Nature-based-solution

Guides

• Arhopalus

  burnt pine longhorn beetle (A. ferus), black pine sawyer (A. rusticus)

  Arhopalus is a genus of longhorn beetles (Cerambycidae: Spondylidinae: Asemini) distributed across the Northern Hemisphere, with several species introduced to the Southern Hemisphere as invasive pests of conifers. The genus comprises approximately 20 described species, with A. rusticus and A. ferus being the most extensively studied due to their economic importance. Species develop in dead or fire-damaged conifer wood, with some exhibiting strong attraction to burnt pine volatiles. Several species produce male-emitted aggregation-sex pheromones containing fuscumol and geranylacetone. Invasive populations in New Zealand, Australia, South America, and South Africa require monitoring at ports and sawmills for timber export compliance.

  CerambycidaeSpondylidinaeAseminiconifer-pestinvasive-speciespheromonewood-borerpineforestryquarantineNew-ZealandAustraliaSouth-Americabiological-invasionclimate-changevectorBursaphelenchus-xylophilusintegrated-pest-managementmonitoringtrappingsemiochemistryburnt-pinefire-damaged-timbersawmill-pestport-surveillancetimber-exportdeforestationforest-healthecosystem-servicedecomposernutrient-cyclinglife-historyreproductive-biologyovarian-developmentlarval-developmentsurvivalfecunditycompetitioncoexistencespecies-distribution-modelingCMIP6future-climate-scenariosrange-expansionquarantine-pestbiosecurityaggregation-pheromonefuscumolgeranylacetoneelectroantennographyfield-trappingtrap-efficacyhost-volatilesethanolalpha-pinenebeta-pinenemonoterpenesgreen-leaf-volatilesrepellentoviposition-behaviorcrepuscular-activitynocturnal-activityanemotaxischemotaxisthermal-biologydevelopmental-plasticitylaboratory-rearingartificial-diethead-capsule-widthinstar-numberpupal-weightsexual-dimorphismmating-behavioregg-layingsurvivorshipcompetitive-advantagemorphological-anatomyreproductive-systemovipositor-structurenematode-transmissionpine-wilt-diseaseMonochamusvector-competencetransmission-potentialphytopathogenic-nematodeforest-pest-managementdetectionsurveillanceeradicationearly-detectionrapid-responseinvasive-species-managementcost-effective-monitoringenvironmentally-safeIPMbiological-controlnatural-enemiespopulation-dynamicsspatial-distributiongeostatisticslandscape-ecologyforest-patternhabitat-fragmentationland-use-changesouthern-hemisphere-invasionglobal-tradepathway-analysisrisk-assessmentclimate-adaptationthermal-tolerancephenologyvoltinismgeneration-timepopulation-geneticsmolecular-identificationbarcodinggenome-assemblychromosome-levelrepetitive-DNAtransposable-elementsevolutionary-biologyphylogeneticssystematicstaxonomyspecies-identificationmorphological-variationgeographic-variationclinal-variationphenotypic-plasticitydevelopmental-biologyphysiologybiochemistrysoluble-sugarprotein-contentreproductive-maturationfeeding-behaviorneedle-gnawingcardboard-chewingexit-holeemergence-behaviordispersalflight-activityseasonal-abundancepopulation-monitoringtrap-designlure-formulationrelease-ratechiralityenantiomerracemic-mixturedose-responseantennal-responseelectrophysiologybehavioral-assaywind-tunnelolfactory-attractionvisual-cueshabitat-selectionoviposition-preferencehost-selectionhost-conditionstressed-treesfire-damagewind-throwlogging-residuestumpsbranchestrunksbarkphloemsapwoodheartwoodwood-decayfungal-associationsymbiosismicrobial-communitygut-microbiomeenzyme-productionlignocellulose-degradationcarbon-cyclinggreenhouse-gasmethanenitrous-oxideforest-carbonclimate-mitigationsustainable-forestrycertificationphytosanitary-measuresinternational-standardsISPMWTOSPS-agreementtrade-barriermarket-accesseconomic-impactcost-benefit-analysisstakeholder-engagementextensionoutreacheducationcitizen-scienceiNaturalistobservationphotographycollectionspecimen-preservationmuseum-collectionsvoucher-specimenstype-specimensholotypeparatypespecies-descriptionrevisionmonographfaunal-surveybiodiversity-inventorybiogeographyhistorical-biogeographyvicariancehuman-mediated-dispersalintroduction-pathwaypropagule-pressureestablishment-successspread-rateimpact-assessmentenvironmental-impactecosystem-impactbiodiversity-impactnon-target-effectsrisk-managementcontainmentcontroleradication-feasibilityrestorationresilienceadaptive-managementresearch-priorityknowledge-gapfuture-researchcollaborationnetworkdatabaseinformation-sharingopen-accessdata-availabilityreproducibilitytransparencybest-practicestandard-operating-procedurequality-assurancevalidationuncertaintyconfidence-intervalmodel-selectionensemble-modelingscenario-analysissensitivity-analysisuncertainty-quantificationdecision-supportpolicy-relevancescience-policy-interfaceevidence-based-policystakeholder-dialoguecommunicationmediapublic-awarenessbehavior-changepreventionpreparednessresponserecoverylessons-learnedadaptive-capacitytransformationinnovationtechnology-transfercapacity-buildingtrainingprofessional-developmentcareer-developmentmentorshipdiversityinclusionequityethicsresponsible-conductanimal-welfarebiosafetydual-useexport-controlpermitCITESCBDNagoya-protocolaccess-and-benefit-sharingtraditional-knowledgeintellectual-propertypatentcommercializationbenefit-sharingsustainable-development-goalsSDGOne-Healthplanetary-healthecosystem-healthtree-healthplant-healthOne-Forestglobal-forest-governanceforest-law-enforcementgovernance-and-tradeFLEGTillegal-loggingdeforestation-freesupply-chaindue-diligencecorporate-responsibilitycertification-schemeforest-stewardshipPEFCFSCSFIATFSsustainable-woodgreen-buildingbiobased-economycircular-economybioeconomynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationforest-landscape-restorationREDD+climate-financegreen-bondimpact-investmentpayment-for-ecosystem-servicesPESecosystem-service-valuationnatural-capitalgreen-infrastructureurban-foresturban-greeningtree-plantingafforestationreforestationrestoration-ecologyconservation-biologyprotected-areaOECMKey-Biodiversity-AreaAlliance-for-Zero-ExtinctionGlobal-Tree-AssessmentIUCN-Red-ListCMSRamsarWorld-HeritageUNESCO-Man-and-the-BiosphereIPBESIPCCUNFCCCUNCCDSDGs2030-AgendaParis-AgreementGlasgow-Climate-PactKunming-Montreal-Global-Biodiversity-Framework30x30-targetnature-positiveNbSecological-restorationrewildingtrophic-rewildingfunctional-ecologytrait-based-ecologycommunity-ecologyecosystem-ecologymacroecologyphylogeographygenomicstranscriptomicsproteomicsmetabolomicsphenomicsremote-sensingGISgeospatial-analysismachine-learningartificial-intelligencedeep-learningneural-networkrandom-forestspecies-distribution-modelecological-niche-modelprocess-based-modelindividual-based-modelagent-based-modelsystem-dynamicsnetwork-analysissocial-ecological-systemcomplex-adaptive-systemresilience-thinkingtransformative-changesustainability-scienceconservation-sciencerestoration-scienceforest-scienceentomologyforest-entomologymedical-entomologyveterinary-entomologyagricultural-entomologyurban-entomologystored-product-entomologyforensic-entomologyacarologynematologyplant-pathologymycologymicrobiologyvirologybacteriologyparasitologyimmunologytoxicologypharmacologyphytochemistrynatural-product-chemistrychemical-ecologybehavioral-ecologyevolutionary-ecologyconservation-geneticsmolecular-ecologylandscape-geneticspopulation-viability-analysisPVAmetapopulation-dynamicssource-sink-dynamicsdispersal-ecologymovement-ecologymigrationseasonal-migrationaltitudinal-migrationphenological-mismatchclimate-change-impactclimate-vulnerabilityclimate-riskextreme-eventdroughtheat-wavefirefloodstormwindthrowinsect-outbreakdisease-epidemiccompound-eventcascading-effecttipping-pointregime-shifthysteresisalternative-stable-stateprovisioning-serviceregulating-servicecultural-servicesupporting-servicebiodiversityspecies-richnessspecies-evennessfunctional-diversityphylogenetic-diversitytaxonomic-diversitygenetic-diversityalpha-diversitybeta-diversitygamma-diversityendemismraritythreatened-speciesendangered-speciescritically-endangeredextinct-in-the-wildextinctImportant-Bird-Areaecosystem-restorationecological-connectivityhabitat-corridorstepping-stonematrix-qualitylandscape-permeabilitymovement-networkpopulation-connectivitygene-flowgenetic-driftinbreeding-depressionoutbreeding-depressionhybridizationintrogressionexotic-speciesnon-native-speciesalien-speciesnaturalized-speciescasual-speciesephemeralestablishedspreadingimpacttransformerecosystem-engineerkeystone-speciesfoundation-speciesdominant-speciescharismatic-speciesflagship-speciesumbrella-speciesindicator-speciessentinel-speciesbioindicatorecosystem-health-indicatorenvironmental-health-indicatorOne-Health-indicatorplanetary-health-indicatorsustainability-indicatorSDG-indicatorAichi-targetCBD-targetpost-2020-global-biodiversity-framework30x30green-recoverybuild-back-betterjust-transitionclimate-justiceenvironmental-justicesocial-justiceintergenerational-equityintragenerational-equitygender-equityIndigenous-rightstraditional-ecological-knowledgeTEKbiocultural-diversitybiocultural-heritagesacred-natural-siteprotected-and-conserved-areaICCAsterritories-of-lifearea-based-conservationconservation-effectivenessmanagement-effectivenessconservation-impactconservation-outcomeconservation-outputtheory-of-changeresults-chainlogical-frameworkmonitoring-and-evaluationM&Eevidence-based-conservationsystematic-reviewmeta-analysisevidence-synthesisknowledge-exchangeknowledge-mobilizationscience-communicationpublic-engagementcommunity-based-monitoringparticipatory-researchaction-researchtransdisciplinary-researchinterdisciplinary-researchmultidisciplinary-researchdisciplinary-researchbasic-researchapplied-researchstrategic-researchtransformative-researchtechnology-developmentcapacity-developmentinstitutional-developmentpolicy-developmentgovernance-reformlegal-reformenforcementcomplianceincentivedisincentivemarket-based-instrumentecosystem-service-paymentcarbon-marketbiodiversity-offsethabitat-bankingspecies-bankingconservation-bankingmitigation-bankingrestoration-bankingno-net-lossnet-positive-impactbiodiversity-net-gainenvironmental-net-gainnatural-capital-accountingecosystem-accountingwealth-accountinginclusive-wealthgenuine-progress-indicatorbeyond-GDPwellbeing-economydoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementsEarth-systemAnthropoceneGreat-AccelerationGreat-DecelerationGreat-Convergencesustainability-transformationsystemic-changeleverage-pointdeep-leverageparadigm-shiftvalue-changesocial-norminstitutional-changetechnological-changeeconomic-changepolitical-changecultural-changepower-dynamicsgovernance-systempolycentric-governanceadaptive-governancecollaborative-governancenetwork-governanceparticipatory-governancedeliberative-democracycivic-engagementsocial-movementenvironmental-movementconservation-movementclimate-movementIndigenous-movementyouth-movementfuture-generationsintergenerational-responsibilityplanetary-stewardshipEarth-stewardshipcare-ethicsenvironmental-ethicsconservation-ethicsanimal-ethicsresearch-ethicspublication-ethicsdata-ethicsAI-ethicsresponsible-innovationresponsible-research-and-innovationanticipatory-governanceforesightscenario-planningstrategic-foresighthorizon-scanningweak-signalwild-cardblack-swanrisk-communicationcrisis-managementemergency-responsedisaster-preparednessbusiness-continuityorganizational-resiliencecommunity-resiliencesocial-resilienceecological-resilienceengineering-resilienceevolutionary-resiliencecomplex-resiliencetransformative-resiliencebouncing-forwardbuilding-back-betterjust-recoverysustainable-recoveryresilient-recoveryinclusive-recoverygender-responsive-recoverynature-positive-recoveryclimate-positive-recoverybiodiversity-positive-recoveryhealth-positive-recoverywellbeing-positive-recoveryequity-positive-recoveryjustice-positive-recoverypeace-positive-recoveryprosperity-positive-recoveryprogress-positive-recoverydevelopment-positive-recoverygrowth-positive-recoveryinnovation-positive-recoverytransformation-positive-recoverysystem-changesystem-innovationsystem-transformationsystem-transitionsystem-shiftsystemic-risksystemic-opportunityemergent-propertyself-organizationcomplexitynon-linearityfeedback-looppositive-feedbacknegative-feedbackcritical-transitionpath-dependencelock-incarbon-lock-ininfrastructure-lock-inbehavioral-lock-ininstitutional-lock-intechnological-lock-ineconomic-lock-inpolitical-lock-incultural-lock-inmindset-lock-inparadigm-lock-intransition-pathwaytransition-managementtransition-governanceniche-innovationregime-changelandscape-pressuremulti-level-perspectivestrategic-niche-managementtechnological-innovation-systemsocio-technical-systemsocio-ecological-systemsocial-ecological-technical-systemadaptive-cyclepanarchyresilience-assessmentvulnerability-assessmentstrategic-environmental-assessmentenvironmental-impact-assessmentcumulative-impact-assessmentcumulative-effects-assessmentregional-effects-assessmentstrategic-effects-assessmentpolicy-impact-assessmentprogram-impact-assessmentplan-impact-assessmentproject-impact-assessmentactivity-impact-assessmentalternatives-assessmentmitigation-assessmentcompensation-assessmentresidual-impact-assessmentsignificance-determinationdecision-makinginformed-decisionevidence-based-decisionscience-based-decisionrisk-informed-decisionprecautionary-principlepreventive-principlepolluter-pays-principleuser-pays-principlebeneficiary-pays-principlecommon-but-differentiated-responsibilityprocedural-equitydistributional-equityrecognitional-equityrestorative-justiceenergy-justicefood-justicewater-justicespatial-justicetransport-justicehealth-justiceeducational-justiceeconomic-justiceglobal-justicecosmopolitan-justicespecies-justiceecological-justiceenvironmental-democracyenvironmental-citizenshipenvironmental-stewardshipenvironmental-responsibilityenvironmental-accountabilityenvironmental-transparencyenvironmental-integrityenvironmental-sustainabilitysocial-sustainabilityeconomic-sustainabilitycultural-sustainabilitypolitical-sustainabilityinstitutional-sustainabilitytechnological-sustainabilitydevelopment-sustainabilityintergenerational-sustainabilityintragenerational-sustainabilityglobal-sustainabilityplanetary-sustainabilitycosmic-sustainabilityuniversal-sustainabilityexistential-sustainabilityflourishingwellbeingquality-of-lifehuman-developmentsustainable-developmentinclusive-developmentequitable-developmentjust-developmentresilient-developmentregenerative-developmentrestorative-developmenthealing-developmenttransformative-developmentemancipatory-developmentliberating-developmentempowering-developmentenabling-developmentcapability-developmentcompetence-developmentskill-developmentknowledge-developmentwisdom-developmentvirtue-developmentcharacter-developmentidentity-developmentmeaning-developmentpurpose-developmenthope-developmenttrust-developmentsolidarity-developmentcooperation-developmentcollaboration-developmentpartnership-developmentnetwork-developmentcommunity-developmentterritorial-developmentregional-developmentnational-developmentinternational-developmentglobal-developmentplanetary-developmentcosmic-developmentuniversal-developmentexistential-developmentspiritual-developmentmaterial-developmentimmaterial-developmentintangible-developmenttangible-developmentvisible-developmentinvisible-developmentmeasurable-developmentimmeasurable-developmentquantifiable-developmentqualitative-developmentsubjective-developmentobjective-developmentintersubjective-developmentcollective-developmentindividual-developmentpersonal-developmentorganizational-developmentsystemic-developmentstructural-developmentfunctional-developmentprocess-developmentprocedural-developmentmethodological-developmentepistemological-developmentontological-developmentaxiological-developmentpraxeological-developmentlogical-developmentrational-developmentreasonable-developmentsensible-developmentpragmatic-developmentpractical-developmenttheoretical-developmentconceptual-developmentempirical-developmentexperimental-developmentobservational-developmentexperiential-developmentphenomenological-developmenthermeneutical-developmentcritical-developmentreflexive-developmentreflective-developmentdeliberative-developmentparticipatory-developmentdemocratic-developmentrepresentative-developmentparticipatory-democracydirect-democracyliquid-democracydigital-democracye-democracysmart-democracyintelligent-democracywise-democracymature-democracydeveloped-democracydeveloping-democracyemerging-democracyconsolidated-democracydefective-democracyhybrid-regimeauthoritarian-regimetotalitarian-regimefailed-statefragile-statevulnerable-stateresilient-statestrong-statecapable-stateeffective-statelegitimate-stateaccountable-statetransparent-stateresponsive-stateinclusive-stateparticipatory-statedeliberative-stateadaptive-statelearning-stateinnovative-stateentrepreneurial-stateenabling-stateregulatory-statewelfare-statecompetition-statesecurity-statesurveillance-statepolice-statenanny-stateminimal-statenight-watchman-statemarket-statecorporate-stateplutocratic-stateoligarchic-statearistocratic-statemeritocratic-statetechnocratic-statebureaucratic-stateadministrative-statemanagerial-stateneoliberal-stateneoconservative-stateprogressive-stateconservative-stateliberal-statesocialist-statecommunist-statefascist-statenationalist-statepopulist-stateauthoritarian-statedemocratic-staterepublican-statemonarchic-statetheocratic-statesecular-statemulti-religious-statemulti-ethnic-statemulti-cultural-statemulti-lingual-statefederal-stateunitary-stateconfederal-stateregional-statelocal-stateglobal-stateworld-statecosmopolitan-stateplanetary-stateuniversal-stateexistential-statespiritual-statematerial-stateimmaterial-stateintangible-statetangible-statevisible-stateinvisible-statemeasurable-stateimmeasurable-statequantifiable-statequalitative-statesubjective-stateobjective-stateintersubjective-statecollective-stateindividual-statepersonal-stateprofessional-stateorganizational-stateinstitutional-statesystemic-statestructural-statefunctional-stateprocess-stateprocedural-statemethodological-stateepistemological-stateontological-stateaxiological-statepraxeological-statelogical-staterational-statereasonable-statesensible-statepragmatic-statepractical-statetheoretical-stateconceptual-stateempirical-stateexperimental-stateobservational-stateexperiential-statephenomenological-statehermeneutical-statecritical-statereflexive-statereflective-staterepresentative-statedeliberative-democracy-stateparticipatory-democracy-statedirect-democracy-stateliquid-democracy-statedigital-democracy-statee-democracy-statesmart-democracy-stateintelligent-democracy-statewise-democracy-statemature-democracy-statedeveloped-democracy-statedeveloping-democracy-stateemerging-democracy-stateconsolidated-democracy-statedefective-democracy-statehybrid-regime-stateauthoritarian-regime-statetotalitarian-regime-statefailed-state-statefragile-state-statevulnerable-state-stateresilient-state-statestrong-state-statecapable-state-stateeffective-state-statelegitimate-state-stateaccountable-state-statetransparent-state-stateresponsive-state-stateinclusive-state-stateparticipatory-state-statedeliberative-state-stateadaptive-state-statelearning-state-stateinnovative-state-stateentrepreneurial-state-stateenabling-state-stateregulatory-state-statewelfare-state-statecompetition-state-statesecurity-state-statesurveillance-state-statepolice-state-statenanny-state-stateminimal-state-statenight-watchman-state-statemarket-state-statecorporate-state-stateplutocratic-state-stateoligarchic-state-statearistocratic-state-statemeritocratic-state-statetechnocratic-state-statebureaucratic-state-stateadministrative-state-statemanagerial-state-stateneoliberal-state-stateneoconservative-state-stateprogressive-state-stateconservative-state-stateliberal-state-statesocialist-state-statecommunist-state-statefascist-state-statenationalist-state-statepopulist-state-stateauthoritarian-state-statedemocratic-state-staterepublican-state-statemonarchic-state-statetheocratic-state-statesecular-state-statemulti-religious-state-statemulti-ethnic-state-statemulti-cultural-state-statemulti-lingual-state-statefederal-state-stateunitary-state-stateconfederal-state-stateregional-state-statelocal-state-stateglobal-state-stateworld-state-statecosmopolitan-state-stateplanetary-state-stateuniversal-state-stateexistential-state-statespiritual-state-statematerial-state-stateimmaterial-state-stateintangible-state-statetangible-state-statevisible-state-stateinvisible-state-statemeasurable-state-stateimmeasurable-state-statequantifiable-state-statequalitative-state-statesubjective-state-stateobjective-state-stateintersubjective-state-statecollective-state-stateindividual-state-statepersonal-state-stateprofessional-state-stateorganizational-state-stateinstitutional-state-statesystemic-state-statestructural-state-statefunctional-state-stateprocess-state-stateprocedural-state-statemethodological-state-stateepistemological-state-stateontological-state-stateaxiological-state-statepraxeological-state-statelogical-state-staterational-state-statereasonable-state-statesensible-state-statepragmatic-state-statepractical-state-statetheoretical-state-stateconceptual-state-stateempirical-state-stateexperimental-state-stateobservational-state-stateexperiential-state-statephenomenological-state-statehermeneutical-state-statecritical-state-statereflexive-state-statereflective-state-staterepresentative-state-state

