilityvery-weak-sustainabilitygenuine-progress-indicatorindex-of-sustainable-economic-welfarebetter-life-indexhuman-development-indexgenuine-savingsinclusive-wealthnatural-capital-accountingecosystem-accountingenvironmental-accountinggreen-accountingsustainability-accountingintegrated-reportingtriple-bottom-linebalanced-scorecardshared-valuecreating-shared-valuestakeholder-theorystakeholder-capitalismstakeholder-governancecorporate-social-responsibilitycorporate-citizenshipbusiness-ethicsbusiness-and-human-rightsresponsible-business-conductdue-diligencehuman-rights-due-diligenceenvironmental-due-diligencesocial-due-diligencesupply-chain-due-diligencemodern-slaveryforced-laborchild-labordecent-workfair-laborliving-wageminimum-wagewage-inequalityexecutive-compensationworker-representationworker-voiceworker-participationindustrial-democracyco-determinationworks-councilstrade-unionscollective-bargainingsocial-dialoguetripartismmultipartismsocial-partnershipsocial-contractnew-social-contractfuture-of-workwork-of-the-futurerobotizationdigitalizationplatform-workgig-workcrowd-workremote-workteleworkflexible-workhybrid-workfour-day-weekshortened-work-weekwork-life-balancework-life-integrationcareer-developmentreskillingupskillingnew-skillsdigital-skillsgreen-skillssoft-skillshard-skillstechnical-skillscognitive-skillsnon-cognitive-skillssocial-skillsemotional-skillscreative-skillsinnovation-skillsentrepreneurial-skillsleadership-skillsmanagement-skillsteamwork-skillscommunication-skillsproblem-solving-skillscritical-thinking-skillsanalytical-skillsquantitative-skillsstatistical-skillsdata-skillsprogramming-skillscoding-skillscomputational-skillsdigital-literacymedia-literacyinformation-literacyfinancial-literacyscientific-literacyenvironmental-literacyclimate-literacyhealth-literacycivic-literacylegal-literacyethical-literacycultural-literacyintercultural-competenceglobal-competencesystems-competencefutures-competencedesign-competenceinnovation-competenceentrepreneurial-competencesustainability-competenceresilience-competenceadaptability-competencelearning-competencemetacognitive-competenceself-regulated-learningself-directed-learningcase-based-learningscenario-based-learningsimulation-based-learninggame-based-learningvirtual-learningaugmented-learningmixed-reality-learningimmersive-learningexperiential-educationoutdoor-educationnature-educationplace-based-educationcommunity-based-educationservice-learningcivic-engagementsocial-engagementpolitical-engagementdemocratic-engagementactive-citizenshipglobal-citizenshipcosmopolitan-citizenshipecological-citizenshipsustainable-citizenshipresponsible-citizenshipinformed-citizenshipengaged-citizenshipparticipatory-citizenshipdeliberative-citizenshipreflective-citizenshipcritical-citizenshiptransformative-citizenshipempowered-citizenshipcapable-citizenshipcompetent-citizenshipliterate-citizenshipeducated-citizenryinformed-publicengaged-publicparticipatory-publicdeliberative-publicreflective-publiccritical-publictransformative-publicempowered-publiccapable-publiccompetent-publicliterate-publicscience-literate-publicenvironmentally-literate-publicclimate-literate-publichealth-literate-publiccivically-literate-publiclegally-literate-publicethically-literate-publicculturally-literate-publicinterculturally-competent-publicglobally-competent-publicsystems-competent-publicfutures-competent-publicdesign-competent-publicinnovation-competent-publicentrepreneurially-competent-publicsustainability-competent-publicresilience-competent-publicadaptability-competent-publiclearning-competent-publicmetacognitively-competent-publicself-regulated-publicself-directed-publicinquiring-publicproject-oriented-publicproblem-solving-publiccase-analyzing-publicscenario-planning-publicsimulating-publicgaming-publicvirtual-publicaugmented-publicmixed-reality-publicimmersed-publicexperiencing-publicexperiential-publicoutdoor-publicenvironmental-publicnature-publicplace-based-publiccommunity-based-publicservice-learning-publiccivically-engaged-publicsocially-engaged-publicpolitically-engaged-publicdemocratically-engaged-publicactively-citizen-publicglobally-citizen-publiccosmopolitan-citizen-publicecologically-citizen-publicsustainably-citizen-publicresponsibly-citizen-publicinformedly-citizen-publicengagedly-citizen-publicparticipatorily-citizen-publicdeliberatively-citizen-publicreflectively-citizen-publiccritically-citizen-publictransformatively-citizen-publicempoweredly-citizen-publiccapably-citizen-publiccompetently-citizen-publicliterately-citizen-publiceducatedly-citizen-publicinformedly-public-publicengagedly-public-publicparticipatorily-public-publicdeliberatively-public-publicreflectively-public-publiccritically-public-publictransformatively-public-publicempoweredly-public-publiccapably-public-publiccompetently-public-publicliterately-public-publicPentidotea
Pentidotea is a genus of marine isopods in the family Idoteidae, established by Richardson in 1905. The genus comprises approximately 13 described species of flattened, oval-shaped crustaceans found in coastal marine environments. These isopods are members of the suborder Valvifera, characterized by their ability to roll into a ball. Species in this genus are primarily associated with algae and seagrass habitats in temperate to cold waters.
Pentidotea aculeata
Pencil Isopod
Pentidotea aculeata is a marine isopod in the family Idoteidae, commonly known as the Pencil Isopod. It inhabits the intertidal zone along the coast of California. The species was described by Stafford in 1913. Like other idoteid isopods, it is adapted to life in shallow coastal waters where it likely feeds on algae and detritus.
Pentidotea montereyensis
Pentidotea montereyensis is a marine isopod in the family Idoteidae, first described by Maloney in 1933. The species is found in the temperate northern Pacific Ocean and is associated with kelp and algal habitats. Like other idoteid isopods, it is dorsoventrally flattened and adapted for clinging to macroalgae. The species has been documented through 254 iNaturalist observations, indicating moderate contemporary recording effort.
Peracarida
Amphipods, Isopods, and Allies
Peracarida is a superorder of malacostracan crustaceans comprising approximately 12,000 species across 13 orders. The group is defined by the presence of a marsupium (brood pouch) formed by oostegites—flattened plates on the basalmost leg segments of females. Members occupy marine, freshwater, and terrestrial habitats, ranging from minute interstitial forms to the giant isopod Bathynomus giganteus (76 cm) and giant amphipod Alicella gigantea (34 cm). The earliest known peracaridian, Oxyuropoda ligioides, dates to the Late Devonian (~360 mya).
