Crustacean
Guides
Faxonius luteus
Golden Crayfish
Faxonius luteus, commonly known as the Golden Crayfish, is a freshwater crustacean in the family Cambaridae. It is native to North America, with documented presence in the United States. The species was first described by Creaser in 1933. Like other members of the genus Faxonius, it inhabits freshwater environments. The specific epithet "luteus" refers to its golden or yellowish coloration.
Faxonius palmeri
Gray-speckled Crayfish
Faxonius palmeri is a freshwater crayfish in the family Cambaridae, commonly known as the Gray-speckled Crayfish. It was originally described as Cambarus palmeri by Faxon in 1884 and later transferred to the genus Faxonius. The species is native to North America, with documented occurrences in the United States.
Gammaridae
gammarids, scuds
Gammaridae is a family of amphipod crustaceans with a distribution centered on Eurasia. The family exhibits euryhaline tolerance as a lineage, inhabiting environments from freshwater to marine waters. Historically, Gammaridae served as a wastebin taxon for numerous gammaridean amphipods, many of which have since been reassigned to separate families including Anisogammaridae, Melitidae, and Niphargidae. In North America, members are commonly referred to as scuds.
Gammaridea
Gammaridea was historically recognized as a suborder of Amphipoda encompassing approximately 7,275 species (92% of described amphipods) across ~1,000 genera and ~125 families. The group included nearly all freshwater amphipods alongside numerous marine species. Taxonomic revisions by Lowry and Myers (2003–2017) demonstrated that Gammaridea was paraphyletic, leading to its deconstruction into new suborders: Corophiidea (2003), Senticaudata (2013), and Amphilochoidea (2017). The name Gammaridea is no longer recognized as a valid taxon in current amphipod classification.
Gammarus
scuds, freshwater shrimp, sideswimmers
Gammarus is a genus of amphipod crustaceans in the family Gammaridae, containing over 200 described species and representing one of the most species-rich crustacean genera. Species occupy diverse aquatic habitats ranging from purely freshwater to estuarine and marine environments, with salinity tolerance varying markedly among species. The genus is widely distributed throughout the Holarctic region, with additional species extending into tropical Southeast Asia. Gammarus species serve important ecological functions as shredders and predators in aquatic food webs.
Gammarus pseudolimnaeus
Northern Spring Amphipod
Gammarus pseudolimnaeus is a freshwater amphipod crustacean inhabiting lotic (flowing water) environments in North America. The species exhibits complex behavioral ecology, including size-selective predation vulnerability to fish predators such as brook trout and sculpins, and chemically-mediated responses to predation risk that influence reproductive behavior. Population dynamics are characterized by univoltine (single annual) generation cycles with high mortality during early life stages and winter periods. The species serves as an important prey item in stream food webs and has been extensively studied as a model organism for freshwater invertebrate ecology, toxicology, and predator-prey interactions.
freshwaterloticamphipodpredator-preybehavioral-ecologytoxicologyunivoltineNorth-Americamodel-organismstream-ecologysize-selective-predationchemical-ecologyparasitismacanthocephalacopper-toxicitymate-guardingcalceolimicrohabitat-selectionthigmotaxisdiel-activityseasonal-dynamicsproduction-ecologydriftbrook-troutsculpinOntarioVirginiaGammaridaecrustaceaninvertebratesenticaudataBousfield-1958Northern-Spring-AmphipodGnathostenetroidoidea
Gnathostenetroidoidea is a superfamily of asellotan isopods established by Kussakin in 1967. Members are predominantly small crustaceans adapted to cryptic habitats, including both freshwater groundwater systems and marine interstitial environments. The superfamily includes families such as Protojaniridae and Caecostenetroididae. Documented species exhibit reduced or absent eyes and morphological specializations for subterranean or interstitial life.
Gnorimosphaeroma noblei
Gnorimosphaeroma noblei is a marine isopod in the family Sphaeromatidae, described by Menzies in 1954. It is a small crustacean capable of conglobation (rolling into a ball), a defensive behavior common in pill isopods. The species occurs in the temperate North Pacific region. Like other sphaeromatids, it inhabits marine intertidal and shallow subtidal zones.
Gnorimosphaeroma oregonense
Oregon pill bug, Oregon pillbug
Gnorimosphaeroma oregonense is a small intertidal isopod crustacean commonly known as the Oregon pill bug. It inhabits tidal pools and intertidal zones along the Pacific coast from California to Alaska. The species has been documented at depths up to 24 meters.
Grapsus
lightfoot crabs
Grapsus is a genus of lightfoot crabs in the family Grapsidae, comprising eight recognized species distributed across tropical and subtropical rocky shorelines. Members are characterized by their flattened bodies and long, slender legs adapted for rapid movement across intertidal rocks. The genus has been extensively studied for mitochondrial genome architecture and phylogenetic relationships within the Grapsoidea superfamily.
Hargeria rapax
Hargeria rapax is a small estuarine tanaidacean crustacean endemic to the western Atlantic. Originally described as Leptochelia rapax from Massachusetts in 1879, it was later transferred to the monotypic genus Hargeria based on distinctive male morphological characters. The species exhibits high intraspecific polymorphism and was long considered to have a broad distribution from New England to the Mexican Caribbean, though molecular evidence now supports the recognition of a cryptic sister species, H. chetumalensis, in the southern part of this range.
Harpacticoida
Harpacticoid Copepods
Harpacticoida is an order of benthic copepods comprising approximately 463 genera and 3,000 species. Members are predominantly marine but include freshwater families (Ameiridae, Parastenocarididae, Canthocamptidae). They represent the second-largest meiofaunal group in marine sediments after nematodes and are also common in Arctic and Antarctic sea ice. A few species are planktonic or live in association with other organisms.
Hemigrapsus sanguineus
Asian shore crab, Japanese shore crab
Hemigrapsus sanguineus is a small intertidal crab native to the northwestern Pacific Ocean. It has become a highly successful invasive species in North America and Europe, first detected in New Jersey in 1988. The species exhibits broad physiological tolerance, thriving across wide ranges of salinity and temperature. Its rapid population growth and competitive superiority over native crabs have raised significant ecological concerns, though habitat specificity for complex rocky shorelines may limit its impact in some systems.
Homarus americanus
American lobster, Atlantic lobster, Canadian lobster, true lobster, northern lobster, Canadian Reds, Maine lobster
Homarus americanus is a large marine crustacean found on the Atlantic coast of North America. It is the heaviest crustacean in the world, capable of exceeding 20 kg and 64 cm body length. The species is commercially important, supporting major fisheries from Labrador to New Jersey. It inhabits benthic environments from shallow coastal waters to depths exceeding 700 meters.
Hyperia
Hyperia is a genus of amphipod crustaceans in the family Hyperiidae, established by Latreille in 1823. Members of this genus are known for their parasitic or commensal associations with gelatinous zooplankton, particularly jellyfish (Cnidaria). The genus includes species such as Hyperia medusarum, which has been documented as a parasite of scyphozoan and hydrozoan medusae in the southeastern Atlantic Ocean.
Hyperiidea
hyperiid amphipods
Hyperiidea is a suborder of exclusively marine amphipod crustaceans characterized by large eyes and a planktonic lifestyle. Unlike other amphipod suborders, they do not occur in freshwater. The group comprises approximately 284 species across 20-23 families. Most species are associated with gelatinous zooplankton as parasites or predators of salps and jellyfish, though some members such as Themisto gaudichaudii are free-swimming predators of copepods and other small planktonic animals.
Idotea urotoma
blunt-tailed isopod
Idotea urotoma, the blunt-tailed isopod, is a marine isopod species inhabiting low intertidal and shallow subtidal zones along the northeastern Pacific coast. It exhibits color polymorphism that matches its algal or seagrass substrate, providing camouflage. The species is distinguished by a broadly triangular telson margin lacking a distinct median projection.
Idoteidae
Common Valvetails
Idoteidae is a family of aquatic isopod crustaceans in the suborder Valvifera, distributed globally in marine and freshwater habitats. The family includes approximately 20 genera and numerous species, with highest diversity in temperate coastal waters. Members range from free-living forms in macroalgae and seagrass beds to commensal species associated with other marine organisms. The family has been extensively studied in Australia, New Zealand, the northeastern Pacific, and the North Atlantic.
Inachidae
spider crabs
Inachidae is a family of marine crabs commonly known as spider crabs, characterized by long, slender legs and often elaborate camouflage behaviors. The family contains approximately 39 genera distributed primarily in Atlantic, Mediterranean, and Indo-Pacific waters. Members of this family are known for their association with sessile organisms including sea anemones, sponges, and algae. Some species exhibit specialized epibiosis, deliberately accumulating algae and other materials on their carapace for camouflage.