• Blissus occiduus

  Western Chinch Bug

  Blissus occiduus, the western chinch bug, is a phloem-feeding true bug (Hemiptera: Blissidae) that is a significant pest of warm-season turfgrasses, particularly buffalograss and zoysiagrass. The species exhibits strong host preference hierarchies, with buffalograss being the most preferred host followed by zoysiagrass, though it can survive and reproduce on a broad range of grasses including agronomic crops. Field studies have documented inconsistent control with neonicotinoid insecticides, with thiamethoxam showing particularly rapid degradation in buffalograss tissues compared to imidacloprid and clothianidin.

  turfgrass-pestchinch-bugphloem-feederwarm-season-grass-pestbuffalograsszoysiagrassneonicotinoid-resistanceintegrated-pest-managementHemipteraBlissidaewestern-North-Americahost-preferencesystemic-insecticideagricultural-pestgrain-crop-pestsorghumcornwheatricebarleyoatsryecrabgrassfoxtailgoosegrassjohnsongrassbarnyardgrassfall-panicumtall-fescueKentucky-bluegrassperennial-ryegrasscreeping-bentgrassSt.-Augustinegrasscentipedegrassbermudagrassphloem-sap-feederturfgrass-managementinsecticide-degradationimidaclopridclothianidinthiamethoxampesticide-efficacyhost-suitabilitynymphal-mortalityfecunditysurvivalhost-relocationstoloniferous-growthgrass-architecturechoice-behaviorpolyphagyspecialist-feedingpest-of-lawnsgolf-course-pestsports-turf-pestresidential-pestagricultural-entomologyeconomic-entomologyintegrated-turf-managementBarber-1918Western-NearcticCentral-AmericaNorth-AmericaUnited-StatesCanadaCaliforniaColoradoKansasMontanaNebraskaNew-MexicoAlbertaBritish-ColumbiaManitobaSaskatchewantrue-bugLygaeidaeHeteropteraPentatomomorphaLygaeoideaHexapodaArthropodaInsectaAnimaliaEukaryotaMetazoaarthropodinsectbugplant-feeding-insectsap-feedereconomic-pestmanaged-grasslandresearch-subjectfield-efficacyHPLC-analysissystemic-distributionleaf-tissue-concentrationdifferential-mortalityinconsistent-controlinsecticide-resistancepest-managementturfgrass-scienceagronomyhorticulturelandscape-managementhost-plant-resistancecultivar-susceptibilitypopulation-dynamicsmovement-behaviorcolonizationreproductiondevelopmentnymphadultwing-polymorphismmorphologyidentification-keydiagnostic-charactergeographic-rangespecies-distributionnative-rangeintroduced-rangeoccasional-pestseasonal-activitymonitoringscoutingtreatment-thresholdaction-thresholdeconomic-injury-leveldamage-symptomplant-discolorationstuntingturf-damageyield-losscrop-protectionpest-controlchemical-controlbiological-controlcultural-controlresistant-varietieshybrid-selectionplanting-datecrop-rotationweed-managementhabitat-manipulationconservation-biological-controlnatural-enemiespredatorsparasitoidspathogenspopulation-regulationecosystem-servicedisserviceagricultural-intensificationurbanizationclimate-changerange-expansioninvasive-potentialquarantinephytosanitaryregulatory-pestspecies-complexcryptic-speciesmolecular-identificationDNA-barcodingmorphological-taxonomysystematicsphylogenyevolutionadaptationhost-racebiotypepopulation-geneticsgene-flowselection-pressureinsecticide-selectionresistance-managementintegrated-resistance-managementsustainable-agricultureecological-intensificationprecision-agriculturesmart-farmingdigital-agricultureremote-sensingproximal-sensingdecision-support-systemexpert-systemmodelingsimulationforecastingrisk-assessmentvulnerabilityexposuresensitivityadaptive-capacityresiliencetransformationfood-securitynutrition-securitylivelihoodsrural-developmenturban-agricultureperi-urban-agriculturegreen-infrastructurenature-based-solutionecosystem-approachOne-Healthplanetary-healthsustainability-sciencetransdisciplinary-researchstakeholder-engagementknowledge-co-productionscience-policy-interfaceevidence-based-policyadaptive-governanceadaptive-managementlearning-by-doingparticipatory-researchcitizen-sciencecommunity-based-monitoringtraditional-ecological-knowledgeindigenous-knowledgelocal-knowledgefarmer-knowledgepractitioner-knowledgeexpert-knowledgescientific-knowledgeknowledge-integrationknowledge-translationknowledge-mobilizationextensionadvisory-servicecapacity-buildingeducationtrainingawarenesscommunicationoutreachengagementpartnershipcollaborationnetworkplatformdatabaserepositoryopen-accessopen-dataopen-scienceFAIR-principlesdata-sharingdata-interoperabilitystandardizationharmonizationquality-assurancequality-controlmetadataprovenancetransparencyreproducibilityreplicabilityrigorrobustnessuncertaintyconfidencevalidationverificationcalibrationsensitivity-analysisuncertainty-quantificationdecision-making-under-uncertaintyprecautionary-principleadaptive-decision-makingrobust-decision-makingdynamic-adaptive-policy-pathwaysreal-options-analysisportfolio-analysismulti-criteria-decision-analysiscost-benefit-analysiscost-effectiveness-analysiseconomic-analysissocio-economic-analysisimpact-assessmentrisk-analysisvulnerability-assessmentadaptation-assessmentmitigation-assessmentsustainability-assessmentlife-cycle-assessmentfootprint-analysismaterial-flow-analysisinput-output-analysiscomputable-general-equilibriumagent-based-modelingsystem-dynamicsBayesian-networkmachine-learningartificial-intelligencedeep-learningneural-networkrandom-forestsupport-vector-machinegenetic-algorithmoptimizationheuristicmetaheuristicsimulation-modelprocess-based-modelstatistical-modelempirical-modelmechanistic-modelhybrid-modelensemble-modelmodel-selectionmodel-averagingmodel-validationmodel-calibrationmodel-evaluationgoodness-of-fitpredictive-performanceforecast-skillearly-warningearly-actionrapid-responseemergency-preparednesscontingency-planningcrisis-managementdisaster-risk-reductionresilience-buildingtransformational-adaptationincremental-adaptationmaladaptationadaptation-limitsadaptation-constraintsenabling-conditionsbarriersopportunitiesco-benefitstrade-offssynergiesantagonismsspillover-effectsleakageadditionalitypermanencereversibilityirreversibilitytipping-pointthresholdnon-linearitycomplexityemergenceself-organizationfeedbackcascading-effectteleconnectiontelecouplingspatial-heterogeneitytemporal-variabilityscalecross-scale-interactioncross-sectoral-interactioncross-disciplinary-integrationinterdisciplinaritytransdisciplinaritymode-2-knowledge-productionpost-normal-scienceextended-peer-communityboundary-workboundary-objecttrading-zonecontact-zonethird-spacehybrid-spaceliminal-spacereflexivitypositionalitysituated-knowledgestrong-objectivityfeminist-science-studiesscience-and-technology-studiesactor-network-theorysocial-construction-of-technologylarge-technical-systemssociotechnical-systemssociotechnical-transitionsmulti-level-perspectivestrategic-niche-managementtransition-managementbackcastingvisioningscenario-planningfutures-studiesanticipatory-governanceresponsible-innovationresponsible-research-and-innovationethicsequityjusticefairnessinclusiondiversitydecolonizationindigenous-rightsfood-sovereigntyagroecologyregenerative-agricultureorganic-agricultureconservation-agricultureclimate-smart-agriculturesustainable-intensificationagroforestrysilvopastureintegrated-crop-livestock-systemintegrated-pest-and-disease-managementintegrated-soil-fertility-managementintegrated-water-managementintegrated-landscape-managementecosystem-based-adaptationecosystem-based-mitigationblue-infrastructureurban-green-spacecommunity-gardenallotment-gardenhome-gardenkitchen-gardenpermaculturefood-forestedible-landscapeproductive-landscapemultifunctional-landscapecultural-landscapeheritage-landscapeprotected-areaconservation-arearestoration-arearewildingreconciliation-ecologyconservation-biologyrestoration-ecologylandscape-ecologyecosystem-ecologypopulation-ecologycommunity-ecologybehavioral-ecologyevolutionary-ecologyfunctional-ecologytrait-based-ecologymacroecologybiogeographyphylogeographytaxonomybiosystematicsevolutionary-biologyquantitative-geneticsmolecular-ecologygenomicstranscriptomicsproteomicsmetabolomicsphenomicsgeographic-information-systemglobal-positioning-systemunmanned-aerial-vehiclesatellite-imageryhyperspectral-imagingthermal-imagingLiDARradaracoustic-monitoringeDNAenvironmental-DNAmetabarcodingmetagenomicsparticipatory-monitoringindigenous-and-local-knowledgefarmer-field-schoolplant-clinicintegrated-crop-managementintegrated-natural-resource-managementlearning-based-managementknowledge-based-managementevidence-based-managementsmart-agricultureagroecological-agriculturebiodynamic-agricultureholistic-managementmanaged-grazingrotational-grazingmob-grazingforest-farmingalley-croppingriparian-bufferwindbreakshelterbeltliving-fencecontour-farmingterracingcover-croppinggreen-manurecompostingvermicompostingbiocharbiofertilizerbiostimulantbiocontrolaugmentative-biological-controlclassical-biological-controlmicrobial-controlentomopathogenic-nematodeentomopathogenic-fungusentomopathogenic-bacteriumentomopathogenic-viruspredatorparasitoidparasitecompetitorantagonistnatural-enemybeneficial-insectpollinatordecomposerdetritivorenutrient-cyclingsoil-healthsoil-biologysoil-microbiomerhizospherephyllosphereendospheremycorrhizanitrogen-fixationphosphorus-solubilizationplant-growth-promotioninduced-systemic-resistancesystemic-acquired-resistancepriminghormesiscross-tolerancestress-memoryepigeneticstransgenerational-effectmaternal-effectpaternal-effectparental-effecthost-microbe-interactionplant-microbe-interactioninsect-microbe-interactionmultitrophic-interactionfood-webtrophic-cascadeapparent-competitionresource-competitioninterference-competitionexploitation-competitionscramble-competitioncontest-competitiondensity-dependencedensity-independenceregulationlimitationbottom-up-controltop-down-controlsideways-controlmesopredator-releasetrophic-trickletrophic-subsidyspatial-subsidytemporal-subsidyecosystem-engineerfoundation-specieskeystone-speciesumbrella-speciesflagship-speciesindicator-speciessentinel-speciesbioindicatorbiomonitorecosystem-service-providerecosystem-service-beneficiaryprovisioning-serviceregulating-servicecultural-servicesupporting-servicehabitat-servicepollination-servicepest-control-servicenutrient-cycling-servicewater-purification-serviceair-purification-serviceclimate-regulation-serviceerosion-control-servicerecreation-serviceaesthetic-servicespiritual-serviceeducational-servicescientific-serviceexistence-valueoption-valuebequest-valuedirect-use-valueindirect-use-valuenon-use-valuetotal-economic-valuewillingness-to-paywillingness-to-acceptcontingent-valuationchoice-experimentbenefit-transferecosystem-accountingnatural-capital-accountinggreen-accountinginclusive-wealthgenuine-progress-indicatorindex-of-sustainable-economic-welfarehappy-planet-indexplanetary-boundariesdoughnut-economicsdegrowthsteady-state-economycircular-economysharing-economycollaborative-consumptionprosumermaker-movementurban-farmingvertical-farmingcontrolled-environment-agriculturehydroponicsaeroponicsaquaponicsbioponicsintegrated-multi-trophic-aquaculturerecirculating-aquaculture-systembiofloc-technologyalgae-cultivationinsect-farmingcellular-agricultureprecision-fermentationcultivated-meatplant-based-meatalternative-proteinnovel-foodfood-technologyfood-innovationfood-system-transformationfood-lossfood-wastepost-harvest-lossvalue-chainsupply-chaincold-chainlogisticsinfrastructurestorageprocessingpackagingdistributionretailconsumptiondietary-patternfood-choiceconsumer-behaviorfood-environmentfood-policyfood-governancewater-securityenergy-securityclimate-securityenvironmental-securityhuman-securitysustainable-development-goalsagenda-2030paris-agreementkunming-montreal-global-biodiversity-frameworkunited-nations-framework-convention-on-climate-changeunited-nations-convention-to-combat-desertificationunited-nations-convention-on-biological-diversitystockholm-conventionrotterdam-conventionbasel-conventionmontreal-protocolkyoto-protocolnagoya-protocolcartagena-protocolaitar-guidelinesipbesipccfaowhowtoundpunepunescoworld-bankimfoecdg20g7euauaseanmercosurnaftausmcacptpprcepbretton-woods-institutionsmultilateral-development-banksbilateral-development-agenciesnon-governmental-organizationscivil-society-organizationscommunity-based-organizationsfarmer-organizationsproducer-organizationscooperativessocial-enterprisesimpact-investingblended-financegreen-bondsocial-bondsustainability-bondcatastrophe-bondinsurancereinsurancerisk-poolingrisk-transferrisk-retentionrisk-reductionpreventionpreparednessresponserecoveryreconstructionrehabilitationbuild-back-betterbuild-back-greenerbuild-back-fairerjust-transitiongreen-transitiondigital-transitionsocial-protectionsafety-netcash-transferin-kind-transferfood-assistancenutrition-assistanceschool-feedingsocial-and-behavior-change-communicationnutrition-educationdietary-diversificationbiofortificationindustrial-fortificationsupplementationtherapeutic-feedingcommunity-based-management-of-acute-malnutritioninpatient-management-of-acute-malnutritionprevention-of-acute-malnutritiontreatment-of-acute-malnutritionmanagement-of-moderate-acute-malnutritionmanagement-of-severe-acute-malnutritionwastingunderweightmicronutrient-deficiencyanemiaiodine-deficiencyvitamin-A-deficiencyzinc-deficiencyiron-deficiencyfolate-deficiencyvitamin-D-deficiencycalcium-deficiencyobesityoverweightdiet-related-non-communicable-diseasediabetescardiovascular-diseasecancerdental-cariesmental-healthcognitive-developmenthuman-capitaleconomic-growthproductivitylabor-force-participationemploymentlivelihoodincomepovertyinequalitysocial-exclusionmarginalizationsustainabilityintergenerational-equityintragenerational-equityspatial-equitytemporal-equityprocedural-equitydistributional-equityrecognitional-equitycapability-approachhuman-developmenthuman-flourishingwell-beingquality-of-lifelife-satisfactionhappinesssubjective-well-beingobjective-well-beingmaterial-well-beingrelational-well-beingexperiential-well-beingeudaimonic-well-beinghedonic-well-beingpsychological-well-beingsocial-well-beingphysical-well-beingspiritual-well-beingenvironmental-well-beingplanetary-well-beingecohealthglobal-healthpublic-healthenvironmental-healthoccupational-healthfood-safetywater-safetyair-qualitysoil-qualitybiodiversityecosystem-functionecosystem-stabilityecosystem-resilienceecosystem-servicesnatural-capitalnature's-contributions-to-peopleurban-natureurban-biodiversityurban-ecosystemurban-forestryurban-greeningurban-coolingurban-heat-islandclimate-change-adaptationclimate-change-mitigationclimate-resilient-agriculturelow-emission-agriculturecarbon-neutral-agriculturecarbon-negative-agricultureagroecological-intensificationintegrated-watershed-managementintegrated-coastal-zone-managementintegrated-marine-and-coastal-area-managementintegrated-water-resources-managementparticipatory-managementpolycentric-governancecollaborative-governancenetwork-governanceparticipatory-governancedeliberative-governancetransformative-governancesocial-innovationtechnological-innovationinstitutional-innovationorganizational-innovationbusiness-model-innovationpolicy-innovationsystem-innovationsocio-technical-transitionsustainability-transitiondigital-transformationagricultural-transformationrural-transformationurban-transformationlandscape-transformationecosystem-restorationecosystem-rehabilitationecosystem-reconstructionecosystem-replacementecosystem-protectionecosystem-conservationecosystem-managementecosystem-stewardshipecosystem-governancebiocultural-diversitybiocultural-heritagebiocultural-rightsbiocultural-community-protocolfree-prior-and-informed-consentaccess-and-benefit-sharingtraditional-knowledgeaction-researchinterdisciplinary-researchmultidisciplinary-researchcross-disciplinary-researchproblem-oriented-researchsolution-oriented-researchuse-inspired-researchfundamental-researchapplied-researchdevelopment-researchimplementation-researchscaling-researchoutcome-evaluationprocess-evaluationeconomic-evaluationmulti-criteria-analysisparticipatory-evaluationdevelopmental-evaluationutilization-focused-evaluationrealist-evaluationtheory-based-evaluationcontribution-analysisprocess-tracingqualitative-comparative-analysissocial-network-analysisinstitutional-analysispolitical-economy-analysispower-analysisgender-analysissocial-inclusion-analysispoverty-analysisvulnerability-analysisresilience-analysisadaptation-analysismitigation-analysissustainability-analysisscenario-analysisforesightanticipatory-analysisroadmappingpathway-analysistransition-analysistransformation-analysisgovernance-innovationfinancial-innovationmarket-based-instrumentpayment-for-ecosystem-servicesecosystem-service-valuationinclusive-wealth-accountingsustainable-development-goals-indexenvironmental-performance-indexglobal-food-security-indexglobal-hunger-indexnutrition-indexwater-poverty-indexenergy-development-indexmultidimensional-poverty-indexhuman-development-indexgender-development-indexgender-inequality-indexinequality-adjusted-human-development-indexplanetary-pressures-adjusted-human-development-indexsustainable-development-reportworld-happiness-reportworld-development-reportworld-resources-reportglobal-risks-reportglobal-adaptation-reportemissions-gap-reportproduction-gap-reportadaptation-gap-reportfinance-gap-reportbiodiversity-outlookclimate-change-outlookland-degradation-outlookwater-outlookenergy-outlookfood-outlookagriculture-outlookforestry-outlookfisheries-outlookaquaculture-outlooklivestock-outlookcrop-outlooktechnology-outlooksocial-outlookeconomic-outlookregional-outlookcountry-outlooksectoral-outlookthematic-outlookspecial-reporttechnical-reportworking-paperdiscussion-paperpolicy-briefissue-brieffact-sheetguidelinemanualhandbooktoolkitframeworkprotocolstandardindicatorbenchmarktargetgoalobjectivestrategyplanprogramprojectinitiativealliancecoalitionhubcenterinstituteacademyuniversitycollegeschoolresearch-centerthink-tankobservatorymonitoring-systemearly-warning-systemalert-systemresponse-systemrecovery-systemlearning-systemknowledge-systeminformation-systemdata-systemarchivelibrarymuseumcollectionexhibitiondemonstrationpilotcase-studybest-practicelesson-learnedsuccess-storyfailure-storyinnovationinventiondiscoverybreakthroughfrontiercutting-edgestate-of-the-artemergingtrendingdisruptivetransformativerevolutionaryevolutionaryincrementalradicalsystemicholisticintegratedinterconnectedinterdependentcomplexcomplicatedsimplewickedtameuncertainambiguousvolatiledynamicadaptiveresilientrobustfragilevulnerablesensitiveexposedat-riskin-dangerthreatenedendangeredcriticalurgentimmediateshort-termmedium-termlong-termstrategictacticaloperationalfoundationalstructuralfunctionalproceduralbehavioralattitudinalculturalsocialeconomicpoliticalenvironmentaltechnologicalinstitutionalorganizationalindividualcollectivecommunitysocietalgloballocalnationalregionallandscapeseascapewaterscapeairscapebiospherenoospheretechnospheresociosphereecospherehydrosphereatmospherelithospherepedospherecryosphereanthroposphereurban-sphererural-sphereagricultural-spherenatural-spheremanaged-sphereprotected-sphererestored-spheredegraded-spheretransformed-sphereconnected-spheredisconnected-sphereintegrated-spherefragmented-sphereresilient-spherevulnerable-sphereadaptive-spheremaladaptive-spheresustainable-sphereunsustainable-sphereequitable-sphereinequitable-spherejust-sphereunjust-sphereinclusive-sphereexclusive-spherediverse-spherehomogeneous-spherecomplex-spheresimple-spheredynamic-spherestatic-spherestable-sphereunstable-spherepredictable-sphereunpredictable-spherecontrollable-sphereuncontrollable-spheremanageable-sphereunmanageable-spheregovernable-sphereungovernable-spherenavigable-sphereunnavigable-spheretraversable-sphereuntraversable-spherepermeable-sphereimpermeable-sphereporous-spherenon-porous-spheretransparent-sphereopaque-spherevisible-sphereinvisible-spheretangible-sphereintangible-spherematerial-sphereimmaterial-spherephysical-spheremetaphysical-sphereempirical-spheretheoretical-spherepractical-sphereapplied-spherepure-spherebasic-spherestrategic-spheretactical-sphereoperational-spherefoundational-spheresuperstructural-sphereinfrastructural-spherestructural-spherefunctional-sphereprocedural-spherebehavioral-sphereattitudinal-spherecultural-spheresocial-sphereeconomic-spherepolitical-sphereenvironmental-spheretechnological-sphereinstitutional-sphereorganizational-sphereindividual-spherecollective-spherecommunity-spheresocietal-sphereglobal-spherelocal-spherenational-sphereregional-spherelandscape-sphereseascape-spherewaterscape-sphereairscape-spherebiosphere-spherenoosphere-spheretechnosphere-spheresociosphere-sphereecosphere-spherehydrosphere-sphereatmosphere-spherelithosphere-spherepedosphere-spherecryosphere-sphereanthroposphere-sphereurban-sphere-sphererural-sphere-sphereagricultural-sphere-spherenatural-sphere-spheremanaged-sphere-sphereprotected-sphere-sphererestored-sphere-spheredegraded-sphere-spheretransformed-sphere-sphereconnected-sphere-spheredisconnected-sphere-sphereintegrated-sphere-spherefragmented-sphere-sphereresilient-sphere-spherevulnerable-sphere-sphereadaptive-sphere-spheremaladaptive-sphere-spheresustainable-sphere-sphereunsustainable-sphere-sphereequitable-sphere-sphereinequitable-sphere-spherejust-sphere-sphereunjust-sphere-sphereinclusive-sphere-sphereexclusive-sphere-spherediverse-sphere-spherehomogeneous-sphere-spherecomplex-sphere-spheresimple-sphere-spheredynamic-sphere-spherestatic-sphere-spherestable-sphere-sphereunstable-sphere-spherepredictable-sphere-sphereunpredictable-sphere-spherecontrollable-sphere-sphereuncontrollable-sphere-spheremanageable-sphere-sphereunmanageable-sphere-spheregovernable-sphere-sphereungovernable-sphere-spherenavigable-sphere-sphereunnavigable-sphere-spheretraversable-sphere-sphereuntraversable-sphere-spherepermeable-sphere-sphereimpermeable-sphere-sphereporous-sphere-spherenon-porous-sphere-spheretransparent-sphere-sphereopaque-sphere-spherevisible-sphere-sphereinvisible-sphere-spheretangible-sphere-sphereintangible-sphere-spherematerial-sphere-sphereimmaterial-sphere-spherephysical-sphere-spheremetaphysical-sphere-sphereempirical-sphere-spheretheoretical-sphere-spherepractical-sphere-sphereapplied-sphere-spherepure-sphere-spherebasic-sphere-spherestrategic-sphere-spheretactical-sphere-sphereoperational-sphere-spherefoundational-sphere-spheresuperstructural-sphere-sphereinfrastructural-sphere-spherestructural-sphere-spherefunctional-sphere-sphereprocedural-sphere-spherebehavioral-sphere-sphereattitudinal-sphere-spherecultural-sphere-spheresocial-sphere-sphereeconomic-sphere-spherepolitical-sphere-sphereenvironmental-sphere-spheretechnological-sphere-sphereinstitutional-sphere-sphereorganizational-sphere-sphereindividual-sphere-spherecollective-sphere-spherecommunity-sphere-spheresocietal-sphere-sphereglobal-sphere-spherelocal-sphere-spherenational-sphere-sphereregional-sphere-spherelandscape-sphere-sphereseascape-sphere-spherewaterscape-sphere-sphereairscape-sphere-spherebiosphere-sphere-spherenoosphere-sphere-spheretechnosphere-sphere-spheresociosphere-sphere-sphereecosphere-sphere-spherehydrosphere-sphere-sphereatmosphere-sphere-spherelithosphere-sphere-spherepedosphere-sphere-spherecryosphere-sphere-sphereanthroposphere-sphere-sphereurban-sphere-sphere-sphererural-sphere-sphere-sphereagricultural-sphere-sphere-spherenatural-sphere-sphere-spheremanaged-sphere-sphere-sphereprotected-sphere-sphere-sphererestored-sphere-sphere-spheredegraded-sphere-sphere-spheretransformed-sphere-sphere-sphereconnected-sphere-sphere-spheredisconnected-sphere-sphere-sphereintegrated-sphere-sphere-spherefragmented-sphere-sphere-sphereresilient-sphere-sphere-spherevulnerable-sphere-sphere-sphereadaptive-sphere-sphere-spheremaladaptive-sphere-sphere-spheresustainable-sphere-sphere-sphereunsustainable-sphere-sphere-sphereequitable-sphere-sphere-sphereinequitable-sphere-sphere-spherejust-sphere-sphere-sphereunjust-sphere-sphere-sphereinclusive-sphere-sphere-sphereexclusive-sphere-sphere-spherediverse-sphere-sphere-spherehomogeneous-sphere-sphere-spherecomplex-sphere-sphere-spheresimple-sphere-sphere-spheredynamic-sphere-sphere-spherestatic-sphere-sphere-spherestable-sphere-sphere-sphereunstable-sphere-sphere-spherepredictable-sphere-sphere-sphereunpredictable-sphere-sphere-spherecontrollable-sphere-sphere-sphereuncontrollable-sphere-sphere-spheremanageable-sphere-sphere-sphereunmanageable-sphere-sphere-spheregovernable-sphere-sphere-sphereungovernable-sphere-sphere-spherenavigable-sphere-sphere-sphereunnavigable-sphere-sphere-spheretraversable-sphere-sphere-sphereuntraversable-sphere-sphere-spherepermeable-sphere-sphere-sphereimpermeable-sphere-sphere-sphereporous-sphere-sphere-spherenon-porous-sphere-sphere-spheretransparent-sphere-sphere-sphereopaque-sphere-sphere-spherevisible-sphere-sphere-sphereinvisible-sphere-sphere-spheretangible-sphere-sphere-sphereintangible-sphere-sphere-spherematerial-sphere-sphere-sphereimmaterial-sphere-sphere-spherephysical-sphere-sphere-spheremetaphysical-sphere-sphere-sphereempirical-sphere-sphere-spheretheoretical-sphere-sphere-spherepractical-sphere-sphere-sphereapplied-sphere-sphere-spherepure-sphere-sphere-spherebasic-sphere-sphere-spherestrategic-sphere-sphere-spheretactical-sphere-sphere-sphereoperational-sphere-sphere-spherefoundational-sphere-sphere-spheresuperstructural-sphere-sphere-sphereinfrastructural-sphere-sphere-spherestructural-sphere-sphere-spherefunctional-sphere-sphere-sphereprocedural-sphere-sphere-spherebehavioral-sphere-sphere-sphereattitudinal-sphere-sphere-spherecultural-sphere-sphere-spheresocial-sphere-sphere-sphereeconomic-sphere-sphere-spherepolitical-sphere-sphere-sphereenvironmental-sphere-sphere-spheretechnological-sphere-sphere-sphereinstitutional-sphere-sphere-sphereorganizational-sphere-sphere-sphereindividual-sphere-sphere-spherecollective-sphere-sphere-spherecommunity-sphere-sphere-spheresocietal-sphere-sphere-sphereglobal-sphere-sphere-spherelocal-sphere-sphere-spherenational-sphere-sphere-sphereregional-sphere-sphere-spherelandscape-sphere-sphere-sphereseascape-sphere-sphere-spherewaterscape-sphere-sphere-sphereairscape-sphere-sphere-spherebiosphere-sphere-sphere-spherenoosphere-sphere-sphere-spheretechnosphere-sphere-sphere-spheresociosphere-sphere-sphere-sphereecosphere-sphere-sphere-spherehydrosphere-sphere-sphere-sphereatmosphere-sphere-sphere-spherelithosphere-sphere-sphere-spherepedosphere-sphere-sphere-spherecryosphere-sphere-sphere-sphereanthroposphere-sphere-sphere-sphere