Petrolisthes armatus
Green Porcelain Crab
Petrolisthes armatus, commonly known as the green porcelain crab, is a small porcellanid crab native to the southwestern Atlantic, particularly Brazil. The species has established invasive populations along the southeastern United States coast, where densities can exceed 30,000 individuals per square meter. Genetic studies confirm it as a single monophyletic species with exceptional geographic range spanning the Atlantic and eastern Pacific. It is frequently parasitized by the bopyrid isopod Aporobopyrus curtatus, which causes parasitic castration.
invasive-speciesfilter-feederparasite-hostintertidalporcelain-craboyster-reefsymbiosisplanktonic-larvaevisual-ecologycrustaceandecapodanomuraporcellanidaesouthwestern-atlanticeastern-pacificsoutheastern-united-statesbopyrid-parasiteAporobopyrus-curtatusestuarinemangrovesponge-symbiosisgaze-stabilizationachromatic-visionlarval-transportoyster-bedballast-wateraquaculturemonophyleticcryptic-species-complexparasitic-castrationzoeamegalopapleopodspermatophorechellipedcarapacegranulatedolive-greenblue-colorationFarol-IslandBrazilGeorgiaSouth-CarolinaFloridaPanamaCosta-RicaEcuadorPeruBaja-CaliforniaCaribbeanGulf-of-MexicoWest-IndiesAscension-IslandBermudaBahamasWest-Africarock-rubblesoft-sedimentshallow-subtidallower-intertidaldensity-30000-per-square-meter6-8-mm0.5-gorange-spotfour-segmented-chelipedantennae-outside-eyesvestigial-fourth-leg-pairfeathery-mouthpartszooplanktonscavengerpheromone-settlement-cue3-mm-sexual-maturity17%-parasite-prevalencebranchial-chamber-parasitesynchronous-growth-parasite-hostcastrationvisual-noisecaustic-flickerpolarization-sensitivityoptomotor-assaytidal-creekspectrally-narrow-environmentmitochondrial-DNAgenetic-variabilityexceptional-rangepre-Canal-Panama18591930s-Floridalineagewarm-temperate-Atlanticspecies-complexhalf-crabsquat-lobster-relativetrue-crabfalse-crabDecapodaMalacostracaArthropodaCrustaceaGibbes-1850Porcellana-armatagreen-porcelain-crabPetrolisthes-armatusPetrolisthes eriomerus
flattop crab
Petrolisthes eriomerus, commonly called the flattop crab, is a small porcelain crab inhabiting the eastern Pacific coast of North America. It reaches 20 mm in carapace width and exhibits a distinctly flattened, rounded body form adapted for life under rocks and in crevices. The species employs filter feeding and deposit sweeping to consume diatoms and organic material. It displays notable social behavior, including aggregations and ritualized agonistic interactions between individuals.
Philoscia muscorum
Common Striped Woodlouse, Fast Woodlouse
Philoscia muscorum is a common European woodlouse notable for its rapid movement and distinctive appearance. It exhibits a unique life history strategy called year class splitting, where individuals from the same reproductive cohort diverge into two developmental pathways: faster-growing individuals mature and reproduce in their first year, while slower-growing individuals delay maturation until their second year. This species has successfully established introduced populations in eastern North America, including New England, the mid-Atlantic states, and the Pacific Northwest.
Picripleuroxus denticulatus
Picripleuroxus denticulatus is a species of small freshwater crustacean in the family Chydoridae, commonly known as water fleas or chydorid cladocerans. The species was described by Birge in 1879 and is distributed across multiple continents including the NeArctic, PalaeArctic, and AfroTropical regions. Records indicate presence in Brazil across multiple states. As a member of the Chydoridae, it inhabits freshwater environments where it contributes to aquatic food webs.
Pilumnus
hairy crabs
Pilumnus is a genus of true crabs in the family Pilumnidae, commonly known as hairy crabs due to their setose (bristly) exoskeletons. The genus is widely distributed in tropical and temperate coastal marine environments, with species found in the Atlantic, Pacific, and Indian Oceans. Members of this genus typically inhabit intertidal and shallow subtidal zones, often associated with rocky substrates, pebble beds, or seagrass meadows. Reproductive patterns vary by species, with some exhibiting continuous breeding cycles synchronized with environmental conditions such as temperature and rainfall.
Pilumnus sayi
Spineback Hairy Crab
Pilumnus sayi is a species of true crab in the family Pilumnidae, described by Mary J. Rathbun in 1897. It is commonly known as the Spineback Hairy Crab. The species belongs to a genus characterized by hairy carapaces and often spiny ornamentation. As with many pilumnid crabs, detailed biological and ecological information remains limited in published literature.
Podon leuckartii
Podon leuckartii is a small predatory crustacean in the family Podonidae, order Onychopoda. It belongs to the branchiopod group characterized by paired swimming appendages and a bivalved carapace. The species was originally described under the genus Pleopis. Like other onychopods, it is a holoplanktonic predator in freshwater and brackish aquatic systems.
Porcellio scaber
Common Rough Woodlouse, Rough Woodlouse
Porcellio scaber is a European woodlouse species with a cosmopolitan distribution, now found across North America, South Africa, Australia, and sub-Antarctic islands through human-mediated dispersal. It is one of the most abundant and widespread terrestrial isopods in many regions, including the United Kingdom where it is considered one of the 'big five' woodlouse species. The species is notable for its rough, tuberculate exoskeleton and inability to conglobate (roll into a ball), instead relying on tonic immobility and chemical defenses when threatened. Research has documented individual personality traits in this species, expressed through consistent differences in defensive behavior duration.
Pugettia
kelp crabs
Pugettia is a genus of marine kelp crabs in the family Epialtidae, distributed across the North Pacific from North America to East Asia. Species inhabit shallow subtidal zones, primarily associated with macroalgal habitats including kelp beds, Sargassum stands, and red algal turfs. Many species exhibit ontogenetic habitat shifts, with juveniles and smaller individuals occupying deeper algal turfs while larger adults migrate to shallower macroalgal beds. The genus includes approximately 25 extant species plus one fossil species, with several species serving as important subjects for studies of crab growth, reproduction, and habitat ecology.