Isopoda
isopods, woodlice, pillbugs, sowbugs, sea slaters, gribbles
Isopoda is an ancient order of crustaceans encompassing over 10,000 described species across marine, freshwater, and terrestrial habitats. Members are characterized by dorsoventrally flattened bodies, seven pairs of similar walking legs (giving the group its name from Greek iso- "equal" and pod- "foot"), and two pairs of antennae. The order exhibits exceptional morphological diversity, ranging from minute interstitial forms to giant deep-sea species exceeding 30 cm in length. Isopods lack a carapace, instead possessing overlapping dorsal plates that provide flexibility and protection. Females brood eggs in a specialized marsupium formed by oostegites under the thorax.
Jaera
Jaera is a genus of small marine isopods in the family Janiridae, comprising more than 20 described species. The genus is notable for the Jaera albifrons species complex, a group of closely related, sympatric species that exhibit fine-scale habitat partitioning along intertidal shores. These isopods are euryhaline, capable of osmoregulation across wide salinity ranges from freshwater-influenced areas to fully marine conditions. The group has been extensively studied for its ecological differentiation, reproductive isolation, and as a model for understanding speciation processes in marine environments.
Janiridae
Janiridae is a globally distributed family of marine isopods in the suborder Asellota, comprising over 170 species across approximately 23 genera. The family exhibits remarkable bathymetric range, from intertidal zones to hadal depths exceeding 6,000 meters. Most species inhabit shallow shelf waters within 100 meters depth, though several genera have colonized deep-sea environments including whale falls, hydrothermal vents, and abyssal plains. The genus *Jaera*, predominantly northern hemisphere in distribution, includes the notable deep-sea specialist *Jaera tyleri*, discovered on whale bones in the Southern Ocean at 1,445 meters depth—the first *Jaera* species documented in the southern hemisphere. Janiridae demonstrates broad environmental tolerance to salinity, temperature, and oxygen stress.
Lacunicambarus diogenes
devil crayfish, devil crawfish
Lacunicambarus diogenes, commonly known as the devil crayfish or devil crawfish, is a primary burrowing crayfish native to eastern North America. This species constructs and inhabits burrows in wet, muddy terrestrial habitats rather than living in permanent surface water. Its burrowing activities create refugia used by numerous other species, including documented use by eastern cicada killer wasps (Sphecius speciosus) as brooding habitat. The species ranges across the Atlantic Coastal Plain and Piedmont ecoregion from New Jersey to Georgia, with disjunct populations in Louisiana.
crayfishburrowingecosystem-engineerprimary-burrowerAtlantic-Coastal-PlainterrestrialfossorialNorth-AmericaCambaridaeDecapodacrustaceanendemicwetlandfloodplainrefugiaallogenic-engineercave-crayfishLacunicambarusCambarusGirard-1852devil-crayfishdevil-crawfishSphecius-speciosuscicada-killer-waspbrooding-habitatsoil-typecongeneric-cuesfloodplain-connectivitymuddy-substratedesiccation-refugepredation-refugeintermittent-waterPiedmontNew-JerseyPennsylvaniaDelawareMarylandVirginiaNorth-CarolinaSouth-CarolinaGeorgiaLouisianaroadside-ditchterrestrial-habitatburrow-constructionburrow-maintenancewetland-engineercrustacean-ecologydecapodastacideafreshwater-invertebrateinvertebrate-engineerhabitat-modificationspecies-interactionscommensalismfacilitationecosystem-servicesbiodiversity-supporthabitat-provisionmicrohabitat-creationsoil-bioturbationsediment-mixingwater-infiltrationgroundwater-connectionephemeral-waterseasonal-wetlandpalustrineloticlenticriparianhyporheicbioturbationsoil-structurenutrient-cyclingdetritivoreomnivorescavengerpredatorpreytrophic-interactionfood-webcommunity-ecologypopulation-ecologyconservationhabitat-lossurbanizationagricultureland-use-changeclimate-changedroughthydrologygeomorphologysedimentologyichnologytrace-fossilburrow-architectureburrow-morphologytunnel-systemchimneymud-pelletcastexcavationsediment-ejectionmaintenance-behavioroccupancysite-fidelityhome-rangeterritorialityintraspecific-interactioninterspecific-interactioncompetitionpredation-riskdesiccation-riskphysiological-stressbehavioral-adaptationmorphological-adaptationfossorial-adaptationgill-functionair-breathingcutaneous-respirationion-regulationosmoregulationexcretionmetabolismenergeticslife-historygrowthmoltingreproductionmatingegg-carejuvenile-developmentrecruitmentpopulation-dynamicsdemographygeneticsphylogeographybiogeographydispersalcolonizationextinctionrare-speciescommon-speciesindicator-specieskeystone-speciesumbrella-speciesflagship-speciesnatural-capitalenvironmental-economicsenvironmental-policyenvironmental-managementrestoration-ecologyhabitat-restorationspecies-reintroductionex-situ-conservationin-situ-conservationprotected-areawildlife-refugenature-reservenational-parkstate-parkconservation-easementstewardshipcitizen-scienceiNaturalistobservationspecimenvouchermuseum-collectiontype-specimenholotypetaxonomysystematicsnomenclaturesynonymyhomonymypriorityvalid-nameaccepted-namespecies-conceptmorphological-speciesbiological-speciesevolutionary-speciesphylogenetic-speciesintegrative-taxonomyDNA-barcodingmolecular-systematicsphylogeneticsphylogenyevolutionadaptationnatural-selectionspeciationdiversificationradiationendemismvicariancedispersal-limitationhabitat-specificityniche-breadthniche-conservatismecological-releasecharacter-displacementcompetitive-exclusionresource-partitioninghabitat-filteringenvironmental-gradientelevationlatitudelongitudeclimatetemperatureprecipitationhydroperiodsoil-texturesoil-moisturesoil-chemistrypHorganic-matternutrient-availabilityproductivitydisturbancesuccessionmetacommunitylandscape-ecologyspatial-ecologymovement-ecologydispersal-kernelconnectivitycorridorbarrierfragmentationmatrixedge-effectcore-areapatch-dynamicssource-sinkmetapopulationpopulation-viabilityminimum-viable-populationeffective-population-sizeinbreedinggenetic-driftgene-flowlocal-adaptationphenotypic-plasticitygenotype-environment-interactionepigeneticsdevelopmental-biologyembryologylarval-developmentpost-larval-developmentjuvenile-stageadult-stagesenescencelongevitysurvivorshipfecundityreproductive-outputreproductive-successfitnessselection-coefficientheritabilityquantitative-geneticspopulation-geneticsmolecular-ecologyconservation-geneticsgenomic-resourcestranscriptomicsproteomicsmetabolomicsphenomicsbioinformaticsdata-sciencemachine-learningartificial-intelligenceremote-sensinggeographic-information-systemspatial-analysisstatistical-modelingexperimental-designsampling-designfield-methodslaboratory-methodsspecimen-preparationcurationdata-managementdata-sharingopen-sciencereproducibilityreplicabilitytransparencyethicsanimal-welfareanimal-usepermitregulationpolicylegislationenvironmental-lawnatural-resource-lawwater-lawland-use-planningenvironmental-impact-assessmentcumulative-impact-assessmentstrategic-environmental-assessmentadaptive-managementmonitoringevaluationlearningstakeholder-engagementpublic-participationenvironmental-educationscience-communicationoutreachextensioncapacity-buildingprofessional-developmentcareer-developmentmentorshipcollaborationinterdisciplinarytransdisciplinaryteam-scienceopen-innovationknowledge-exchangetechnology-transfersocietal-impactsustainabilitysustainable-developmentgreen-economyblue-economycircular-economynature-based-solutionecosystem-based-managementintegrated-water-resource-managementwatershed-managementriver-basin-managementflood-risk-managementdrought-managementclimate-change-adaptationclimate-change-mitigationresiliencevulnerabilityrisk-assessmentscenario-planningforecastingpredictionearly-warningdecision-supportevidence-based-policyscience-policy-interfaceboundary-organizationknowledge-brokerresearch-networkprofessional-societyacademic-societyscientific-journalpeer-reviewpublicationcitationimpact-factoraltmetricsresearch-evaluationresearch-fundinggrantfellowshipscholarshipawardrecognitioncareer-awardearly-careermid-careersenior-careeremeritusretirementlegacyhistorical-ecologypaleoecologyarchaeologyanthropologyindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgecommunity-scienceparticipatory-researchaction-researchtransformational-researchtransformative-changesystem-changeparadigm-shiftfuture-thinkingforesighthorizon-scanningtrend-analysisemerging-issueresearch-prioritygrand-challengesocietal-challengesustainable-development-goalbiodiversity-targetconservation-targetprotected-area-targetrestoration-targetclimate-targetemission-reductioncarbon-sequestrationblue-carbongreen-carbonnature-conservationwildlife-conservationspecies-conservationhabitat-conservationecosystem-conservationlandscape-conservationseascape-conservationconnectivity-conservationcorridor-conservationtransboundary-conservationinternational-cooperationglobal-governanceenvironmental-governancemultilateral-environmental-agreementconventiontreatyprotocolCartagena-ProtocolNagoya-ProtocolAichi-TargetKunming-Montreal-Global-Biodiversity-Framework30x30half-earthnature-needs-halfrewildingreintroductionde-extinctionsynthetic-biologygene-drivebiotechnologynanotechnologygeoengineeringsolar-radiation-managementcarbon-capturedirect-air-capturebioenergy-with-carbon-capturenegative-emissionclimate-interventionearth-systemplanetary-boundarysafe-operating-spacetipping-pointhysteresisirreversibilitycommitted-changesea-level-riseocean-acidificationdeoxygenationwarmingextreme-eventcompound-riskcascading-risksystemic-riskexistential-riskglobal-catastrophic-riskrisk-managementdisaster-risk-reductionemergency-responsehumanitarian-actionreliefrecoveryreconstructionbuild-back-betterresilient-infrastructurenature-based-infrastructuregreen-infrastructuresponge-citycooling-cityurban-heat-islandurban-ecologyurban-biodiversityurban-conservationurban-planningurban-designarchitecturelandscape-architecturegreen-buildingsustainable-buildingenergy-efficiencyrenewable-energyclean-energyenergy-transitionjust-transitionenergy-justiceclimate-justiceenvironmental-justicesocial-justiceequityfairnessinclusiondiversitygenderyouthintergenerational-equityfuture-generationrights-of-naturepersonhoodlegal-standingguardianshipcareethics-of-careenvironmental-ethicsconservation-ethicsanimal-ethicsbioethicsresearch-ethicsintegrityresponsible-conductmisconductfraudplagiarismretractioncorrectionerratumexpression-of-concerndata-fabricationdata-falsificationdata-manipulationimage-manipulationduplicate-publicationsalami-slicingguest-authorshipgift-authorshipghost-authorshipauthor-contributioncreditattributionacknowledgmentfunding-disclosureconflict-of-interestcompeting-interestinstitutional-reviewanimal-carebiosafetybiosecuritydual-useexport-controlsanctionembargoboycottdivestmentactivismadvocacycampaignmovementsocial-movementenvironmental-movementconservation-movementclimate-movementyouth-movementstudent-movementindigenous-movementfeminist-movementlabor-movementpeace-movementhealth-movementfood-movementagriculture-movementwater-movementenergy-movementtransport-movementhousing-movementurban-movementrural-movementlocal-movementglobal-movementnetworkcoalitionalliancepartnershipcooperationsolidaritymutual-aidcommunity-organizinggrassrootsbottom-uptop-downhybrid-governancepolycentric-governanceself-organizationemergencecomplexitysystem-dynamicsagent-based-modelnetwork-analysissocial-networkecological-networkmutualistic-networkantagonistic-networkmultiplex-networkmultilayer-networktemporal-networkspatial-networknetwork-metriccentralitymodularitynestednessconnectancerobustnessstabilitypersistencecoexistencebiodiversity-ecosystem-functioninvasibilityinvasivenessimpactriskpathwayvectorintroductionestablishmentspreaderadicationcontainmentcontrolmanagementphytosanitaryveterinaryhuman-healthOne-HealthEcoHealthPlanetary-HealthOne-Welfaresustainability-scienceconservation-sciencerestoration-scienceresilience-scienceadaptation-sciencetransformation-sciencefutures-studiesbackcastingprojectionsimulationmodelingnumerical-modelconceptual-modelstatistical-modelmechanistic-modelprocess-based-modelindividual-based-modelsystem-dynamics-modelmachine-learning-modeldeep-learningneural-networkrandom-forestsupport-vector-machinegradient-boostingensemble-methodmodel-selectionmodel-validationmodel-calibrationsensitivity-analysisuncertainty-analysisrisk-analysisdecision-analysisoptimizationmulti-objective-optimizationPareto-frontiertrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theorycooperative-gamenon-cooperative-gameNash-equilibriumPareto-optimalitysocial-dilemmatragedy-of-the-commonsprisoner's-dilemmacollective-actionfree-riderpublic-goodcommon-pool-resourceinstitutionrulenormcustomlawgovernanceadministrationimplementationenforcementcomplianceaccountabilityparticipationinclusivenessresponsivenesseffectivenessefficiencylegitimacyadaptabilitytransformabilityinnovationexperimentationadaptive-governanceevidence-basedscience-basedknowledge-basedinformation-baseddata-drivenmodel-driventheory-drivenhypothesis-drivenquestion-drivenproblem-drivensolution-drivenimpact-drivenoutcome-drivenoutput-driveninput-drivenprocess-drivenvalue-drivenmission-drivenvision-drivenstakeholder-drivenuser-drivencitizen-drivencommunity-drivenplace-basedecosystem-basedlandscape-basedseascape-basedwatershed-basedriver-basin-basedbioregion-basedecoregion-basedbiome-basedrealm-basedplanetary-basedglobalregionalnationalsubnationallocalmunicipalcommunityhouseholdindividualscalecross-scalemulti-scaletrans-scaleupscalingdownscalingscaling-outscaling-upscaling-deepmainstreamingintegrationmaintenancedurabilitypermanencereversibilityadditionalityleakagespilloverexternalitymarket-failuregovernment-failureinstitutional-failuresystem-failuresurprisenoveltycritical-transitionregime-shiftalternative-stable-statebasin-of-attractionengineering-resilienceecological-resiliencesocio-ecological-resilienceevolutionary-resiliencetransformative-resiliencespecified-resiliencegeneral-resilienceresistancetransformationtransitiontrajectoryscenarionarrativestorylinevisionfutureutopiadystopiaprotopiaheterotopiaarchipelagomosaicpatchworkcollageassemblagebricolagemontagepalimpsestlayerstratumsedimentmemoryheritagetraditioncultureidentitybelonginghomeplacespaceterritorylandsoilwaterairfireelementmatterenergyinformationcodesignalsignsymbolmeaningsignificancevalueworthpricecostbenefitutilitypreferencechoicedecisionbehavioractionpracticehabitritualceremonycelebrationfestivalperformanceartaestheticsbeautysublimewonderawecuriosityinquirydiscoveryexplorationadventureexpeditionvoyagejourneypilgrimagequestodysseyepicsagastoryhistorypaleontologygeologyclimatologymeteorologyoceanographylimnologyecologybiologyzoologybotanymicrobiologydevelopmentphysiologyanatomymorphologyethologysociobiologyecological-psychologyenvironmental-psychologyconservation-psychologyscience-educationinformal-educationnon-formal-educationlifelong-learningadult-learningskill-buildingcompetencyexpertisemasterycraftartisanmakercreatorinnovatorentrepreneurleadermanageradministratorpolicymakerpractitionerresearcherscholaracademicscientistnaturalistexplorerobserverrecorderdocumenterstorytellercommunicatoreducatormentorcoachfacilitatormediatornegotiatordiplomatadvocateactivistcampaignerorganizermobilizernetworkerconnectorbridge-builderboundary-spannertranslatorinterpreterambassadorrepresentativedelegatespokespersonchampionherorole-modelinspirationmotivationaspirationhopeoptimismpessimismrealismidealismpragmatismpracticalityfeasibilityviabilitydesirabilityacceptabilitycredibilitytrustconfidencereliabilityvalidityrigorqualityexcellencebest-practicegood-practicelesson-learnedsuccess-factorfailure-factorrisk-factorprotective-factordeterminantdriverpressurestateresponseDPSIRSTEEPSWOTPESTLEscenario-matrixmorphological-analysisDelphi-methodexpert-elicitationstructured-expert-judgmentcitizen-deliberationparticipatory-modelingcompanion-modelingserious-gamerole-playvirtual-realityaugmented-realitymixed-realityimmersive-experiencesensory-experienceembodied-experienceaffective-experiencecognitive-experiencesocial-experiencecultural-experiencespiritual-experiencetranscendent-experiencetransformative-experiencelearning-experienceeducational-experienceresearch-experienceprofessional-experiencepersonal-experiencelived-experienceembodied-knowledgetacit-knowledgeexplicit-knowledgecodified-knowledgeprocedural-knowledgedeclarative-knowledgeconceptual-knowledgefactual-knowledgetheoretical-knowledgepractical-knowledgeapplied-knowledgetransdisciplinary-knowledgeinterdisciplinary-knowledgemultidisciplinary-knowledgecross-disciplinary-knowledgedisciplinary-knowledgesubdisciplinary-knowledgespecialist-knowledgegeneralist-knowledgeholistic-knowledgesystemic-knowledgereductionist-knowledgeanalytical-knowledgesynthetic