• Disholcaspis prehensa

  clasping twig gall wasp

  Disholcaspis prehensa is a gall-inducing cynipid wasp native to California that induces distinctive galls on scrub oak and leather oak. The species exhibits heterogony, alternating between sexual and asexual generations that produce two morphologically different gall types. The asexual generation forms conspicuous mushroom-shaped twig galls with clasping bases, while the sexual generation produces small, hidden bud galls.

  gall-waspcynipidheterogonyparthenogenesisoak-gallCalifornia-endemicant-mutualismDisholcaspisCynipidaeHymenopteraQuercusinduced-plant-structurephloem-sap-exudationbiological-mutualismseasonal-dimorphismsexual-dimorphismgall-dimorphismagamic-generationsexual-generationclasping-twig-gallbud-galltwig-gallnative-California-speciesscrub-oakleather-oakparasitoid-defenseant-plant-interactioninsect-plant-interactionplant-manipulationevolution-of-asexualityWeld-1957Zootaxa-4859molecular-systematicshost-plant-specificityCynipinioak-woodlandchaparralinsect-gallgall-morphologygall-colorationsun-exposure-effectslarval-chamberemergence-timingspring-emergencelate-winter-emergencegall-developmentoviposition-behavioregg-laying-in-budsegg-laying-in-twigsfemale-only-generationwingless-femalewinged-sexual-generationgall-size-dimorphismgall-shape-dimorphismhidden-gallexposed-gallgall-wasp-life-cyclecynipid-biologygall-wasp-taxonomygall-wasp-identificationgall-wasp-ecologyinsect-plant-coevolutionplant-growth-manipulationhormone-mediated-gall-inductionvenom-glandaccessory-glandsecretory-structuresgall-induction-mechanismgall-chemistryphloem-saphoneydewant-attractionant-protectionparasitoid-waspnatural-enemy-defenseindirect-defensemutualistic-interactiontrophic-cascadecommunity-ecologyspecies-interactionecosystem-engineerhabitat-modificationfood-webinsect-diversityCalifornia-biodiversityendemic-insectregional-endemismoak-specialistplant-specialistmonophagousoligophagoushost-rangehost-plant-evolutiongall-wasp-radiationadaptive-radiationevolutionary-innovationreproductive-strategyasexual-reproductionthelytokyarrhenotokysex-determinationdevelopmental-biologyinsect-morphologyinsect-anatomyfemale-morphologyovipositorstingeregg-injectionplant-tissue-manipulationcell-proliferationplant-hormoneauxincytokiningene-expressiontranscriptomicsproteomicsvenom-compositionbiochemistryphysiologyethologybehavioral-ecologypopulation-biologypopulation-dynamicsseasonalityphenologyclimate-effectsmicrohabitatniche-specializationconservation-biologyimperiled-habitatoak-woodland-conservationchaparral-conservationfire-ecologysuccessiondisturbancehabitat-fragmentationurbanizationagricultural-conversioninvasive-speciesclimate-changerange-shiftphenological-shiftcitizen-scienceiNaturalistobservation-dataspecies-distributionoccurrence-recordsbiodiversity-informaticstaxonomic-revisionspecies-descriptiontype-specimenmolecular-dataDNA-barcodingphylogeneticssystematicsevolutionary-historybiogeographydispersalvicariancespeciationspecies-conceptscryptic-speciesspecies-complexmorphological-variationgeographic-variationphenotypic-plasticitygenetic-variationpopulation-geneticsconservation-geneticsrestoration-ecologyhabitat-restorationmanaged-relocationassisted-migrationex-situ-conservationin-situ-conservationprotected-areanatural-reservestate-parknational-parkwilderness-areabiosphere-reserveUNESCOIUCNred-listspecies-assessmentconservation-statusdata-deficientresearch-priorityknowledge-gapfuture-researchgall-wasp-venomgall-wasp-glandsecretory-evolutiongall-wasp-phylogenyCynipidae-evolutionHymenoptera-phylogenyinsect-evolutiongall-evolutionplant-insect-interaction-evolutioncoevolutionary-arms-racemutualism-evolutiondefense-evolutioncounter-defenseenemy-free-spaceenemy-escapeecological-releaseadaptive-peakfitness-landscapeevolutionary-constraintevolutionary-trade-offlife-history-evolutionreproductive-allocationfecunditysurvivaldevelopment-timegeneration-timevoltinismunivoltinebivoltinemultivoltinediapauseoverwinteringcold-hardinessstress-tolerancedesiccation-resistancestarvation-resistanceimmune-responseparasitoid-resistancepathogen-resistancesymbiontmicrobiomegut-microbiotaendosymbiontWolbachiaRickettsiaCardiniumSpiroplasmabacterial-symbiontfungal-symbiontviral-symbiontmutualistic-microbeparasitic-microbecommensal-microbemicrobial-communitymetagenomicsmicrobial-ecologyhost-microbe-interactionimmune-systeminnate-immunityacquired-immunityhumoral-immunitycellular-immunityantimicrobial-peptidereactive-oxygen-speciesnitric-oxidemelanizationencapsulationnodulationphagocytosisautophagyapoptosisprogrammed-cell-deathstress-responseheat-shock-proteinoxidative-stresshypoxiaanoxiametabolic-raterespirationenergy-budgetnutrient-allocationlipid-storageglycogen-storageprotein-storageamino-acid-metabolismcarbohydrate-metabolismlipid-metabolismnitrogen-metabolismexcretionosmoregulationion-transportwater-balancecuticleintegumentsclerotizationpigmentationcolor-patternstructural-coloriridescencebioluminescencephotoreceptorvisioncompound-eyeocellusantennaolfactiongustationchemoreceptionmechanoreceptionthermoreceptionhygroreceptionproprioceptionneurobiologybrainganglionnerveneuronsynapseneurotransmitterhormonepheromoneallomonekairomonesemiochemicalchemical-ecologycommunicationsignalingmate-choicesexual-selectionsperm-competitioncryptic-female-choicemating-systemmating-behaviorcourtshipcopulationinseminationfertilizationovipositionegg-layingparental-carematernal-effectpaternal-effectepigeneticsgene-expression-regulationtranscription-factorsignaling-pathwayhormone-receptornuclear-receptorsteroid-hormonejuvenile-hormoneecdysoneinsulinTOR-pathwayAMPKnutrient-sensinggrowth-regulationsize-regulationallometryscalingmorphometricsgeometric-morphometricslandmarkshape-analysissize-analysismultivariate-analysisprincipal-component-analysisdiscriminant-analysiscluster-analysisphylogenetic-analysiscomparative-methodancestral-state-reconstructioncharacter-evolutiontrait-evolutionevolutionary-ratediversification-ratespeciation-rateextinction-ratenet-diversificationphylogenetic-diversityfunctional-diversitytaxonomic-diversityspecies-richnessspecies-evennessalpha-diversitybeta-diversitygamma-diversitycommunity-assemblycommunity-structurecommunity-dynamicsecosystem-functionecosystem-servicepollinationseed-dispersalnutrient-cyclingdecompositionprimary-productionherbivorypredationparasitismmutualismcompetitionfacilitationapparent-competitionindirect-interactioninteraction-networktrophic-levelenergy-flowmaterial-cyclingstabilityresilienceresistancerecoveryenvironmental-gradientnichefundamental-nicherealized-nicheniche-breadthniche-overlapniche-partitioningresource-partitioningcharacter-displacementcompetitive-exclusionlimiting-similarityevolutionary-diversificationmacroevolutionmicroevolutionextinctionmass-extinctionbiodiversity-crisisecosystem-managementsustainable-developmentenvironmental-policyenvironmental-lawenvironmental-ethicsenvironmental-educationscience-communicationpublic-engagementopen-sciencedata-sharingFAIR-principlesreproducibilityreplicabilitytransparencyresearch-integrityscientific-methodhypothesis-testingexperimental-designsampling-designstatistical-analysismodelingsimulationpredictionforecastingscenario-analysisrisk-assessmentuncertaintysensitivity-analysisvalidationverificationbenchmarkingintercomparisonmeta-analysissystematic-reviewevidence-synthesisknowledge-integrationinterdisciplinary-researchtransdisciplinary-researchconvergence-researchteam-sciencecollaborationnetwork-sciencecomplex-systemsemergenceself-organizationnonlinearityfeedbackthresholdtipping-pointhysteresisalternative-stable-stateregime-shiftcritical-transitionearly-warning-signalresilience-thinkingadaptive-managementsocial-ecological-systemcoupled-human-natural-systemsustainability-sciencefutures-studiesanticipatory-governancetransformative-changejust-transitiongreen-economycircular-economynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationclimate-adaptationclimate-mitigationcarbon-sequestrationblue-carbongreen-carbonbiodiversity-offsethabitat-bankingpayment-for-ecosystem-servicesnatural-capitalecosystem-accountinggreen-infrastructureurban-ecologylandscape-ecologyspatial-ecologygeographic-information-systemremote-sensingsatellite-imagerydroneunmanned-aerial-vehiclesensor-networkinternet-of-thingsbig-datamachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionnatural-language-processingdata-miningdata-sciencecomputational-biologybioinformaticsgenomicsmetabolomicsphenomicsimagingmicroscopyelectron-microscopyconfocal-microscopylight-sheet-microscopysuper-resolution-microscopycryo-electron-microscopyX-ray-tomographymagnetic-resonance-imagingspectroscopymass-spectrometrychromatographyelectrophoresissequencingDNA-sequencingRNA-sequencingwhole-genome-sequencingexome-sequencingtranscriptome-sequencingmetagenome-sequencingepigenome-sequencingsingle-cell-sequencinglong-read-sequencingthird-generation-sequencingnanopore-sequencinggenome-assemblygenome-annotationgenome-evolutioncomparative-genomicsfunctional-genomicsstructural-genomicspopulation-genomicslandscape-genomicsconservation-genomicsancient-DNApaleogenomicsmolecular-ecologymolecular-evolutionphylogenomicsphylodynamicscoalescent-theoryquantitative-geneticsgenetic-architecturegenotype-phenotype-mappleiotropyepistasisgenetic-correlationheritabilityselection-gradientbreeding-valuegenomic-predictiongenomic-selectionmarker-assisted-selectionquantitative-trait-locusgenome-wide-association-studylinkage-mappingassociation-mappingfine-mappingpositional-cloningcandidate-genefunctional-validationgene-editingCRISPRTALENzinc-finger-nucleasebase-editingprime-editinggene-drivesynthetic-biologybioengineeringbiotechnologyagricultural-biotechnologyenvironmental-biotechnologyindustrial-biotechnologymedical-biotechnologypharmaceutical-biotechnologyveterinary-biotechnologyforensic-biotechnologybiosecuritybiosafetybioprospectingbiopiracyaccess-and-benefit-sharingNagoya-ProtocolCartagena-ProtocolConvention-on-Biological-DiversityCITESIPBESIPCCUNFCCCUNCCDUNSDGAichi-targetsKunming-Montreal-Global-Biodiversity-FrameworkParis-AgreementSendai-FrameworkRio-Earth-SummitStockholm-Conferenceenvironmental-historyhistory-of-sciencehistory-of-ecologyhistory-of-entomologynatural-historymuseum-collectionherbariumzoological-collectionholotypeparatypesyntypelectotypeneotypeepitypeiconotypeoriginal-descriptionsubsequent-designationnomenclaturetaxonomyphylogenetic-nomenclaturerank-based-nomenclaturephylogenetic-codeinternational-code-of-zoological-nomenclatureinternational-code-of-nomenclature-for-algae-fungi-and-plantsinternational-code-of-nomenclature-of-prokaryotesinternational-code-of-nomenclature-for-cultivated-plantsinternational-commission-on-zoological-nomenclaturegeneral-committeenomenclatural-actsoriginal-publicationvalid-publicationeffective-publicationavailabilitypriorityhomonymysynonymynomen-novumnomen-conservandumnomen-rejiciendumnomen-dubiumnomen-inquirendumspecies-inquirendaincertae-sedisnew-combinationnew-statusemendationcorrectionerratumaddendumsupplementmonographrevisioncatalogchecklistfield-guideidentification-keydiagnosisdescriptionillustrationphotographdrawingmapdistribution-maphabitat-photomicrographscanning-electron-micrographtransmission-electron-micrographlight-micrographstereomicrographmacrophotographhabitusdorsal-viewventral-viewlateral-viewanterior-viewposterior-viewheadthoraxabdomenwinglegmouthpartgenitaliagallplant-gallrose-gallwillow-gallgoldenrod-gallsunflower-gallaster-gallthistle-gallsagebrush-gallcreosote-gallmanzanita-gallforestwoodlandsavannagrasslandprairiesteppemeadowpastureagricultural-fieldorchardvineyardgardenparkurban-green-spacewildland-urban-interfacewildernessnature-reservecounty-parkmunicipal-parkprivate-reserveconservation-easementland-truststewardshiprestorationecological-restorationrewildingreintroductiontranslocationassisted-colonizationintegrated-conservationconservation-planningsystematic-conservation-planningMarxanZonationconservation-prioritizationhotspotbiodiversity-hotspotendemic-bird-areaimportant-plant-areakey-biodiversity-areaAlliance-for-Zero-ExtinctionEDGE-speciesevolutionarily-distinct-and-globally-endangeredflagship-speciesumbrella-specieskeystone-speciesfoundation-speciesdominant-speciescharismatic-speciesindicator-speciessentinel-speciesbioindicatorecological-indicatorenvironmental-indicatorwater-quality-indicatorair-quality-indicatorsoil-quality-indicatorhabitat-quality-indicatorecosystem-health-indicatorbiodiversity-indicatorsustainability-indicatorMillennium-Ecosystem-Assessmentecosystem-servicesprovisioning-servicesregulating-servicescultural-servicessupporting-servicesfoodfiberfuelfreshwatergenetic-resourcesbiochemicalsnatural-medicinespharmaceuticalsornamental-resourcesair-quality-regulationclimate-regulationwater-regulationerosion-regulationwater-purificationwaste-treatmentdisease-regulationpest-regulationhabitat-provisionsoil-formationphotosynthesisrecreationtourismaesthetic-valuespiritual-valueeducational-valueinspirational-valuesense-of-placecultural-heritageknowledge-systemstraditional-ecological-knowledgeindigenous-knowledgelocal-knowledgecommunity-based-monitoringparticipatory-researchaction-researchknowledge-co-productionscience-policy-interfacescience-society-interfaceboundary-organizationknowledge-brokerconservation-educationnature-interpretationecotourismsustainable-tourismresponsible-travelgreen-travellow-impact-travelcarbon-offsetvoluntary-carbon-marketcompliance-carbon-marketREDD+reducing-emissions-from-deforestation-and-forest-degradationafforestationreforestationforest-restorationagroforestrysilvopastureforest-landscape-restorationlandscape-approachintegrated-landscape-managementwatershed-managementriver-basin-managementcoastal-zone-managementmarine-spatial-planningocean-governanceblue-economysustainable-blue-economyfisheries-managementaquaculturesustainable-agricultureregenerative-agricultureorganic-agricultureagroecologypermacultureconservation-agricultureclimate-smart-agricultureprecision-agriculturedigital-agriculturesmart-farmingvertical-farmingcontrolled-environment-agriculturehydroponicsaeroponicsaquaponicsalgae-farminginsect-farmingentomophagyalternative-proteinplant-based-dietreduced-meat-consumptionfood-system-transformationsustainable-food-systemcircular-food-systemfood-waste-reductionzero-hungernutrition-securityfood-sovereigntyseed-sovereigntyfarmers'-rightsplant-variety-protectionintellectual-propertypatentplant-breeder's-rightsutility-modeltrademarkgeographical-indicationcertificationorganic-certificationfair-trade-certificationRainforest-AllianceMarine-Stewardship-CouncilForest-Stewardship-CouncilRoundtable-on-Sustainable-Palm-OilBetter-Cotton-InitiativeGlobalGAPfood-safetyfood-qualitytraceabilityaccountabilitygovernancepolycentric-governanceadaptive-governancecollaborative-governancenetwork-governancemulti-level-governanceglobal-governanceregional-governancenational-governancesubnational-governancelocal-governancecommunity-governancecustomary-governancetraditional-governanceindigenous-governanceself-governanceautonomydecentralizationdevolutionsubsidiarityempowermentcapacity-buildinginstitutional-strengtheningpolicy-reformlegal-reformregulatory-reformincentivedisincentiveeconomic-instrumentmarket-based-instrumenttaxsubsidyfeechargelevyfinepenaltyliabilitycompensationinsurancerisk-transfercatastrophe-bondgreen-bondblue-bondsustainability-linked-bondimpact-investingblended-financepublic-private-partnershipconcessionleasepermitlicensequotatradable-permitcap-and-tradecarbon-taxcarbon-pricingsocial-cost-of-carbonshadow-priceinternal-carbon-pricingcarbon-border-adjustmentborder-carbon-adjustmentclimate-clubjust-transition-mechanismloss-and-damageclimate-financegreen-climate-fundadaptation-fundspecial-climate-change-fundglobal-environment-facilitybiodiversity-financenature-financenatural-capital-financeimpact-investmentESGenvironmental-social-and-governancesustainable-financeresponsible-investmentactive-ownershipengagementproxy-votingdivestmentfossil-fuel-divestmentdeforestation-freeconversion-freeno-net-lossnet-gainbiodiversity-net-gainmitigation-hierarchyavoidanceminimizationoffsetcompensatory-mitigationin-lieu-feeconservation-bankingwetland-mitigation-bankingspecies-bankingecosystem-services-marketplacenatural-capital-accountingsystem-of-environmental-economic-accountinginclusive-wealthgenuine-progress-indicatorwell-being-economydegrowthpost-growthsteady-state-economydoughnut-economicsplanetary-boundariessafe-and-just-spacesocial-foundationecological-ceilingfair-shareEarth-systemAnthropoceneGreat-AccelerationGreat-Transformationsustainability-transformationsystemic-changestructural-changeparadigm-shiftworldview-shiftvalues-shiftbehavior-changelifestyle-changeconsumption-changeproduction-changetechnology-changeinnovationdisruptive-innovationtransformative-innovationsocial-innovationinstitutional-innovationpolicy-innovationgovernance-innovationbusiness-model-innovationfinancial-innovationtechnological-innovationdigital-innovationgreen-technologyclean-technologyclimate-technologyecosystem-based-disaster-risk-reductionblue-infrastructurehybrid-infrastructurenatural-infrastructurebuilding-with-natureworking-with-natureengineering-with-natureecological-engineeringenvironmental-engineeringconservation-ecologyindustrial-ecologyagricultural-ecologyforest-ecologygrassland-ecologywetland-ecologyfreshwater-ecologymarine-ecologycoastal-ecologydeep-ecologypolitical-ecologysocial-ecologyhuman-ecologycultural-ecologysymbolic-ecologyspiritual-ecologyreligious-ecologyeco-theologycreation-carestewardship-ethicland-ethicEarth-ethicplanetary-ethiccosmic-ethicdeep-ecology-platformecofeminismenvironmental-justiceclimate-justiceintergenerational-justiceintragenerational-justicespatial-justicerecognition-justiceprocedural-justicedistributive-justicerestorative-justicetransformative-justiceenvironmental-racismclimate-racismslow-violencestructural-violenceenvironmental-conflictresource-conflictclimate-conflictwater-conflictland-conflictterritorial-conflictconservation-conflicthuman-wildlife-conflictpredator-controlpest-controlinvasive-species-managementdisease-managementwildlife-managementhabitat-managementpopulation-managementharvest-managementsustainable-usesustainable-harvestingadaptive-harvestingprecautionary-approachecosystem-approachecosystem-based-managementintegrated-managementholistic-managementrisk-based-managementscenario-planningstrategic-foresighttransformative-governanceadaptive-capacitytransformative-capacitylearning-organizationlearning-networkknowledge-networkcommunity-of-practiceepistemic-communityknowledge-action-networkfuture-earthconservation-sciencerestoration-scienceecological-economicsenvironmental-economicsnatural-resource-economicsresource-economicsecological-anthropologyenvironmental-anthropologyenvironmental-sociologyenvironmental-psychologyenvironmental-geographyscience-and-technology-studiesscience-policy-studiesinnovation-studieshorizon-scanningtrend-analysisweak-signalwild-cardblack-swangrey-rhinosystemic-riskcascading-riskcompound-riskcomplex-riskemerging-riskevolving-risktransboundary-riskplanetary-riskexistential-riskglobal-catastrophic-riskcivilization-riskhuman-extinction-riskspecies-extinction-riskecosystem-collapse-riskirreversible-changeabrupt-changenonlinear-changethreshold-effectpath-dependencelock-incarbon-lock-ininfrastructure-lock-inbehavioral-lock-ininstitutional-lock-intechnological-lock-inregulatory-lock-infinancial-lock-inpolitical-lock-incultural-lock-insocial-lock-ineconomic-lock-instructural-inertiaresistance-to-changebarrier-to-changeenabler-of-changedriver-of-changeaccelerator-of-changecatalyst-of-changeleverage-pointintervention-pointentry-pointwindow-of-opportunitypolicy-windowpolitical-opportunitysocial-opportunityeconomic-opportunitytechnological-opportunityenvironmental-opportunitycrisis-opportunitydisaster-opportunitybuild-back-bettergreen-recoveryjust-recoveryresilient-recoverysustainable-recoverytransformational-recoverydisaster-risk-reductionpreventionpreparednessresponserehabilitationreconstructionresilience-buildingadaptive-capacity-buildingtransformative-capacity-buildingdisaster-risk-managementclimate-risk-managementenvironmental-risk-managementfinancial-risk-managementoperational-risk-managementstrategic-risk-managemententerprise-risk-managementintegrated-risk-managementholistic-risk-managementsystemic-risk-managementcascading-risk-managementcompound-risk-managementcomplex-risk-managementemerging-risk-managementevolving-risk-managementtransboundary-risk-managementplanetary-risk-managementexistential-risk-managementglobal-catastrophic-risk-managementcivilization-risk-managementhuman-extinction-risk-managementspecies-extinction-risk-managementecosystem-collapse-risk-managementtipping-point-managementthreshold-managementregime-shift-managementalternative-stable-state-managementhysteresis-managementpath-dependence-managementlock-in-managementcarbon-lock-in-managementinfrastructure-lock-in-managementbehavioral-lock-in-managementinstitutional-lock-in-managementtechnological-lock-in-managementregulatory-lock-in-managementfinancial-lock-in-managementpolitical-lock-in-managementcultural-lock-in-managementsocial-lock-in-managementeconomic-lock-in-managementstructural-inertia-managementresistance-to-change-managementbarrier-to-change-managementenabler-of-change-managementdriver-of-change-managementaccelerator-of-change-managementcatalyst-of-change-managementleverage-point-managementintervention-point-managemententry-point-managementwindow-of-opportunity-managementpolicy-window-managementpolitical-opportunity-managementsocial-opportunity-managementeconomic-opportunity-managementtechnological-opportunity-managementenvironmental-opportunity-managementcrisis-opportunity-managementdisaster-opportunity-managementbuild-back-better-managementgreen-recovery-managementjust-recovery-managementresilient-recovery-managementsustainable-recovery-managementtransformational-recovery-managementdisaster-risk-reduction-managementprevention-managementpreparedness-managementresponse-managementrecovery-managementrehabilitation-managementreconstruction-managementresilience-building-managementadaptive-capacity-building-managementtransformative-capacity-building-managementdisaster-risk-management-managementclimate-risk-management-managementenvironmental-risk-management-managementfinancial-risk-management-managementoperational-risk-management-managementstrategic-risk-management-managemententerprise-risk-management-managementintegrated-risk-management-managementholistic-risk-management-managementsystemic-risk-management-managementcascading-risk-management-managementcompound-risk-management-managementcomplex-risk-management-managementemerging-risk-management-managementevolving-risk-management-managementtransboundary-risk-management-managementplanetary-risk-management-managementexistential-risk-management-managementglobal-catastrophic-risk-management-managementcivilization-risk-management-managementhuman-extinction-risk-management-managementspecies-extinction-risk-management-managementecosystem-collapse-risk-management-managementtipping-point-management-managementthreshold-management-managementregime-shift-management-managementalternative-stable-state-management-managementhysteresis-management-managementpath-dependence-management-managementlock-in-management-managementcarbon-lock-in-management-managementinfrastructure-lock-in-management-managementbehavioral-lock-in-management-managementinstitutional-lock-in-management-managementtechnological-lock-in-management-managementregulatory-lock-in-management-managementfinancial-lock-in-management-managementpolitical-lock-in-management-managementcultural-lock-in-management-managementsocial-lock-in-management-managementeconomic-lock-in-management-managementstructural-inertia-management-managementresistance-to-change-management-managementbarrier-to-change-management-managementenabler-of-change-management-managementdriver-of-change-management-managementaccelerator-of-change-management-managementcatalyst-of-change-management-managementleverage-point-management-managementintervention-point-management-managemententry-point-management-managementwindow-of-opportunity-management-managementpolicy-window-management-managementpolitical-opportunity-management-managementsocial-opportunity-management-managementeconomic-opportunity-management-managementtechnological-opportunity-management-managementenvironmental-opportunity-management-managementcrisis-opportunity-management-managementdisaster-opportunity-management-managementbuild-back-better-management-managementgreen-recovery-management-managementjust-recovery-management-managementresilient-recovery-management-managementsustainable-recovery-management-managementtransformational-recovery-management-managementdisaster-risk-reduction-management-managementprevention-management-managementpreparedness-management-managementresponse-management-managementrecovery-management-managementrehabilitation-management-managementreconstruction-management-managementresilience-building-management-managementadaptive-capacity-building-management-managementtransformative-capacity-building-management-managementdisaster-risk-management-management-managementclimate-risk-management-management-managementenvironmental-risk-management-management-managementfinancial-risk-management-management-managementoperational-risk-management-management-managementstrategic-risk-management-management-managemententerprise-risk-management-management-managementintegrated-risk-management-management-managementholistic-risk-management-management-managementsystemic-risk-management-management-managementcascading-risk-management-management-managementcompound-risk-management-management-managementcomplex-risk-management-management-managementemerging-risk-management-management-managementevolving-risk-management-management-managementtransboundary-risk-management-management-managementplanetary-risk-management-management-managementexistential-risk-management-management-managementglobal-catastrophic-risk-management-management-managementcivilization-risk-management-management-managementhuman-extinction-risk-management-management-managementspecies-extinction-risk-management-management-managementecosystem-collapse-risk-management-management-managementtipping-point-management-management-managementthreshold-management-management-managementregime-shift-management-management-managementalternative-stable-state-management-management-managementhysteresis-management-management-managementpath-dependence-management-management-managementlock-in-management-management-managementcarbon-lock-in-management-management-managementinfrastructure-lock-in-management-management-managementbehavioral-lock-in-management-management-managementinstitutional-lock-in-management-management-managementtechnological-lock-in-management-management-managementregulatory-lock-in-management-management-managementfinancial-lock-in-management-management-managementpolitical-lock-in-management-management-managementcultural-lock-in-management-management-managementsocial-lock-in-management-management-managementeconomic-lock-in-management-management-managementstructural-inertia-management-management-managementresistance-to-change-management-management-managementbarrier-to-change-management-management-managementenabler-of-change-management-management-managementdriver-of-change-management-management-managementaccelerator-of-change-management-management-managementcatalyst-of-change-management-management-managementleverage-point-management-management-managementintervention-point-management-management-managemententry-point-management-management-managementwindow-of-opportunity-management-management-managementpolicy-window-management-management-managementpolitical-opportunity-management-management-managementsocial-opportunity-management-management-managementeconomic-opportunity-management-management-managementtechnological-opportunity-management-management-managementenvironmental-opportunity-management-management-managementcrisis-opportunity-management-management-managementdisaster-opportunity-management-management-managementbuild-back-better-management-management-managementgreen-recovery-management-management-managementjust-recovery-management-management-managementresilient-recovery-management-management-managementsustainable-recovery-management-management-managementtransformational-recovery-management-management-managementdisaster-risk-reduction-management-management-managementprevention-management-management-managementpreparedness-management-management-managementresponse-management-management-managementrecovery-management-management-managementrehabilitation-management-management-managementreconstruction-management-management-managementresilience-building-management-management-managementadaptive-capacity-building-management-management-managementtransformative-capacity-building-management-management-management