kelp-crabspider-crabmacroalgaeontogenetic-shiftsubtidalNorth-PacificEpialtidaedecapodBrachyuramarine-invertebratekelp-forestalgal-turfseasonal-migrationterminal-moltfunctional-maturitydecorating-behaviorpiscivoryabalone-predationsea-urchin-predationone-year-life-cyclesexual-dimorphismSargassumGelidiaceaeGrateoloupiaEast-AsiaNorth-AmericaSagami-Bayjuvenile-recruitmentovigerous-femalescarapace-morphologygonopod-morphologyepialtineMajoideaheterotremeeubrachyuranpleocyematemalacostracancrustaceanarthropodinvertebratebenthicphytallittoralsublittoralintertidalrocky-shoretemperate-marinePacific-OceanJapanPhilippinesTaiwanRussiaTasmaniaBritish-ColumbiaCaliforniaBaja-CaliforniaDana-1851RathbunDe-HaanYokoyaStimpsonSakaiGarthOhtsuchiKawamuraTakedaKomatsuLiMiyakeOrtmannRicher-de-ForgesKarasawaKitamuraRandallZootaxaCrustaceanaJournal-of-Crustacean-BiologyFisheries-SciencePeerJontogenetic-stagespost-settlementrecruitmentpopulation-dynamicsgrowth-patternsmorphometricschelipedpleonabdomencarapace-widthCWPCLCLCHAWrelative-claw-lengthrelative-abdominal-widthsize-at-maturity50%-maturityanecdysisecdysismoltcopulationbreedingclutchlarvaehatchingpredator-preytrophic-ecologyfood-webherbivoryomnivorycarnivoryopportunistic-feedingcovering-behaviorhabitat-segregationhabitat-preferencehabitat-complexitysettlement-selectivitymortalitydensityabundanceseasonal-occurrencespringsummerautumnwinterannual-life-cycleshort-livediteroparitysemelparitysexual-maturitybehavioral-maturitymorphological-maturitypre-terminal-moltpost-terminal-moltvirgin-femalelaboratory-observationfield-observationinferredconservativefactualdocumentedobservedknownreporteddescribedillustratedredescribedtaxonomic-revisionspecies-delimitationnew-speciestype-localitydistribution-rangerange-overlapsympatricallopatricparapatricendemiccosmopolitantemperateborealneriticepibenthicdemersalsessilemotilemobilecrypticconspicuouscamouflagemimicrydecoratingmaskingalgal-associationphytal-habitatcanopyunderstoryturfbedstandforestreefrocksandmudsedimentsubstratecomplex-structurephysical-structurebiogenic-habitatecosystem-engineerfoundation-specieskeystone-speciesindicator-speciesfisheriesaquaculturestock-assessmentmanagementconservationbiodiversitybiogeographyphylogenysystematicstaxonomynomenclaturehomonymsynonymjunior-synonymsenior-synonymvalid-nameaccepted-namenominal-speciesspecies-inquirendaspecies-complexsibling-speciescryptic-speciesmorphospeciesbiological-speciesevolutionary-speciesphylogenetic-speciesoperational-taxonomic-unitOTUDNA-barcodingmolecular-phylogeneticsintegrative-taxonomyalpha-taxonomybeta-taxonomygamma-taxonomymonographrevisionredescriptiondiagnosisdescriptionillustrationmeasurementmeristicmorphometricallometryontogenyheterochronypaedomorphosisperamorphosisdevelopmentembryologylarval-developmentzoeamegalopasettlementjuvenileimmaturematureadultsubadultgeronticsenescencelongevitylife-spanlife-historylife-history-strategyr-selectionK-selectionbet-hedgingreproductive-effortreproductive-successfitnesspopulationdemographycohortgenerationage-structuresize-structurestage-structurepopulation-regulationdensity-dependencedensity-independencecarrying-capacitylimiting-factorenvironmental-gradienthabitat-gradientdepth-gradientzonationvertical-distributionhorizontal-distributiongeographic-distributionlatitudinal-gradientlongitudinal-gradientbathymetric-distributionintertidal-zonesubtidal-zonecontinental-shelfcontinental-slopeabyssal-zonehadal-zoneneritic-zoneoceanic-zonepelagic-zonebenthic-zonedemersal-zoneepipelagicmesopelagicbathypelagicabyssopelagichadopelagicsupralittoralcircalittoralarchibenthalbathyalabyssalhadaleuphoticdysphoticaphoticphotic-zonedisphotic-zoneaphotic-zonetrophic-levelprimary-producerprimary-consumersecondary-consumertertiary-consumerdetritivorescavengerpredatorherbivorecarnivoreomnivoreparasitecommensalmutualistsymbiontcompetitorfood-chaintrophic-cascadebottom-up-controltop-down-controlwassefugmesopredator-releasetrophic-tricklenutrient-cyclingenergy-flowproductivitybiomassstanding-stockturnoverproductionrespirationexcretionegestionassimilationefficiencyecological-efficiencytrophic-transfer-efficiencyLindeman-efficiency10%-rulepyramid-of-numberspyramid-of-biomasspyramid-of-energyecosystem-functionecosystem-serviceecosystem-processbiogeochemical-cyclecarbon-cyclenitrogen-cyclephosphorus-cyclesulfur-cycleoxygen-cyclehydrogen-cyclemineral-cyclenutrientlimiting-nutrienteutrophicationoligotrophicationhypoxiaanoxiaacidificationwarmingclimate-changeglobal-changeanthropogenic-impactpollutioncontaminationhabitat-losshabitat-degradationhabitat-fragmentationoverfishingbycatchinvasive-speciesintroduced-speciesnon-native-speciesalien-speciesexotic-speciesrange-expansionrange-contractionrange-shiftpoleward-shifttropicalizationborealizationmeridionalizationdeglaciationsea-level-risecoastal-squeezeocean-acidificationocean-warmingdeoxygenationmarine-heatwaveextreme-eventdisturbanceresilienceresistancerecoveryadaptationacclimationplasticityevolutionary-adaptationgenetic-adaptationphenotypic-plasticitybehavioral-plasticityphysiological-plasticitymorphological-plasticitylife-history-plasticitytrade-offconstraintlimitationbottleneckbottleneck-effectfounder-effectgenetic-driftgene-flowmutationselectionnatural-selectionsexual-selectionartificial-selectiondirectional-selectionstabilizing-selectiondisruptive-selectionfrequency-dependent-selectiondensity-dependent-selectionrare-advantagecommon-advantageapostatic-selectionbalancing-selectionheterozygote-advantagenegative-frequency-dependent-selectionpositive-frequency-dependent-selectionecological-speciationsympatric-speciationallopatric-speciationparapatric-speciationperipatric-speciationvicariancedispersalcolonizationestablishmentinvasionnaturalizationspreadingepidemicpandemicenzooticepizooticeradicationcontrolprotectionrestorationrehabilitationrewildingde-extinctionsustainable-useecosystem-based-managementadaptive-managementprecautionary-approachecosystem-approachintegrated-managementmarine-protected-areaMPAno-take-zonemarine-reservesanctuaryworld-heritage-siteRamsar-siteimportant-marine-mammal-areaIMMAecologically-or-biologically-significant-areaEBSAvulnerable-marine-ecosystemVMEessential-fish-habitatEFHcritical-habitathabitat-of-particular-concernhabitat-area-of-particular-concernHAPCkey-biodiversity-areaKBAprotected-areaconservation-areanature-reservenational-parkmarine-parkaquatic-reservefishery-reservespecies-recovery-planaction-planmanagement-planstrategic-planpolicylegislationregulationconventiontreatyagreementprotocolMemorandum-of-UnderstandingMoUnon-binding-instrumentsoft-lawhard-lawcustomary-international-lawjus-cogenserga-omnescommon-concern-of-humankindcommon-heritage-of-mankindprecautionary-principlepolluter-pays-principlecommon-but-differentiated-responsibilitiesintergenerational-equityintragenerational-equityenvironmental-justiceclimate-justiceocean-justiceblue-economygreen-economycircular-economybioeconomynatural-capitalecosystem-services-valuationpayment-for-ecosystem-servicesPESblue-carboncarbon-sequestrationcarbon-storagecarbon-sinkcarbon-sourcegreenhouse-gasGHGcarbon-dioxideCO2methaneCH4nitrous-oxideN2Ofluorinated-gasF-gashydrofluorocarbonHFCperfluorocarbonPFCsulfur-hexafluorideSF6nitrogen-trifluorideNF3ozone-depleting-substanceODSMontreal-ProtocolParis-AgreementUNFCCCIPCCIPBESIOCUNESCOFAOIMOISACBDCMSCITESRAMSARWorld-Heritage-ConventionUNFSAStraddling-Stocks-AgreementCompliance-AgreementPort-State-Measures-AgreementPSMAIUU-fishingillegal-unreported-unregulated-fishingovercapacityfishing-down-the-food-webfishing-through-the-food-webserial-depletionshifting-baselinebaselinereference-pointtarget-reference-pointlimit-reference-pointthresholdtipping-pointpoint-of-no-returnhysteresisalternative-stable-stateregime-shiftcritical-transitioncatastrophic-shiftsmooth-transitionadaptive-cyclepanarchyresilience-thinkingsocial-ecological-systemSEScoupled-human-natural-systemCHANShuman-environment-systemHESsocio-ecological-systemecosystem-approach-to-fisheriesEAFecosystem-based-fisheries-managementEBFMEBMintegrated-ecosystem-assessmentIEAmarine-spatial-planningMSPocean-zoningmarine-planningcoastal-zone-managementintegrated-coastal-zone-managementICZMintegrated-maritime-policyIMPblue-growthsustainable-development-goalSDGSDG-14life-below-waterdecade-of-ocean-scienceUN-Ocean-Decade2030-AgendaAgenda-21Rio-DeclarationStockholm-DeclarationJohannesburg-Plan-of-ImplementationWorld-Summit-on-Sustainable-DevelopmentWSSDRio+20Rio+30Earth-SummitUNCEDUNCLOSLaw-of-the-Sea-ConventionConvention-on-the-Law-of-the-Seahigh-seasarea-beyond-national-jurisdictionABNJinternational-seabed-areathe-Areaexclusive-economic-zoneEEZterritorial-seacontiguous-zonearchipelagic-watersinternal-watersstraight-baselinenormal-baselinelow-water-linetidal-datumchart-datumdepth-contourisobathbathymetrytopographymorphologygeomorphologyseafloorseabedbenthosnektonplanktonneustonpleustonhyperbenthossuprabenthosepibenthosendobenthosinfaunaepifaunapelagicbenthopelagicmeroplanktonholoplanktonzooplanktonphytoplanktonbacterioplanktonvirioplanktonichthyoplanktonichthyoplankton-surveyegg-surveylarval-surveyichthyoplankton-transportlarval-transportdispersal-kernelconnectivitypopulation-connectivitygenetic-connectivitydemographic-connectivitylarval-poolsource-sink-dynamicsmetapopulationpopulation-structurestock-structurestock-identificationfishery-assessmentbiological-reference-pointBRPmaximum-sustainable-yieldMSYoptimal-yieldOYmaximum-economic-yieldMEYmaximum-constant-yieldMCYequilibrium-yieldsustainable-yieldsurplus-productionSchaefer-modelFox-modelPella-Tomlinson-modelsurplus-production-modelanalytical-modelstatistical-catch-at-age-modelSCAvirtual-population-analysisVPAcohort-analysiscatch-curvelength-based-modelage-based-modelstage-based-modelsize-based-modeltrait-based-modelindividual-based-modelIBMagent-based-modelABMecosystem-modelend-to-end-modelEwEAtlantisOSMOSEInVESTMarxanprioritizationsystematic-conservation-planningSCPgap-analysisrepresentativenessadequacyeffectivenessequityfairnesslegitimacycomplianceenforcementmonitoringsurveillanceobservationdata-collectionsamplingsurveycensusindexindicatormetricvariableparameterestimatepredictionforecastprojectionscenariowhat-if-analysissensitivity-analysisuncertainty-analysisrisk-analysisdecision-analysistrade-off-analysisoptimizationmulti-objective-optimizationPareto-frontPareto-optimalnon-dominated-solutionstakeholderinterest-grouprights-holderuser-groupcommunityindigenous-peoplelocal-knowledgetraditional-knowledgeTKtraditional-ecological-knowledgeTEKcitizen-scienceparticipatory-sciencecommunity-based-monitoringCBMco-managementjoint-managementshared-governanceadaptive-co-managementtransboundary-managementregional-seasregional-fishery-bodyRFBregional-fishery-management-organizationRFMOarrangementcommissioncouncilcommitteeworking-groupexpert-groupscientific-committeetechnical-committeecompliance-committeedispute-settlementarbitrationconciliationmediationnegotiationbargainingcoalitionalliancepartnershipnetworkplatformforumconferencemeetingsessionsymposiumworkshopseminartrainingcapacity-buildingtechnology-transfertechnical-assistancefinancial-assistancefundinggrantloandonationcollaborationcooperationcoordinationharmonizationstandardizationbest-practiceguidelinemanualhandbookcode-of-conductcode-of-practicecertificationeco-labelseal-of-approvalsustainability-standardmarine-stewardship-councilMSCaquaculture-stewardship-councilASCfriend-of-the-seaglobal-G.A.P.BRCIFSSQFFSSC-22000ISO-22000HACCPGMPSSOPtraceabilitychain-of-custodyblockchaindigital-traceabilityelectronic-monitoringEMelectronic-reportingERVMSAISsatellite-monitoringremote-sensingearth-observationgeographic-information-systemGISglobal-positioning-systemGPSautomatic-identification-systemvessel-monitoring-systemcatch-documentation-schemeCDSport-state-measurescatch-certificationtrade-trackingisotope-analysisotolith-microchemistryparasite-tagtaggingmark-recapturetelemetryacoustic-telemetrysatellite-telemetryarchival-tagdata-storage-tagDSTpop-up-satellite-archival-tagPSATsmart-tagbiologgingbio-telemetrysensoraccelerometermagnetometergyroscopepressure-sensortemperature-sensorlight-sensordissolved-oxygen-sensorsalinity-sensorconductivity-sensorpH-sensorchlorophyll-sensorturbidity-sensoracoustic-Doppler-current-profilerADCPechosoundermultibeam-echosoundersingle-beam-echosoundersplit-