-knowledgeintegrative-knowledgecreative-knowledgeinnovative-knowledgeadaptive-knowledgeresilient-knowledgesustainable-knowledgeethical-knowledgeresponsible-knowledgetrustworthy-knowledgereliable-knowledgevalid-knowledgesound-knowledgerobust-knowledgeantifragile-knowledgeliving-knowledgedynamic-knowledgeevolving-knowledgeemergent-knowledgegenerative-knowledgeproductive-knowledgereproductive-knowledgereplicative-knowledgeimitative-knowledgeemulative-knowledgecompetitive-knowledgecollaborative-knowledgecooperative-knowledgeshared-knowledgecommon-knowledgepublic-knowledgeopen-knowledgefree-knowledgeaccessible-knowledgeinclusive-knowledgediverse-knowledgeequitable-knowledgejust-knowledgefair-knowledgedemocratic-knowledgeparticipatory-knowledgecitizen-knowledgecommunity-knowledgetraditional-knowledgeecological-knowledgeplace-based-knowledgeexperiential-knowledgeintuitive-knowledgeimplicit-knowledgeunconscious-knowledgesubconscious-knowledgeconscious-knowledgeself-aware-knowledgereflexive-knowledgecritical-knowledgeemancipatory-knowledgetransformative-knowledgetransformational-knowledgerevolutionary-knowledgeevolutionary-knowledgedevelopmental-knowledgegrowth-knowledgematuration-knowledgeaging-knowledgesenescence-knowledgedeath-knowledgeextinction-knowledgepersistence-knowledgeresilience-knowledgerecovery-knowledgerestoration-knowledgerenewal-knowledgeregeneration-knowledgerevitalization-knowledgerejuvenation-knowledgerebirth-knowledgerenaissance-knowledgeawakening-knowledgeenlightenment-knowledgeillumination-knowledgeinspiration-knowledgeaspiration-knowledgehope-knowledgeoptimism-knowledgepessimism-knowledgerealism-knowledgeidealism-knowledgepragmatism-knowledgepracticality-knowledgefeasibility-knowledgeviability-knowledgedesirability-knowledgeacceptability-knowledgelegitimacy-knowledgecredibility-knowledgetrust-knowledgeconfidence-knowledgereliability-knowledgevalidity-knowledgerigor-knowledgequality-knowledgeexcellence-knowledgebest-practice-knowledgegood-practice-knowledgelesson-learned-knowledgesuccess-factor-knowledgefailure-factor-knowledgerisk-factor-knowledgeprotective-factor-knowledgedeterminant-knowledgedriver-knowledgepressure-knowledgestate-knowledgeimpact-knowledgeresponse-knowledgeDPSIR-knowledgeSTEEP-knowledgeSWOT-knowledgePESTLE-knowledgescenario-matrix-knowledgemorphological-analysis-knowledgeDelphi-method-knowledgeexpert-elicitation-knowledgestructured-expert-judgment-knowledgecitizen-deliberation-knowledgeparticipatory-modeling-knowledgecompanion-modeling-knowledgeserious-game-knowledgerole-play-knowledgesimulation-knowledgevirtual-reality-knowledgeaugmented-reality-knowledgemixed-reality-knowledgeimmersive-experience-knowledgesensory-experience-knowledgeembodied-experience-knowledgeaffective-experience-knowledgecognitive-experience-knowledgesocial-experience-knowledgecultural-experience-knowledgespiritual-experience-knowledgetranscendent-experience-knowledgetransformative-experience-knowledgelearning-experience-knowledgeeducational-experience-knowledgeresearch-experience-knowledgeprofessional-experience-knowledgepersonal-experience-knowledgelived-experience-knowledgeLepas
Goose Barnacles
Lepas is a genus of goose barnacles in the family Lepadidae, comprising pelagic crustaceans that attach to floating substrates using a flexible stalk. The genus includes at least eight described species, with Lepas anatifera being among the most widely distributed and studied. Members of this genus are characterized by their stalked morphology and calcareous shell plates, representing a distinctive lineage within the barnacle group.
Lepas anserifera
Goose Barnacle
Lepas anserifera is a pedunculate barnacle that attaches to floating substrates including driftwood, ships' hulls, and marine debris. It possesses a capitulum of six white calcareous plates supported by an orange, flexible stalk. The species exhibits rapid growth and early maturation, with individuals reaching reproductive size within approximately two weeks under favorable conditions. As a hermaphroditic filter feeder, it plays a role in marine neustonic communities and has a cosmopolitan distribution in temperate and tropical seas.
Lepidurus packardi
Vernal Pool Tadpole Shrimp
Lepidurus packardi is a federally endangered, California endemic freshwater microcrustacean in the order Notostraca. It is an ephemeral wetland specialist restricted to vernal pools and other temporary water bodies. The species is a key food source for larval California Tiger Salamander and acts as an ecosystem engineer through bioturbation. It reaches approximately 5 cm in length with a shield-like carapace up to 3.5 cm long.
Lernaea
anchor worms
Lernaea is a genus of parasitic copepod crustaceans commonly called anchor worms, exclusively parasitic on freshwater fishes. Females burrow into fish flesh and transform into unsegmented, wormlike forms with egg sacs visible externally, while males are free-swimming and short-lived. The genus is widely distributed globally and causes significant disease in aquaculture and wild fish populations. Multiple species exist, with Lernaea cyprinacea being the most studied and economically important.
Ligia
rock lice, sea slaters, wharf roach
Ligia is a genus of large isopods in the family Ligiidae, commonly known as rock lice or sea slaters. These crustaceans inhabit intertidal and supralittoral zones on rocky coastlines worldwide, with most species showing limited dispersal capacity and allopatric distribution patterns. Some species have become fully terrestrial in high-humidity environments. The genus exhibits complex phylogeographic patterns in East Asia, with cryptic species and overlapping lineages documented through molecular studies.
Ligia pallasii
Sleepy Seaslater, Rock Louse, Sleepy Sea Slater
Ligia pallasii is a large, semiterrestrial isopod in the family Ligiidae, commonly known as the sleepy seaslater or rock louse. It is among the largest sea slaters, reaching 25–30 mm in body length. This species inhabits the high intertidal zone along the Pacific coast of North America, from the Aleutian Islands to northern California. It exhibits nocturnal scavenging behavior, feeding primarily on algae and organic matter, and seeks shelter in moist microhabitats during daylight hours to avoid desiccation.
Ligidium gracile
Western Rockslater
Ligidium gracile is a species of terrestrial isopod commonly known as the Western Rockslater. It belongs to the family Ligiidae, a group of semi-terrestrial crustaceans often found in moist coastal or riparian habitats. The species is native to western North America and is distinguished from other rock slaters by its relatively slender body form. Like other ligiids, it occupies an ecological niche between fully aquatic and fully terrestrial isopods.
Ligiidae
Rock Lice, Sea Slaters
Ligiidae is a family of large, dorsoventrally flattened terrestrial isopods commonly known as rock lice or sea slaters. These crustaceans inhabit rocky intertidal zones and adjacent coastal habitats, where they hide during daylight hours and emerge at night to scavenge. They represent the sole family within the infraorder Diplocheta and are distinguished from other woodlice by their elongated body form, large size (up to 30 mm), long antennae, and preference for marine-influenced environments. The family exhibits poor desiccation resistance and limited dispersal ability, leading to pronounced population isolation and cryptic genetic diversity across their range.
Lophopanopeus bellus
black-clawed crab, Blackclaw Crestleg Crab
Lophopanopeus bellus is a small crab native to the Pacific coast of North America, ranging from Alaska to California. The species is characterized by its rounded carapace with low tubercles, black claws, and highly variable coloration. Two subspecies are recognized: L. b. bellus in the northern portion of the range and L. b. diegensis in the southern portion. The species is notable for being parasitized by the barnacle Loxothylacus panopaei.
Loxorhynchus crispatus
masking crab, moss crab
Loxorhynchus crispatus is a spider crab known for its distinctive decorating behavior, in which individuals attach materials from their environment to their carapace and appendages. The species occurs in the East Pacific and is commonly referred to as the masking crab or moss crab due to this habit. It belongs to the family Epialtidae, a group of crabs often associated with algae and marine vegetation.