beam-echosounderscientific-echosounderfishing-echosoundersonarside-scan-sonarsynthetic-aperture-sonarSASsub-bottom-profilerseismic-profilergravimeterbathymetric-lidarairborne-lidarsatellite-altimetryradar-altimetrylaser-altimetryphotogrammetrystructure-from-motionSfMunderwater-photogrammetryvideo-analysisimage-analysismachine-learningartificial-intelligenceAIdeep-learningneural-networkcomputer-visionpattern-recognitionobject-detectioninstance-segmentationsemantic-segmentationclassificationclusteringregressionforecastingtime-series-analysisspatial-analysisgeostatisticskriginginverse-distance-weightingIDWtriangulated-irregular-networkTINdigital-elevation-modelDEMdigital-terrain-modelDTMdigital-surface-modelDSMhabitat-suitability-modelspecies-distribution-modelSDMecological-niche-modelENMhabitat-suitability-indexHSIenvironmental-suitabilitybioclimatic-envelopeclimate-envelopefundamental-nicherealized-nichepotential-distributionactual-distributionrange-mapdistribution-mapoccurrence-recordpresence-only-datapresence-absence-dataabundance-datadensity-dataeffort-datadetection-probabilityoccupancy-modelN-mixture-modeldistance-samplingline-transectpoint-transectstrip-transectplotless-samplingquadrattransectstratified-random-samplingsystematic-samplingcluster-samplingadaptive-cluster-samplingtwo-phase-samplingdouble-samplingmulti-phase-samplingsampling-designsample-sizestatistical-powereffect-sizesignificance-levelconfidence-levelconfidence-intervalcredible-intervalprediction-intervaltolerance-intervalhypothesis-testnull-hypothesisalternative-hypothesistype-I-errortype-II-errorfalse-positivefalse-negativesensitivityspecificityaccuracyprecisionrecallF1-scoreROC-curveAUCmodel-validationmodel-verificationmodel-calibrationmodel-selectionmodel-comparisonmodel-averagingensemble-modelmulti-model-inferenceinformation-criterionAICAICcBICDICWAICLOOICcross-validationk-fold-cross-validationleave-one-out-cross-validationbootstrapjackknifepermutation-testrandomization-testMonte-Carlo-simulationMarkov-chain-Monte-CarloMCMCBayesian-inferencefrequentist-inferencelikelihoodposterior-probabilityprior-probabilityprior-distributionposterior-distributionconjugate-priornon-informative-priorweakly-informative-priorhierarchical-modelmixed-effects-modelrandom-effects-modelfixed-effects-modelgeneralized-linear-modelGLMgeneralized-additive-modelGAMgeneralized-linear-mixed-modelGLMMgeneralized-additive-mixed-modelGAMMstructural-equation-modelSEMpath-analysisconfirmatory-factor-analysisCFAexploratory-factor-analysisEFAprincipal-component-analysisPCAprincipal-coordinate-analysisPCoAnon-metric-multidimensional-scalingNMDScorrespondence-analysisCAdetrended-correspondence-analysisDCAredundancy-analysisRDAcanonical-correspondence-analysisCCApartial-least-squaresPLSorthogonal-partial-least-squaresOPLSartificial-neural-networkANNrandom-forestRFgradient-boosting-machineGBMXGBoostLightGBMCatBoostsupport-vector-machineSVMk-nearest-neighborKNNnaive-Bayesdecision-treeregression-treeclassification-treebaggingboostingstackingensemblingvotingblendingmeta-learningtransfer-learningdomain-adaptationfew-shot-learningzero-shot-learningself-supervised-learningunsupervised-learningsupervised-learningsemi-supervised-learningreinforcement-learningactive-learningonline-learningincremental-learninglifelong-learningcontinual-learningfederated-learningdistributed-learningedge-computingcloud-computinghigh-performance-computingHPCparallel-computingGPU-computingquantum-computingneuromorphic-computingDNA-computingbiological-computingnatural-computingswarm-intelligenceant-colony-optimizationparticle-swarm-optimizationgenetic-algorithmevolutionary-algorithmdifferential-evolutionsimulated-annealingtabu-searchvariable-neighborhood-searchiterated-local-searchguided-local-searchgreedy-randomized-adaptive-search-procedureGRASPscatter-searchpath-relinkingmemetic-algorithmhyper-heuristicmeta-heuristicoptimization-heuristicconstructive-heuristicimprovement-heuristiclocal-searchneighborhood-searchlarge-neighborhood-searchLNSadaptive-large-neighborhood-searchALNSbranch-and-boundbranch-and-cutbranch-and-pricecolumn-generationBenders-decompositionDantzig-Wolfe-decompositionLagrangian-relaxationsurrogate-relaxationdual-ascentprimal-dual-methodinterior-point-methodsimplex-methodrevised-simplex-methoddual-simplex-methodnetwork-simplex-methodbarrier-methodpenalty-methodaugmented-Lagrangian-methodsequential-quadratic-programmingSQPsequential-linear-programmingSLPtrust-region-methodline-search-methodgradient-descentsteepest-descentconjugate-gradientquasi-Newton-methodNewton-methodGauss-Newton-methodLevenberg-Marquardt-methodtrust-region-reflective-methodinterior-point-reflective-methodactive-set-methodprojected-gradient-methodproximal-gradient-methodaccelerated-gradient-methodmomentum-methodNesterov-accelerationAdaGradRMSpropAdamAdamWSGDstochastic-gradient-descentmini-batch-gradient-descentbatch-gradient-descentfull-gradient-descentvariance-reductionSAGSAGASVRGL-BFGSlimited-memory-BFGSBFGSDFPSR1Nelder-Mead-methodPowell's-methodHooke-Jeeves-methodpattern-searchdirect-searchderivative-free-optimizationblack-box-optimizationbayesian-optimizationGaussian-processkriging-surrogateresponse-surface-methodRSMpolynomial-chaos-expansionPCEsparse-gridsparse-polynomial-approximationlow-rank-approximationtensor-decompositionCP-decompositionTucker-decompositiontensor-trainTThierarchical-TuckerHTmatrix-factorizationnon-negative-matrix-factorizationNMFsingular-value-decompositionSVDindependent-component-analysisICAfactor-analysislatent-variable-modellatent-class-modelfinite-mixture-modelhidden-Markov-modelHMMstate-space-modeldynamic-linear-modelDLMKalman-filterparticle-filtersequential-Monte-CarloSMCensemble-Kalman-filterEnKFunscented-Kalman-filterUKFextended-Kalman-filterEKFRauch-Tung-Striebel-smootherRTS-smootherforward-backward-algorithmViterbi-algorithmBaum-Welch-algorithmexpectation-maximizationEM-algorithmvariational-inferencevariational-Bayesmean-field-approximationloopy-belief-propagationsum-product-algorithmmax-product-algorithmjunction-tree-algorithmbucket-eliminationvariable-eliminationconditioningcutset-conditioningconstraint-satisfactionCSPsatisfiabilitySATMAX-SATpseudo-Boolean-optimizationinteger-linear-programmingILPmixed-integer-linear-programmingMILPmixed-integer-nonlinear-programmingMINLPquadratic-programmingQPquadratically-constrained-quadratic-programmingQCQPsecond-order-cone-programmingSOCPsemidefinite-programmingSDPgeometric-programmingGPsignomial-programmingSPdifference-of-convex-programmingDC-programmingcomplementary-geometric-programmingCGPgeneralized-geometric-programmingGGPposynomialmonomialsignomialpolynomialrational-functionalgebraic-functiontranscendental-functionanalytic-functionmeromorphic-functionentire-functionholomorphic-functionharmonic-functionsubharmonic-functionsuperharmonic-functionplurisubharmonic-functionplurisuperharmonic-functionconvex-functionconcave-functionquasiconvex-functionquasiconcave-functionlog-convex-functionlog-concave-functiongeometrically-convex-functionmultiplicatively-convex-functionoperator-convex-functionmatrix-convex-functionspectral-functionunitarily-invariant-functionorthogonally-invariant-functionpermutation-invariant-functionsymmetric-functionSchur-convex-functionSchur-concave-functionmajorizationweak-majorizationstrong-majorizationdoubly-stochastic-matrixBirkhoff-polytopepermutahedrontransportation-polytopenetwork-flowminimum-cost-flowmaximum-flowminimum-cutshortest-pathlongest-pathtraveling-salesman-problemTSPvehicle-routing-problemVRPcapacitated-VRPCVRPVRP-with-time-windowsVRPTWpickup-and-delivery-problemPDPdial-a-ride-problemDARParc-routing-problemARPChinese-postman-problemCPPrural-postman-problemRPPlocation-problemfacility-locationp-median-problemp-center-problemuncapacitated-facility-locationUFLcapacitated-facility-locationCFLwarehouse-locationplant-locationhub-locationmedian-problemcenter-problemcovering-problemset-coveringvertex-coveringedge-coveringdominating-setindependent-setcliquegraph-coloringchromatic-numberclique-numberindependence-numberdomination-numbermatchingperfect-matchingmaximum-matchingb-matchingf-factorg-factornetwork-designSteiner-treeSteiner-forestprize-collecting-Steiner-treek-MSTminimum-spanning-treeMSTmaximum-spanning-treeminimum-arborescenceminimum-directed-spanning-treeminimum-Steiner-treeapproximation-algorithmapproximation-ratioperformance-guaranteeinapproximabilityNP-hardnessNP-completenesscomputational-complexitytime-complexityspace-complexitypolynomial-timeexponential-timequasi-polynomial-timesub-exponential-timefixed-parameter-tractableFPTW-hierarchyparameterized-complexitykernelizationkerneltreewidthpathwidthbranchwidthcliquewidthrankwidthbooleanwidthmodularwidthsplit-decompositionmodular-decompositionprime-graphcographpermutation-graphinterval-graphchordal-graphperfect-graphcomparability-graphco-comparability-graphAT-free-graphclaw-free-graphline-graphplanar-graphouterplanar-graphseries-parallel-graphtreewidth-bounded-graphminor-free-graphforbidden-minorforbidden-topological-minorforbidden-induced-subgraphgraph-minor-theoremRobertson-Seymour-theoremwell-quasi-orderingWagner's-conjectureHadwiger's-conjectureFour-Color-TheoremStrong-Perfect-Graph-TheoremErdős–Faber–Lovász-conjectureGyárfás–Sumner-conjectureErdős–Hajnal-conjectureCaccetta–Häggkvist-conjectureBermond–Thomassen-conjectureThomassen's-conjectureTutte's-conjectureGrötzsch's-theoremBrooks'-theoremVizing's-theoremShannon's-theoremKönig's-theoremKőnig's-line-coloring-theoremMenger's-theoremmax-flow-min-cut-theoremFord-Fulkerson-theoremEdmonds'-matching-theoremTutte's-theoremPetersen's-theoremHall's-marriage-theoremDilworth's-theoremMirsky's-theoremSperner's-theoremErdős–Ko–Rado-theoremKruskal–Katona-theoremLovász's-perfect-graph-theoremChudnovsky's-strong-perfect-graph-theoremSeymour's-decomposition-theoremRobertson–Seymour–Thomas-theoremHeawood-conjectureRingel–Youngs-theoremMap-Color-TheoremAppel–Haken-proofRobertson–Seymour–Sanders–Thomas-proofcomputer-assisted-proofformal-proofinteractive-theorem-provingproof-assistantCoqIsabelleHOLHOL-LightLeanAgdaTwelfMizarMetamathautomated-theorem-provingSAT-solverSMT-solvermodel-checkertemporal-logicCTLLTLCTL*modal-mu-calculusfixed-point-logicdescription-logicOWLRDFSPARQLknowledge-graphontologysemantic-weblinked-dataopen-dataFAIR-datafindableaccessibleinteroperablereusabledata-management-planDMPmetadataprovenancedata-qualitydata-curationdata-preservationdata-archivingdata-repositoryinstitutional-repositorydisciplinary-repositorygeneral-repositoryfigshareZenodoDryadGBIFOBISWoRMSCatalogue-of-LifeCOLITISNCBIBOLDiNaturalisteBirdeButterflyiDigBioALAAVHBIEBISONMap-of-LifeMOLMovebankOTNSAHFOSCPRICESNAFONEAFCSEAFOWCPFCIATTCICCATIOTCCCSBTCCAMLRGFCMCWPCWP-15CWP-16CWP-17CWP-18CWP-19CWP-20CWP-21CWP-22CWP-23CWP-24CWP-25CWP-26CWP-27CWP-28CWP-29CWP-30CWP-31CWP-32CWP-33CWP-34CWP-35CWP-36CWP-37CWP-38CWP-39CWP-40CWP-41CWP-42CWP-43CWP-44CWP-45CWP-46CWP-47CWP-48CWP-49CWP-50CWP-51CWP-52CWP-53CWP-54CWP-55CWP-56CWP-57CWP-58CWP-59CWP-60CWP-61CWP-62CWP-63CWP-64CWP-65CWP-66CWP-67CWP-68CWP-69CWP-70CWP-71CWP-72CWP-73CWP-74CWP-75CWP-76CWP-77CWP-78CWP-79CWP-80CWP-81CWP-82CWP-83CWP-84CWP-85CWP-86CWP-87CWP-88CWP-89CWP-90CWP-91CWP-92CWP-93CWP-94CWP-95CWP-96CWP-97CWP-98CWP-99CWP-100CWP-101CWP-102CWP-103CWP-104CWP-105CWP-106CWP-107CWP-108CWP-109CWP-110CWP-111CWP-112CWP-113CWP-114CWP-115CWP-116CWP-117CWP-118CWP-119CWP-120CWP-121CWP-122CWP-123CWP-124CWP-125CWP-126CWP-127CWP-128CWP-129CWP-130CWP-131CWP-132CWP-133CWP-134CWP-135CWP-136CWP-137CWP-138CWP-139CWP-140CWP-141CWP-142CWP-143CWP-144CWP-145CWP-146CWP-147CWP-148CWP-149CWP-150CWP-151CWP-152CWP-153CWP-154CWP-155CWP-156CWP-157CWP-158CWP-159CWP-160CWP-161CWP-162CWP-163CWP-164CWP-165CWP-166CWP-167CWP-168CWP-169CWP-170CWP-171CWP-172CWP-173CWP-174CWP-175CWP-176CWP-177CWP-178CWP-179CWP-180CWP-181CWP-182CWP-183CWP-184CWP-185CWP-186CWP-187CWP-188CWP-189CWP-190CWP-191CWP-192CWP-193CWP-194CWP-195CWP-196CWP-197CWP-198CWP-199CWP-200Seroloidea
Seroloidea is a superfamily of marine isopod crustaceans within the suborder Sphaeromatidea. It comprises six families, four of which are extant and two extinct. The superfamily was established by Dana in 1852. Seroloidea is distinguished from other sphaeromatidean superfamilies by unique morphological characteristics of its constituent families, particularly the Serolidae.
Siphonostomatoida
Siphon-mouth Copepods
Siphonostomatoida is an order of copepods distinguished by siphon-like mandibles and a frontal filament used for host attachment. The order comprises 40 recognized families, with approximately 75% of all fish-parasitizing copepods belonging to this group. Most species are marine symbionts, though a few inhabit freshwater environments. Members exhibit diverse host associations, with 17 families parasitizing vertebrates (primarily fishes) and 23 families associated with invertebrates.
copepodparasitemarinefish-parasitesymbiontcrustaceanectoparasiteSiphonostomatoidabiodiversitySouthern-AfricaJapanBrazilsponge-associatecoral-associatedevelopmental-stageschalimusfrontal-filamentsiphon-mandibleAsterocheridaeLernaeopodidaePennellidaeHatschekiidaeSphyriidaeNotodelphyidaeBotryllophilidaeSphaeroma
pillbug, roly poly, marine pillbug
Sphaeroma is a genus of aquatic isopod crustaceans in the family Sphaeromatidae. These small crustaceans are commonly known as marine pillbugs or roly polies, though they are distinct from terrestrial isopods. The genus contains multiple species distributed across marine and estuarine environments globally. Some species, such as S. terebrans, are specialized wood-borers in mangrove habitats, while others inhabit rocky intertidal zones or construct burrows in soft sediments. The genus has been subject to recent taxonomic revision, with new species described from the northeastern Pacific and elsewhere.
Sphaeromatidae
seapills, Typical Seapills
Sphaeromatidae is a family of marine isopods commonly known as seapills, containing approximately 100 genera and 619 marine species with about 65 additional species in freshwater. Members are frequently encountered on rocky shores and in shelf waters of temperate zones. Many species exhibit dorsoventrally compressed body shapes, often with vaulted dorsums, though some are strongly flattened and scale-like. The family includes both free-living and symbiotic forms, with some genera associating with sponges or other marine organisms.
Sphaeromatidea
Seapills and allies
Sphaeromatidea is a suborder of isopod crustaceans established by Wägele in 1989, containing approximately 8587 recorded observations. The suborder comprises seven extant families across two superfamilies: Seroloidea (including Serolidae, Basserolidae, Bathynataliidae, and Plakarthriidae) and Sphaeromatoidea (including Sphaeromatidae, Ancinidae, and Tecticipitidae), plus three extinct families. Members exhibit substantial morphological diversity, with some species having colonized freshwater habitats from marine ancestors.
Sphaeromatoidea
Seapills
Sphaeromatoidea is a superfamily of isopod crustaceans commonly known as seapills. Members of this group are characterized by their ability to conglobate—roll into a ball when disturbed. The superfamily includes approximately 1,000 described species distributed across multiple families, primarily in marine and estuarine habitats. These isopods are distinguished from related groups by specific morphological features of the pleon and uropods.
Squillidae
Squillid Mantis Shrimps
Squillidae is the sole family in the superfamily Squilloidea, representing the most diverse family of mantis shrimps (Stomatopoda) in terms of genus-level diversity. Members are marine crustaceans characterized by raptorial appendages used for capturing prey. The type genus Squilla gives the family its name. This family encompasses numerous genera distributed primarily in shallow to moderately deep marine waters.
Stenasellidae
Stenasellidae is a family of stygobiotic (obligate subterranean aquatic) isopods in the suborder Asellota. The family comprises approximately 10 genera including Stenasellus, Metastenasellus, and Parastenasellus, with species distributed across groundwater habitats in Africa, the Middle East, southern Europe, and Southeast Asia. These crustaceans are exclusively adapted to life in continental underground waters including caves, wells, and interstitial aquifers. Their evolutionary history has been shaped by Quaternary climatic events including aridification in tropical zones and glaciations in temperate regions.
Stenopodidea
Coral and Glass Sponge Shrimps, Boxer Shrimps
Stenopodidea is a small infraorder of decapod crustaceans comprising 71 extant species in 12 genera, commonly known as coral and glass sponge shrimps or boxer shrimps. Despite their common names, they are distinct from both Caridea (true shrimp) and Dendrobranchiata (prawns), representing a separate lineage within Pleocyemata more closely related to reptant decapods such as lobsters and crabs. Members are characterized by a greatly enlarged third pair of pereiopods, non-branching gills, and egg-brooding reproduction. The group includes three fossil species, with the earliest known from the Devonian period.
Stenopus
boxer shrimp, coral shrimp, banded coral shrimp
Stenopus is a genus of marine decapod crustaceans comprising eleven described species, commonly known as boxer or coral shrimps. Members are characterized by enlarged, asymmetrical chelipeds used in defense and intraspecific combat. Several species, particularly Stenopus hispidus, are significant in the ornamental aquarium trade and function as cleaner organisms in reef ecosystems. The genus exhibits monogamous social structures and prominent agonistic behaviors mediated by dopamine and acetylcholine neuroendocrine pathways.