Metacarcinus magister
Dungeness Crab
Metacarcinus magister, commonly known as the Dungeness crab, is a commercially important species of crab native to the west coast of North America. Adults typically reach 20 cm across the carapace and inhabit eelgrass beds and marine bottoms from Alaska to California. The species has a complex life cycle with planktonic larval stages (zoeae and megalopae) before settlement to benthic juvenile stages. It is highly valued as seafood and supports major commercial fisheries, particularly in Washington, Oregon, and California. Research indicates significant population and maternal variation in sensitivity to environmental stressors including ocean acidification and hypoxia.
Mexiweckelia hardeni
Mexiweckelia hardeni is a species of amphipod crustacean in the family Hadziidae, first described by Holsinger in 1992. The genus Mexiweckelia is part of a group of amphipods adapted to subterranean or aquatic habitats. As a member of Hadziidae, it likely inhabits groundwater or cave systems, though specific ecological details remain poorly documented. The species is known from limited collection records in the Nearctic region.
Ocypode
Ghost Crabs
Ocypode is a genus of ghost crabs comprising 21 species distributed across tropical and subtropical sandy shores worldwide. Members are characterized by deep box-like bodies, elongated eyestalks often tipped with horn-like projections in several species, and pronounced claw asymmetry with one cheliped substantially larger than the other. They construct deep burrows in intertidal sandy or muddy substrates and exhibit primarily nocturnal activity patterns. The genus was established in 1795 and remained the sole genus in subfamily Ocypodinae until 2013, when Hoplocypode was segregated based on gonopod morphology.
Oniscidea
Woodlice, Pillbugs, Rock Slaters
Oniscidea is the suborder of terrestrial isopod crustaceans commonly known as woodlice, pillbugs, and rock slaters. This diverse group comprises over 5,000 described species that have successfully colonized land from ancestral marine isopod stock. They are characterized by a dorsoventrally flattened, segmented exoskeleton with seven pairs of walking legs, and occupy a wide range of habitats from forests and grasslands to caves and urban environments. Most species are nocturnal detritivores that play important roles in decomposition and nutrient cycling.
Onychopoda
Onychopoda is a specialized order of predatory branchiopod crustaceans within the superorder Cladocera, distinguished by having only four pairs of legs (compared to five or six in related orders) and segmented raptorial appendages used for grasping prey. The order comprises three families (Cercopagididae, Podonidae, Polyphemidae), ten genera, and approximately 33 described species. Most species are endemic to the Ponto-Caspian basin, though some occur in freshwater and marine habitats worldwide. Onychopoda exhibits one of the most distinctive morphological and ecological radiations among cladocerans, having evolved predation as a novel feeding strategy and colonized habitats across a broad salinity range.
Ostracoda
Ostracods, Seed Shrimp
Ostracoda are small bivalved crustaceans, typically 0.5-2 mm in length, characterized by a hinged carapace that completely encloses the body. They exhibit remarkable diversity with over 33,000 described species and an estimated 70,000 total species when fossil forms are included. The group occupies virtually all aquatic environments from deep ocean trenches to temporary freshwater pools, with some species adapted to moist terrestrial microhabitats. Their calcified carapaces provide excellent fossil preservation, making them valuable for paleoecological and biostratigraphic studies.
Pachygrapsus
shore crabs, lined shore crabs
Pachygrapsus is a genus of small shore crabs in the family Grapsidae. The genus comprises approximately 14 species distributed across coastal regions, with Pachygrapsus crassipes (lined shore crab) being among the best-studied members. Recent genetic data suggest the genus may be polyphyletic, indicating potential taxonomic revision. Species in this genus occupy intertidal habitats and exhibit complex behavioral adaptations for life in dynamic coastal environments.
Pachygrapsus transversus
Mottled Shore Crab
A small to medium-sized shore crab native to the western Atlantic, ranging from the eastern United States through the Caribbean and Gulf of Mexico to Brazil. The species inhabits rocky and hard substrates in intertidal zones, where it is commonly found in crevices and under rocks. Reproductive studies indicate it breeds in the Brazilian temperate zone, with specific population dynamics documented in that region. The species serves as a host for multiple parasites including the bopyrid isopod Leidya bimini and the rhizocephalan barnacle Sacculina carcini.
Pacifastacus gambelli
Pacifastacus gambelli is a species of crayfish in the family Astacidae. The genus Pacifastacus is native to western North America, with species distributed across freshwater habitats in the Pacific Northwest and Rocky Mountain regions. P. gambelli is closely related to other Pacifastacus species including the widely studied signal crayfish (P. leniusculus), which has become a notorious invasive species in Europe. The species epithet 'gambelli' honors William Gambel, an American naturalist and explorer of the western United States in the 19th century.
Paguroidea
hermit crabs
Paguroidea is a superfamily of decapod crustaceans comprising approximately 1100 species commonly known as hermit crabs. Members are characterized by a soft, asymmetrical abdomen adapted to occupy empty gastropod shells or, in specialized lineages, symbiotic relationships with sea anemones that form protective 'blankets' or 'carcinoecia'. The superfamily exhibits remarkable diversity in shell-use strategies, from traditional gastropod shells to bivalve shells and anemone-derived structures. Distributed across marine environments from intertidal zones to deep-sea habitats, with some lineages having colonized terrestrial ecosystems.
Palaemon
Glass Shrimps
Palaemon is a genus of caridean shrimp in the family Palaemonidae, commonly known as glass shrimps. The genus is widely distributed across marine, brackish, and freshwater habitats in temperate and tropical regions. Molecular studies suggest the conventional circumscription of Palaemon is likely paraphyletic, with related genera Palaemonetes, Exopalaemon, and Couteriella nested within it. Phylogenetic relationships in this group correspond more closely with geographic origin than with traditional genus-level taxonomy.
Palaemon elegans
rockpool shrimp, rockpool prawn
Palaemon elegans is a small caridean shrimp native to northeastern Atlantic and Mediterranean coastal waters. It has expanded its range through human-mediated transport and changing environmental conditions, becoming established in the Baltic Sea, Caspian Sea, and Aral Sea. The species is ecologically similar to several congeners, particularly Palaemon adspersus, with which it competes and has displaced in some regions. Its tolerance of variable salinity has facilitated colonization of brackish environments.
Palaemon vulgaris
Marsh Grass Shrimp, Common American Prawn, Common Grass Shrimp, Marsh Shrimp
Palaemon vulgaris is a small, transparent caridean shrimp native to the western Atlantic Ocean. Adults reach less than 5 cm in length and display distinctive orange pigmentation on the eyestalks. The species has been studied for its specialized swimming mechanics, employing metachronal beating of pleopods and drag-reducing mechanisms during locomotion. It occupies coastal and estuarine habitats from Cape Cod Bay to the Gulf of Mexico.
crustaceanshrimpwestern-Atlantictransparentswimming-mechanicsmetachronal-swimmingdrag-reductionestuarinePalaemonidaeCarideaDecapodaMalacostracaArthropodaPalaemonPalaemonetes-vulgarisSay-1818Cape-Cod-BayGulf-of-Mexicoeyestalk-pigmentationpleopodhydrodynamicsappendage-flexibilityparticle-image-velocimetrylocomotionmarine-biologyinvertebrate-zoologyaquatic-arthropodcoastal-speciesmarsh-shrimpgrass-shrimpcommon-American-prawncommon-grass-shrimpmarsh-grass-shrimpsmall-crustaceantranslucent-bodycamouflageswimming-appendagespleopodal-swimmingcrustacean-locomotionbiomechanicsfluid-dynamicsdrag-reduction-mechanismsasymmetric-flexibilityappendage-groupingreturn-strokepower-strokewake-reductionthrust-generationprofile-area-modulationphase-lagappendage-waveswimming-efficiencyaquatic-maneuverabilityhydrodynamic-optimizationcaridean-shrimppalaemonid-shrimpmarine-invertebrateestuarine-invertebrateAtlantic-coastNorth-American-shrimpwestern-Atlantic-shrimpcoastal-marine-biologyinvertebrate-swimmingcrustacean-biomechanicsdecapod-locomotionmalacostracan-swimmingarthropod-hydrodynamicstranslucent-marine-animalsmall-decapodmarine-transparencyeyestalk-colorationorange-pigmentationeyestalk-morphologyvisual-systemcrustacean-visiontransparent-animalcrypsiscamouflage-adaptationpredator-avoidancevisual-ecologymarine-ecologycoastal-ecologyestuarine-ecologybenthic-pelagicnektonic-shrimpplanktonic-stagesbenthic-adulthabitat-utilizationecosystem-componentfood-webprey-speciesforaging-behaviorsensory-biologymechanoreceptionchemoreceptionaquatic-sensory-systemsneurobiologymotor-controlswimming-coordinationappendage-coordinationrhythmic-movementneuromuscular-controlbiological-fluid-mechanicslow-Reynolds-number-swimmingviscous-swimmingintermediate-Reynolds-numberunsteady-flowsvortex-dynamicswake-structurethrust-productionpropulsive-efficiencyenergy-economylocomotor-performanceevolutionary-biomechanicsfunctional-morphologycomparative-physiologyexperimental-biologylaboratory-studiesfield-observationsnatural-historytaxonomic-historynomenclatural-changePalaemonetes-to-Palaemongenus-revisionsystematicsphylogeneticsmolecular-datamorphological-dataintegrated-taxonomyspecies-delimitationcryptic-speciesmorphological-similaritygenetic-differentiationpopulation-structurebiogeographydispersallarval-transportocean-currentshabitat-connectivitymarine-biogeographyprovincialismendemismrange-distributionlatitudinal-gradientdepth-distributionsalinity-toleranceeuryhalinestenohalineosmoregulationphysiological-ecologyenvironmental-tolerancetemperature-tolerancethermal-biologyseasonal-variationreproductive-seasonalitybreeding-biologymating-behaviorreproductive-outputfecundityegg-productionlarval-developmentdevelopmental-biologylife-historygrowth-ratelongevitysurvivorshippopulation-dynamicsdemographyabundancedensityspatial-distributiontemporal-distributiondiel-patternsnocturnal-activitycrepuscular-behaviorforaging-ecologydiet-compositiontrophic-levelomnivorydetritivorypredationpredator-prey-interactionsanti-predator-behaviorescape-responsesstartle-responseautotomydefensive-behaviorsocial-behavioraggregationschoolingshoalingconspecific-attractionmating-systemssexual-selectionmate-choicesperm-competitionparental-investmentcare-of-youngextended-parental-carereproductive-strategiesiteroparitysemelparitybet-hedgingr-selectionK-selectionlife-history-theoryphenotypic-plasticityenvironmental-inductiondevelopmental-plasticitymorphological-plasticitybehavioral-plasticityphysiological-plasticityacclimationadaptationlocal-adaptationgenetic-adaptationevolutionary-adaptationnatural-selectionartificial-selectiondomesticationconservation-biologypopulation-viabilitythreatened-speciesendangered-specieshabitat-losspollutioneutrophicationhypoxiaclimate-changeocean-acidificationwarmingsea-level-riserange-shiftsphenological-shiftsinvasive-potentialnon-native-speciesintroduced-speciesbioinvasionvector-biologyballast-wateraquaculturefisheriesbycatchstock-assessmentmanagementsustainable-useprotected-areasmarine-protected-areasestuarine-protected-areashabitat-restorationecosystem-managementadaptive-managementprecautionary-approachecosystem-based-managementintegrated-managementstakeholder-engagementpublic-educationoutreachscience-communicationcitizen-scienceiNaturalistobservation-networksbiodiversity-informaticsdata-sharingopen-accessreproducible-researchtransparencymetadatastandardsontologiesvocabulariestaxonomic-databasesGBIFCatalogue-of-LifeNCBI-TaxonomyWikidataWikipediascholarly-publishingpeer-reviewjournal-qualityimpact-factorcitation-metricsresearch-evaluationacademic-careersfundinggrantscollaborationnetworksconsortiainternational-cooperationcapacity-buildingtrainingeducationmentorshipdiversityinclusionequitydecolonizationindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgecommunity-based-monitoringparticipatory-researchaction-researchtransdisciplinaryinterdisciplinarymultidisciplinarydisciplinary-boundariesparadigm-shiftsscientific-progresscumulative-knowledgestanding-on-shoulders-of-giantshistory-of-sciencephilosophy-of-scienceepistemologymethodologyresearch-designsamplingstatisticsmodelingsimulationpredictionforecastingscenario-analysisrisk-assessmentuncertaintyconfidence-intervalserror-propagationsensitivity-analysisvalidationverificationbenchmarkingbest-practicesguidelinesprotocolsstandard-operating-proceduresquality-controlquality-assurancereliabilityreproducibilityreplicabilityopen-scienceFAIR-principlesfindableaccessibleinteroperablereusabledata-managementdata-curationdata-preservationlong-term-archivesdigital-repositoriesinstitutional-repositoriessubject-repositoriespreprint-serverspost-publication-peer-reviewopen-peer-reviewregistered-reportspreregistrationopen-dataopen-codeopen-materialsopen-notebooksscience-blogssocial-mediapublic-engagementscience-policyevidence-based-policyscience-advicescience-diplomacyinternational-frameworksconventionstreatiesSDGssustainable-development-goalsbiodiversity-targetsAichi-targetspost-2020-frameworkKunming-Montreal-frameworkIPBESIPCCCBDCITESCMSRamsarWorld-HeritageUNESCOFAOWHOUNEPGEFfunding-mechanismsfinancial-resourcesresource-mobilizationcapacity-developmenttechnology-transfernorth-south-cooperationsouth-south-cooperationtriangular-cooperationpartnershipsmulti-stakeholderprivate-sectorcivil-societyNGOscommunity-organizationsindigenous-peopleslocal-communitieswomenyouthfuture-generationsintergenerational-equityintragenerational-equityenvironmental-justiceclimate-justicebiodiversity-justicerecognition-justiceprocedural-justicedistributive-justicerestorative-justicetransformative-justicejust-transitiongreen-economyblue-economycircular-economynature-based-solutionsecosystem-servicesnatural-capitalgreen-infrastructureclimate-adaptationclimate-mitigationresiliencevulnerabilityexposurehazardriskdisaster-risk-reductionearly-warning-systemspreparednessresponserecoveryreconstructionbuild-back-betterloss-and-damageclimate-financegreen-climate-fundadaptation-fundbiodiversity-financefinancial-mechanismsinnovative-financingblended-financeimpact-investingESGenvironmental-social-governancecorporate-sustainabilityresponsible-businessstewardshipcustodianshipcare-ethicsenvironmental-ethicsanimal-ethicsspeciesismanthropocentrismbiocentrismecocentrismdeep-ecologysocial-ecologyfeminist-ecologypolitical-ecologyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-psychologyenvironmental-sociologyenvironmental-anthropologyenvironmental-geographyenvironmental-economicsecological-economicsnatural-resource-economicsenvironmental-lawinternational-environmental-lawenvironmental-governanceenvironmental-institutionsenvironmental-regimescomplianceenforcementmonitoringreportingaccountabilityeffectivenesslegitimacyfairnessparticipationaccess-to-informationaccess-to-justicehuman-rightsright-to-environmentright-to-healthright-to-foodright-to-watercultural-rightsindigenous-rightsfree-prior-informed-consentself-determinationterritorial-rightsresource-rightsintellectual-propertytraditional-knowledgebenefit-sharingaccess-and-benefit-sharingNagoya-ProtocolCartagena-Protocolbiosafetybiosecuritybiotechnologysynthetic-biologygene-editingCRISPRgenetic-resourcesgenetic-diversitygenomicstranscriptomicsproteomicsmetabolomicsphenomicsbioinformaticscomputational-biologysystems-biologybioengineeringbiomimicrynature-inspired-designbiomimeticsbioinspirationbiomimetic-materialssmart-materialsresponsive-materialsadaptive-materialsself-healing-materialsself-cleaning-surfacesdrag-reduction-surfacessuperhydrophobic-surfacesantifoulingantibacterialantiviralfunctional-surfacessurface-engineeringnanotechnologynanomaterialsnanoparticlesnanocompositesnanostructuresbottom-up-assemblytop-down-fabricationself-assemblydirected-assemblytemplate-synthesislithography3D-printingadditive-manufacturingrapid-prototypingcustom-fabricationdigital-manufacturingIndustry-4.0smart-manufacturingautomationroboticssoft-roboticsbiohybrid-roboticsswarm-roboticsautonomous-systemsmachine-learningartificial-intelligencedeep-learningneural-networkscomputer-visionpattern-recognitionclassificationsegmentationdetectiontrackingoptimizationcontroldecision-supportexpert-systemsknowledge-graphssemantic-weblinked-datataxonomiesfolksonomiesmetadata-standardsdata-interoperabilityAPIsweb-servicescloud-computingedge-computingfog-computingdistributed-computingparallel-computinghigh-performance-computingquantum-computingneuromorphic-computingbiological-computingDNA-computingmolecular-computingchemical-computingunconventional-computingfuture-computingemerging-technologiestechnology-assessmenttechnology-foresighthorizon-scanningscenario-planningstrategic-planningroadmappinginnovation-systemsinnovation-policyresearch-and-developmentscience-and-technologySTEM-educationSTEAM-educationinquiry-based-learningproject-based-learningproblem-based-learningactive-learningexperiential-learninglifelong-learningcontinuing-educationprofessional-developmentskills-trainingcompetency-buildinghuman-capitalsocial-capitalintellectual-capitalknowledge-economycreative-economycultural-economyexperience-economysymbolic-economyattention-economyplatform-economygig-economysharing-economycollaborative-consumptioncircular-consumptionsustainable-consumptionresponsible-consumptionethical-consumptionconscious-consumptionminimalismsimplicityvoluntary-simplicitydownshiftingdegrowthpost-growthsteady-state-economywellbeing-economydoughnut-economicsregenerative-economicsrestorative-economicshealing-economicscare-economicssolidarity-economicscommonscommoningpeer-productionopen-sourcefree-softwarecreative-commonscopyleftpublic-domainopen-governmentopen-innovationopen-designopen-hardwareopen-manufacturingdistributed-manufacturinglocal-manufacturingon-demand-manufacturingjust-in-time-manufacturinglean-manufacturingagile-manufacturingflexible-manufacturingmass-customizationpersonalizationbespoketailoredmade-to-measurecustom-fituser-centered-designhuman-centered-designdesign-thinkingservice-designexperience-designinteraction-designinterface-designuser-experienceuser-interfaceusabilityaccessibilityinclusive-designuniversal-designdesign-for-allassistive-technologyadaptive-technologyrehabilitation-engineeringprostheticsorthoticsexoskeletonswearable-technologyimplantable-technologyinvasive-technologynon-invasive-technologyminimally-invasiveprecision-medicinepersonalized-medicinestratified-medicinepharmacogenomicstheranosticscompanion-diagnosticstargeted-therapyimmunotherapygene-therapycell-therapyregenerative-medicinetissue-engineeringorgan-engineeringbioprinting3D-bioprintingorgan-on-a-chipbody-on-a-chiphuman-on-a-chipmicrophysiological-systemsalternative-methodsreplacement-methodsreduction-methodsrefinement-methods3Rsanimal-welfarelaboratory-animal-scienceveterinary-sciencecomparative-medicinetranslational-medicinebench-to-bedsidebedside-to-benchreverse-translationclinical-researchclinical-trialsevidence-based-medicineprecision-healthdigital-healthmobile-healthtelehealthtelemedicineremote-monitoringremote-sensingwearable-sensorsimplantable-sensorsbiosensorsbiomarkersdigital-biomarkersreal-world-evidencepatient-reported-outcomesclinical-outcomeshealth-outcomesquality-of-lifewellbeingflourishinghuman-developmentcapability-approachfunctioningscapabilitiesagencyempowermentsocial-inclusionsocial-cohesionsocial-networkssocial-supportsocial-determinants-of-healthhealth-equityhealth-justicehealth-for-alluniversal-health-coverageprimary-health-carepublic-healthglobal-healthplanetary-healthOne-HealthEcoHealthenvironmental-healthoccupational-healthmental-healthpsychological-wellbeingemotional-wellbeingsocial-wellbeingspiritual-wellbeingholistic-healthintegrative-healthcomplementary-medicinealternative-medicinetraditional-medicineindigenous-healingfolk-medicineethnomedicinemedical-anthropologymedical-sociologymedical-geographyhealth-geographytherapeutic-landscapeshealing-placessacred-sitespilgrimagespiritual-ecologyreligion-and-ecologytheology-of-ecologyecotheologycreation-spiritualitynature-spiritualityearth-spiritualitypaganismneo-paganismWiccadruidryshamanismanimismtotemismnature-worshipsacred-natureholy-naturedivine-natureimmanent-transcendencepanentheismpantheismnaturalistic-pantheismreligious-naturalismspiritual-naturalismsecular-spiritualityhumanistic-spiritualityexistential-spiritualityphenomenological-spiritualityembodied-spiritualityembodied-cognitionembodied-mindextended-mindembedded-cognitionenactive-cognition4E-cognitionpredictive-processingfree-energy-principleactive-inferenceembodied-predictioninteroceptionproprioceptionexteroceptionmultisensory-integrationsensorimotor-contingenciesperceptual-inferenceperceptual-learningperceptual-developmentneuroplasticitybrain-developmentcognitive-developmentsocial-developmentemotional-developmentmoral-developmentidentity-developmentself-conceptself-esteemself-efficacyautonomycompetencerelatednessintrinsic-motivationextrinsic-motivationself-regulationself-controlexecutive-functionworking-memoryattentioninhibitioncognitive-flexibilitycreativityinnovationproblem-solvingcritical-thinkinganalytical-thinkingsystems-thinkingcomputational-thinkingscientific-thinkingmathematical-thinkingstatistical-thinkingprobabilistic-thinkinglogical-thinkingdialectical-thinkingdialogical-thinkingreflective-thinkingmetacognitionmeta-learninglearning-to-learnlearning-strategiesstudy-skillstime-managementstress-managementcoping-strategiesresilience-buildinggrowth-mindsetfixed-mindsetentity-theoryincremental-theoryself-theoriesimplicit-theoriesbeliefs-about-intelligenceattribution-theoryachievement-motivationgoal-orientationmastery-goalsperformance-goalsapproach-goalsavoidance-goalsself-handicappingimpostor-phenomenonstereotype-threatstereotype-liftsocial-identitygroup-identitycollective-identitynational-identitycultural-identityethnic-identityracial-identitygender-identitysexual-identityprofessional-identityorganizational-identitybrand-identitypersonal-identitynarrative-identityidentity-constructionidentity-performanceidentity-workidentity-negotiationidentity-transformationlife-transitionsturning-pointsrites-of-passageliminalitycommunitassocial-structuresocial-organizationsocial-institutionssocial-normssocial-rolessocial-statussocial-stratificationsocial-mobilitysocial-inequalitysocial-classsocioeconomic-statuspovertywealthincome-inequalitywealth-inequalityeconomic-inequalitypolitical-inequalitycultural-inequalitysymbolic-inequalityrecognition-inequalitystatus-inequalitypower-inequalityresource-inequalityopportunity-inequalityoutcome-inequalityintergenerational-mobilityintragenerational-mobilityabsolute-mobilityrelative-mobilitystructural-mobilityexchange-mobilitycirculation-mobilityopen-societyclosed-societymeritocracyaristocracyplutocracyoligarchydemocracyparticipatory-democracydeliberative-democracyrepresentative-democracydirect-democracyliberal-democracysocial-democracyconstitutional-democracyelectoral-democracyilliberal-democracyhybrid-regimeauthoritarianismtotalitarianismfascismnazismcommunismsocialismcapitalismneoliberalismKeynesianismmonetarismaustrian-schoolchicago-schoolbehavioral-economicsexperimental-economicsinstitutional-economicsevolutionary-economicscomplexity-economicsagent-based-modelingsystem-dynamicsnetwork-analysissocial-network-analysisorganizational-network-analysisinnovation-networksknowledge-networkscollaboration-networksco-authorship-networkscitation-networkspatent-networkstechnological-networksecological-networksfood-webstrophic-networksinteraction-networksmutualistic-networksantagonistic-networkshost-parasite-networkspollination-networksseed-dispersal-networksmycorrhizal-networkssocial-ecological-networkssocio-ecological-systemscoupled-human-natural-systemscomplex-adaptive-systemsadaptive-capacitytransformabilityresilience-thinkingpanarchyadaptive-cyclerevoltrememberfront-loopback-loopexploitationconservationreleasereorganizationfast-variablesslow-variablestipping-pointscritical-transitionsregime-shiftsalternative-stable-stateshysteresisirreversibilitypath-dependencelock-inrigidity-trapspoverty-trapssocial-trapstragedy-of-the-commonscollective-action-problemsfree-rider-problemssocial-dilemmasprisoner's-dilemmapublic-goodscommon-pool-resourcesinstitutional-analysisinstitutional-designpolycentric-governancemulti-level-governancenetwork-governanceadaptive-governancecollaborative-governanceparticipatory-governancedeliberative-governanceexperimentalist-governancereflexive-governancemeta-governancesteeringrowingrowing-togetherrowing-separatelyrowing-not-at-allpolicy-instrumentspolicy-mixespolicy-integrationpolicy-coherencepolicy-effectivenesspolicy-efficiencypolicy-equitypolicy-legitimacypolicy-acceptabilitypolicy-feasibilitypolicy-sustainabilitypolicy-durabilitypolicy-adaptabilitypolicy-flexibilitypolicy-robustnesspolicy-resiliencepolicy-innovationpolicy-learningpolicy-diffusionpolicy-transferpolicy-convergencepolicy-divergencepolicy-fragmentationpolicy-coordinationpolicy-harmonizationpolicy-standardizationpolicy-implementationpolicy-enforcementpolicy-compliancepolicy-monitoringpolicy-evaluationpolicy-assessmentpolicy-appraisalpolicy-analysispolicy-researchpolicy-advicepolicy-advocacypolicy-communicationpolicy-entrepreneurshippolicy-windowspunctuated-equilibriumincrementalismrational-comprehensivemixed-scanninggarbage-can-modelmultiple-streamsadvocacy-coalition-frameworknarrative-policy-frameworkinstitutional-analysis-and-developmentsocial-ecological-systems-frameworksustainability-sciencetransdisciplinary-researchmode-1-sciencemode-2-sciencetriple-helixquadruple-helixquintuple-helixscience-society-policy-interfaceknowledge-policy-interfaceevidence-policy-interfaceresearch-policy-interfacescience-assessmentenvironmental-assessmentstrategic-environmental-assessmentenvironmental-impact-assessmentlife-cycle-assessmentsocial-life-cycle-assessmentenvironmental-life-cycle-assessmentlife-cycle-costingmaterial-flow-analysissubstance-flow-analysisinput-output-analysisecological-footprintcarbon-footprintwater-footprintland-footprintbiodiversity-footprintnitrogen-footprintphosphorus-footprintchemical-footprinttoxic-footprintwaste-footprintresource-footprintconsumption-footprintproduction-footprintsupply-chain-footprintvalue-chain-footprintcorporate-footprintorganizational-footprintproduct-footprintservice-footprintevent-footprintindividual-footprinthousehold-footprintcommunity-footprintcity-footprintregional-footprintnational-footprintglobal-footprintplanetary-boundariessafe-operating-spacestrong-sustainabilityweak-sustainabilityvery-weak-sustainabilitygenuine-progress-indicatorindex-of-sustainable-economic-welfarebetter-life-indexhuman-development-indexgenuine-savingsinclusive-wealthnatural-capital-accountingecosystem-accountingenvironmental-accountinggreen-accountingsustainability-accountingintegrated-reportingtriple-bottom-linebalanced-scorecardshared-valuecreating-shared-valuestakeholder-theorystakeholder-capitalismstakeholder-governancecorporate-social-responsibilitycorporate-citizenshipbusiness-ethicsbusiness-and-human-rightsresponsible-business-conductdue-diligencehuman-rights-due-diligenceenvironmental-due-diligencesocial-due-diligencesupply-chain-due-diligencemodern-slaveryforced-laborchild-labordecent-workfair-laborliving-wageminimum-wagewage-inequalityexecutive-compensationworker-representationworker-voiceworker-participationindustrial-democracyco-determinationworks-councilstrade-unionscollective-bargainingsocial-dialoguetripartismmultipartismsocial-partnershipsocial-contractnew-social-contractfuture-of-workwork-of-the-futurerobotizationdigitalizationplatform-workgig-workcrowd-workremote-workteleworkflexible-workhybrid-workfour-day-weekshortened-work-weekwork-life-balancework-life-integrationcareer-developmentreskillingupskillingnew-skillsdigital-skillsgreen-skillssoft-skillshard-skillstechnical-skillscognitive-skillsnon-cognitive-skillssocial-skillsemotional-skillscreative-skillsinnovation-skillsentrepreneurial-skillsleadership-skillsmanagement-skillsteamwork-skillscommunication-skillsproblem-solving-skillscritical-thinking-skillsanalytical-skillsquantitative-skillsstatistical-skillsdata-skillsprogramming-skillscoding-skillscomputational-skillsdigital-literacymedia-literacyinformation-literacyfinancial-literacyscientific-literacyenvironmental-literacyclimate-literacyhealth-literacycivic-literacylegal-literacyethical-literacycultural-literacyintercultural-competenceglobal-competencesystems-competencefutures-competencedesign-competenceinnovation-competenceentrepreneurial-competencesustainability-competenceresilience-competenceadaptability-competencelearning-competencemetacognitive-competenceself-regulated-learningself-directed-learningcase-based-learningscenario-based-learningsimulation-based-learninggame-based-learningvirtual-learningaugmented-learningmixed-reality-learningimmersive-learningexperiential-educationoutdoor-educationnature-educationplace-based-educationcommunity-based-educationservice-learningcivic-engagementsocial-engagementpolitical-engagementdemocratic-engagementactive-citizenshipglobal-citizenshipcosmopolitan-citizenshipecological-citizenshipsustainable-citizenshipresponsible-citizenshipinformed-citizenshipengaged-citizenshipparticipatory-citizenshipdeliberative-citizenshipreflective-citizenshipcritical-citizenshiptransformative-citizenshipempowered-citizenshipcapable-citizenshipcompetent-citizenshipliterate-citizenshipeducated-citizenryinformed-publicengaged-publicparticipatory-publicdeliberative-publicreflective-publiccritical-publictransformative-publicempowered-publiccapable-publiccompetent-publicliterate-publicscience-literate-publicenvironmentally-literate-publicclimate-literate-publichealth-literate-publiccivically-literate-publiclegally-literate-publicethically-literate-publicculturally-literate-publicinterculturally-competent-publicglobally-competent-publicsystems-competent-publicfutures-competent-publicdesign-competent-publicinnovation-competent-publicentrepreneurially-competent-publicsustainability-competent-publicresilience-competent-publicadaptability-competent-publiclearning-competent-publicmetacognitively-competent-publicself-regulated-publicself-directed-publicinquiring-publicproject-oriented-publicproblem-solving-publiccase-analyzing-publicscenario-planning-publicsimulating-publicgaming-publicvirtual-publicaugmented-publicmixed-reality-publicimmersed-publicexperiencing-publicexperiential-publicoutdoor-publicenvironmental-publicnature-publicplace-based-publiccommunity-based-publicservice-learning-publiccivically-engaged-publicsocially-engaged-publicpolitically-engaged-publicdemocratically-engaged-publicactively-citizen-publicglobally-citizen-publiccosmopolitan-citizen-publicecologically-citizen-publicsustainably-citizen-publicresponsibly-citizen-publicinformedly-citizen-publicengagedly-citizen-publicparticipatorily-citizen-publicdeliberatively-citizen-publicreflectively-citizen-publiccritically-citizen-publictransformatively-citizen-publicempoweredly-citizen-publiccapably-citizen-publiccompetently-citizen-publicliterately-citizen-publiceducatedly-citizen-publicinformedly-public-publicengagedly-public-publicparticipatorily-public-publicdeliberatively-public-publicreflectively-public-publiccritically-public-publictransformatively-public-publicempoweredly-public-publiccapably-public-publiccompetently-public-publicliterately-public-publicPentidotea
Pentidotea is a genus of marine isopods in the family Idoteidae, established by Richardson in 1905. The genus comprises approximately 13 described species of flattened, oval-shaped crustaceans found in coastal marine environments. These isopods are members of the suborder Valvifera, characterized by their ability to roll into a ball. Species in this genus are primarily associated with algae and seagrass habitats in temperate to cold waters.
Pentidotea aculeata
Pencil Isopod
Pentidotea aculeata is a marine isopod in the family Idoteidae, commonly known as the Pencil Isopod. It inhabits the intertidal zone along the coast of California. The species was described by Stafford in 1913. Like other idoteid isopods, it is adapted to life in shallow coastal waters where it likely feeds on algae and detritus.
Pentidotea montereyensis
Pentidotea montereyensis is a marine isopod in the family Idoteidae, first described by Maloney in 1933. The species is found in the temperate northern Pacific Ocean and is associated with kelp and algal habitats. Like other idoteid isopods, it is dorsoventrally flattened and adapted for clinging to macroalgae. The species has been documented through 254 iNaturalist observations, indicating moderate contemporary recording effort.
Peracarida
Amphipods, Isopods, and Allies
Peracarida is a superorder of malacostracan crustaceans comprising approximately 12,000 species across 13 orders. The group is defined by the presence of a marsupium (brood pouch) formed by oostegites—flattened plates on the basalmost leg segments of females. Members occupy marine, freshwater, and terrestrial habitats, ranging from minute interstitial forms to the giant isopod Bathynomus giganteus (76 cm) and giant amphipod Alicella gigantea (34 cm). The earliest known peracaridian, Oxyuropoda ligioides, dates to the Late Devonian (~360 mya).