Stygobromus
Stygobromus is a genus of subterranean freshwater amphipods in the family Crangonyctidae, comprising 134 described species. The genus is primarily distributed in North America, with a smaller number of species in the Palearctic region including Siberia. Many species are narrow endemics restricted to specific groundwater systems, and several are listed as endangered or vulnerable by the IUCN; one species, S. lucifugus, is extinct.
Stygobromus pecki
Peck's cave amphipod
Stygobromus pecki is a small, eyeless, unpigmented cave-dwelling amphipod endemic to four spring systems in Comal County, Texas. It is a federally listed endangered species in the United States and classified as Endangered on the IUCN Red List due to its extremely limited geographic distribution. The species inhabits subterranean limestone aquifers and exhibits adaptations typical of stygobitic organisms, including light sensitivity and starvation resistance. Very few individuals have been documented since its listing, and no formal recovery plan or comprehensive population assessment exists as of 2022.
Synaptotanais
Synaptotanais is a genus of tanaidacean crustaceans in the family Tanaididae, established by Sieg in 1980. The genus contains at least two described species: Synaptotanais abyssorum, described from deep-sea habitats in 1913, and Synaptotanais notabilis, described in 1981. As members of Tanaididae, these are small, benthic peracarid crustaceans.
Talitridae
Sandhoppers, Landhoppers
Talitridae is a family of amphipod crustaceans encompassing diverse ecological forms including beach-dwelling sandhoppers, terrestrial landhoppers, and specialized driftwood hoppers. Members occupy habitats ranging from marine intertidal zones to fully terrestrial environments in rainforest leaf litter and caves. The family exhibits remarkable physiological adaptations for desiccation resistance and aerial respiration, with some Southern Hemisphere species being entirely terrestrial. Ecological diversity within Talitridae includes wrack generalists, psammophilic burrowers, palustral salt marsh dwellers, xylophagous driftwood specialists, and freshwater forms.
Tanaidacea
Tanaids
Tanaidacea is a minor order of small, shrimp-like crustaceans within the class Malacostraca. The group contains approximately 940 described species, ranging from 0.5 to 120 mm in adult size. Tanaids are primarily marine benthic organisms that inhabit bottom sediments, with a few species occurring in freshwater. They exhibit direct development without a planktonic larval stage, with young emerging from the maternal marsupium as post-larvae called mancas. The fossil record extends to the Carboniferous period.
Tanaididae
Tanaididae is a family of small benthic malacostracan crustaceans in the order Tanaidacea, containing approximately 19 genera and more than 90 described species. Members are strictly benthic with low dispersal capacity. Some species colonize artificial structures and fouling communities, with demonstrated potential for transport between geographically distant sites. Life history traits vary significantly with environmental conditions, including pollution levels, pH, and oxygen availability.
Tanais
Tanais is a genus of small marine crustaceans in the order Tanaidacea, family Tanaididae. These benthic organisms inhabit shallow to moderately deep coastal waters, where they burrow in or crawl on soft sediments. The genus was established by Latreille in 1831 and remains taxonomically valid with accepted status in major databases. Tanaidaceans are characterized by a cylindrical body form and specialized mouthparts adapted for deposit feeding.
Tanais dulongii
Tanais dulongii is a small benthic tanaid crustacean with a strictly benthic life cycle and low dispersal capacity. It is widely distributed across temperate coastal waters of the Atlantic, Mediterranean, and Indian Oceans. Populations exhibit continuous reproduction with year-round presence of reproductive individuals and juveniles, and show plasticity in life history traits in response to environmental quality.
Tecticipitidae
Hidehorns
Tecticipitidae is a family of marine isopod crustaceans established by Iverson in 1982. The family belongs to the suborder Sphaeromatidea and is commonly referred to as "Hidehorns." As a sphaeromatid family, its members are likely characterized by body forms adapted to living in interstitial spaces or under hard substrates in marine environments. The family is poorly represented in public biodiversity databases, with only nine observations recorded on iNaturalist and no distribution records available through GBIF.
Thermosphaeroma
Thermosphaeroma is a genus of isopod crustaceans in the family Sphaeromatidae, endemic to thermal springs of the southwestern United States and central Mexico. The genus contains nine described species, most of which are critically endangered or extinct in the wild due to groundwater extraction and habitat alteration. These isopods exhibit specialized adaptations to thermo-mineral spring environments, including temperature-dependent life histories and pronounced sexual dimorphism in uropod morphology. Several species have been studied for their complex social behaviors, including precopulatory mate-guarding and cannibalism.
Tylos
Calloused Beach Pillbugs
Tylos is a genus of terrestrial isopods (woodlice) in the family Tylidae, commonly known as calloused beach pillbugs. These crustaceans are specialized inhabitants of sandy coastal environments, living in the supralittoral zone above the driftline on ocean beaches. They exhibit remarkable adaptations for life in this harsh habitat, including powerful burrowing abilities, strong desiccation resistance, and behavioral synchronization with tidal and diel cycles. Most species are nocturnal, emerging at night to feed on beach-cast organic material such as kelp and other detritus.
Uca pugilator
sand fiddler crab, Atlantic sand fiddler crab, Calico fiddler
Leptuca pugilator is a temperate fiddler crab species found on the Atlantic coast of North America, from Massachusetts to the Gulf of Mexico. It inhabits intertidal mudflats and sandy estuarine shores, where it constructs burrows and occurs in extremely high densities. Males possess one dramatically enlarged claw used for territorial defense and combat with rival males. The species was transferred from genus Uca to Leptuca in 2016 based on phylogenetic evidence.
Uca pugnax
Atlantic marsh fiddler crab, mud fiddler crab, Atlantic mud fiddler crab, marsh fiddler crab
Minuca pugnax is a small intertidal crab native to Atlantic coast salt marshes of North America. Males possess one dramatically enlarged yellow claw used for signaling and combat, while females have two small claws. The species exhibits sexual dimorphism in body size and coloration. It constructs burrows in muddy substrates and has been observed in both low-marsh and, more recently, high-marsh habitats. Larval development includes five zoeal stages and one megalopal stage before settlement.
Ucides cordatus
swamp ghost crab, caranguejo-uçá, Atlantic mangrove ghost crab
Ucides cordatus is a large mangrove crab endemic to the Atlantic coast of the Americas, ranging from Florida to Uruguay. It is one of two species in the genus Ucides and holds substantial economic and ecological importance, particularly in Brazil where it supports artisanal fisheries. The species exhibits pronounced sexual dimorphism, with females typically larger than males and differing in carapace coloration. Population declines have been documented since 1988 due to overharvesting, habitat loss, and disease.
Unciolidae
Unciolidae is a family of marine amphipod crustaceans comprising approximately 9 genera and over 20 described species. The family has a worldwide distribution with records from deep-sea environments in the North Atlantic and shallow tropical waters such as the Great Barrier Reef. Members of this family exhibit diverse habitat preferences, from abyssal depths exceeding 2000 meters to coastal reef systems.