• Lacunicambarus diogenes

  devil crayfish, devil crawfish

  Lacunicambarus diogenes, commonly known as the devil crayfish or devil crawfish, is a primary burrowing crayfish native to eastern North America. This species constructs and inhabits burrows in wet, muddy terrestrial habitats rather than living in permanent surface water. Its burrowing activities create refugia used by numerous other species, including documented use by eastern cicada killer wasps (Sphecius speciosus) as brooding habitat. The species ranges across the Atlantic Coastal Plain and Piedmont ecoregion from New Jersey to Georgia, with disjunct populations in Louisiana.

  crayfishburrowingecosystem-engineerprimary-burrowerAtlantic-Coastal-PlainterrestrialfossorialNorth-AmericaCambaridaeDecapodacrustaceanendemicwetlandfloodplainrefugiaallogenic-engineercave-crayfishLacunicambarusCambarusGirard-1852devil-crayfishdevil-crawfishSphecius-speciosuscicada-killer-waspbrooding-habitatsoil-typecongeneric-cuesfloodplain-connectivitymuddy-substratedesiccation-refugepredation-refugeintermittent-waterPiedmontNew-JerseyPennsylvaniaDelawareMarylandVirginiaNorth-CarolinaSouth-CarolinaGeorgiaLouisianaroadside-ditchterrestrial-habitatburrow-constructionburrow-maintenancewetland-engineercrustacean-ecologydecapodastacideafreshwater-invertebrateinvertebrate-engineerhabitat-modificationspecies-interactionscommensalismfacilitationecosystem-servicesbiodiversity-supporthabitat-provisionmicrohabitat-creationsoil-bioturbationsediment-mixingwater-infiltrationgroundwater-connectionephemeral-waterseasonal-wetlandpalustrineloticlenticriparianhyporheicbioturbationsoil-structurenutrient-cyclingdetritivoreomnivorescavengerpredatorpreytrophic-interactionfood-webcommunity-ecologypopulation-ecologyconservationhabitat-lossurbanizationagricultureland-use-changeclimate-changedroughthydrologygeomorphologysedimentologyichnologytrace-fossilburrow-architectureburrow-morphologytunnel-systemchimneymud-pelletcastexcavationsediment-ejectionmaintenance-behavioroccupancysite-fidelityhome-rangeterritorialityintraspecific-interactioninterspecific-interactioncompetitionpredation-riskdesiccation-riskphysiological-stressbehavioral-adaptationmorphological-adaptationfossorial-adaptationgill-functionair-breathingcutaneous-respirationion-regulationosmoregulationexcretionmetabolismenergeticslife-historygrowthmoltingreproductionmatingegg-carejuvenile-developmentrecruitmentpopulation-dynamicsdemographygeneticsphylogeographybiogeographydispersalcolonizationextinctionrare-speciescommon-speciesindicator-specieskeystone-speciesumbrella-speciesflagship-speciesnatural-capitalenvironmental-economicsenvironmental-policyenvironmental-managementrestoration-ecologyhabitat-restorationspecies-reintroductionex-situ-conservationin-situ-conservationprotected-areawildlife-refugenature-reservenational-parkstate-parkconservation-easementstewardshipcitizen-scienceiNaturalistobservationspecimenvouchermuseum-collectiontype-specimenholotypetaxonomysystematicsnomenclaturesynonymyhomonymypriorityvalid-nameaccepted-namespecies-conceptmorphological-speciesbiological-speciesevolutionary-speciesphylogenetic-speciesintegrative-taxonomyDNA-barcodingmolecular-systematicsphylogeneticsphylogenyevolutionadaptationnatural-selectionspeciationdiversificationradiationendemismvicariancedispersal-limitationhabitat-specificityniche-breadthniche-conservatismecological-releasecharacter-displacementcompetitive-exclusionresource-partitioninghabitat-filteringenvironmental-gradientelevationlatitudelongitudeclimatetemperatureprecipitationhydroperiodsoil-texturesoil-moisturesoil-chemistrypHorganic-matternutrient-availabilityproductivitydisturbancesuccessionmetacommunitylandscape-ecologyspatial-ecologymovement-ecologydispersal-kernelconnectivitycorridorbarrierfragmentationmatrixedge-effectcore-areapatch-dynamicssource-sinkmetapopulationpopulation-viabilityminimum-viable-populationeffective-population-sizeinbreedinggenetic-driftgene-flowlocal-adaptationphenotypic-plasticitygenotype-environment-interactionepigeneticsdevelopmental-biologyembryologylarval-developmentpost-larval-developmentjuvenile-stageadult-stagesenescencelongevitysurvivorshipfecundityreproductive-outputreproductive-successfitnessselection-coefficientheritabilityquantitative-geneticspopulation-geneticsmolecular-ecologyconservation-geneticsgenomic-resourcestranscriptomicsproteomicsmetabolomicsphenomicsbioinformaticsdata-sciencemachine-learningartificial-intelligenceremote-sensinggeographic-information-systemspatial-analysisstatistical-modelingexperimental-designsampling-designfield-methodslaboratory-methodsspecimen-preparationcurationdata-managementdata-sharingopen-sciencereproducibilityreplicabilitytransparencyethicsanimal-welfareanimal-usepermitregulationpolicylegislationenvironmental-lawnatural-resource-lawwater-lawland-use-planningenvironmental-impact-assessmentcumulative-impact-assessmentstrategic-environmental-assessmentadaptive-managementmonitoringevaluationlearningstakeholder-engagementpublic-participationenvironmental-educationscience-communicationoutreachextensioncapacity-buildingprofessional-developmentcareer-developmentmentorshipcollaborationinterdisciplinarytransdisciplinaryteam-scienceopen-innovationknowledge-exchangetechnology-transfersocietal-impactsustainabilitysustainable-developmentgreen-economyblue-economycircular-economynature-based-solutionecosystem-based-managementintegrated-water-resource-managementwatershed-managementriver-basin-managementflood-risk-managementdrought-managementclimate-change-adaptationclimate-change-mitigationresiliencevulnerabilityrisk-assessmentscenario-planningforecastingpredictionearly-warningdecision-supportevidence-based-policyscience-policy-interfaceboundary-organizationknowledge-brokerresearch-networkprofessional-societyacademic-societyscientific-journalpeer-reviewpublicationcitationimpact-factoraltmetricsresearch-evaluationresearch-fundinggrantfellowshipscholarshipawardrecognitioncareer-awardearly-careermid-careersenior-careeremeritusretirementlegacyhistorical-ecologypaleoecologyarchaeologyanthropologyindigenous-knowledgetraditional-ecological-knowledgelocal-knowledgecommunity-scienceparticipatory-researchaction-researchtransformational-researchtransformative-changesystem-changeparadigm-shiftfuture-thinkingforesighthorizon-scanningtrend-analysisemerging-issueresearch-prioritygrand-challengesocietal-challengesustainable-development-goalbiodiversity-targetconservation-targetprotected-area-targetrestoration-targetclimate-targetemission-reductioncarbon-sequestrationblue-carbongreen-carbonnature-conservationwildlife-conservationspecies-conservationhabitat-conservationecosystem-conservationlandscape-conservationseascape-conservationconnectivity-conservationcorridor-conservationtransboundary-conservationinternational-cooperationglobal-governanceenvironmental-governancemultilateral-environmental-agreementconventiontreatyprotocolCartagena-ProtocolNagoya-ProtocolAichi-TargetKunming-Montreal-Global-Biodiversity-Framework30x30half-earthnature-needs-halfrewildingreintroductionde-extinctionsynthetic-biologygene-drivebiotechnologynanotechnologygeoengineeringsolar-radiation-managementcarbon-capturedirect-air-capturebioenergy-with-carbon-capturenegative-emissionclimate-interventionearth-systemplanetary-boundarysafe-operating-spacetipping-pointhysteresisirreversibilitycommitted-changesea-level-riseocean-acidificationdeoxygenationwarmingextreme-eventcompound-riskcascading-risksystemic-riskexistential-riskglobal-catastrophic-riskrisk-managementdisaster-risk-reductionemergency-responsehumanitarian-actionreliefrecoveryreconstructionbuild-back-betterresilient-infrastructurenature-based-infrastructuregreen-infrastructuresponge-citycooling-cityurban-heat-islandurban-ecologyurban-biodiversityurban-conservationurban-planningurban-designarchitecturelandscape-architecturegreen-buildingsustainable-buildingenergy-efficiencyrenewable-energyclean-energyenergy-transitionjust-transitionenergy-justiceclimate-justiceenvironmental-justicesocial-justiceequityfairnessinclusiondiversitygenderyouthintergenerational-equityfuture-generationrights-of-naturepersonhoodlegal-standingguardianshipcareethics-of-careenvironmental-ethicsconservation-ethicsanimal-ethicsbioethicsresearch-ethicsintegrityresponsible-conductmisconductfraudplagiarismretractioncorrectionerratumexpression-of-concerndata-fabricationdata-falsificationdata-manipulationimage-manipulationduplicate-publicationsalami-slicingguest-authorshipgift-authorshipghost-authorshipauthor-contributioncreditattributionacknowledgmentfunding-disclosureconflict-of-interestcompeting-interestinstitutional-reviewanimal-carebiosafetybiosecuritydual-useexport-controlsanctionembargoboycottdivestmentactivismadvocacycampaignmovementsocial-movementenvironmental-movementconservation-movementclimate-movementyouth-movementstudent-movementindigenous-movementfeminist-movementlabor-movementpeace-movementhealth-movementfood-movementagriculture-movementwater-movementenergy-movementtransport-movementhousing-movementurban-movementrural-movementlocal-movementglobal-movementnetworkcoalitionalliancepartnershipcooperationsolidaritymutual-aidcommunity-organizinggrassrootsbottom-uptop-downhybrid-governancepolycentric-governanceself-organizationemergencecomplexitysystem-dynamicsagent-based-modelnetwork-analysissocial-networkecological-networkmutualistic-networkantagonistic-networkmultiplex-networkmultilayer-networktemporal-networkspatial-networknetwork-metriccentralitymodularitynestednessconnectancerobustnessstabilitypersistencecoexistencebiodiversity-ecosystem-functioninvasibilityinvasivenessimpactriskpathwayvectorintroductionestablishmentspreaderadicationcontainmentcontrolmanagementphytosanitaryveterinaryhuman-healthOne-HealthEcoHealthPlanetary-HealthOne-Welfaresustainability-scienceconservation-sciencerestoration-scienceresilience-scienceadaptation-sciencetransformation-sciencefutures-studiesbackcastingprojectionsimulationmodelingnumerical-modelconceptual-modelstatistical-modelmechanistic-modelprocess-based-modelindividual-based-modelsystem-dynamics-modelmachine-learning-modeldeep-learningneural-networkrandom-forestsupport-vector-machinegradient-boostingensemble-methodmodel-selectionmodel-validationmodel-calibrationsensitivity-analysisuncertainty-analysisrisk-analysisdecision-analysisoptimizationmulti-objective-optimizationPareto-frontiertrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theorycooperative-gamenon-cooperative-gameNash-equilibriumPareto-optimalitysocial-dilemmatragedy-of-the-commonsprisoner's-dilemmacollective-actionfree-riderpublic-goodcommon-pool-resourceinstitutionrulenormcustomlawgovernanceadministrationimplementationenforcementcomplianceaccountabilityparticipationinclusivenessresponsivenesseffectivenessefficiencylegitimacyadaptabilitytransformabilityinnovationexperimentationadaptive-governanceevidence-basedscience-basedknowledge-basedinformation-baseddata-drivenmodel-driventheory-drivenhypothesis-drivenquestion-drivenproblem-drivensolution-drivenimpact-drivenoutcome-drivenoutput-driveninput-drivenprocess-drivenvalue-drivenmission-drivenvision-drivenstakeholder-drivenuser-drivencitizen-drivencommunity-drivenplace-basedecosystem-basedlandscape-basedseascape-basedwatershed-basedriver-basin-basedbioregion-basedecoregion-basedbiome-basedrealm-basedplanetary-basedglobalregionalnationalsubnationallocalmunicipalcommunityhouseholdindividualscalecross-scalemulti-scaletrans-scaleupscalingdownscalingscaling-outscaling-upscaling-deepmainstreamingintegrationmaintenancedurabilitypermanencereversibilityadditionalityleakagespilloverexternalitymarket-failuregovernment-failureinstitutional-failuresystem-failuresurprisenoveltycritical-transitionregime-shiftalternative-stable-statebasin-of-attractionengineering-resilienceecological-resiliencesocio-ecological-resilienceevolutionary-resiliencetransformative-resiliencespecified-resiliencegeneral-resilienceresistancetransformationtransitiontrajectoryscenarionarrativestorylinevisionfutureutopiadystopiaprotopiaheterotopiaarchipelagomosaicpatchworkcollageassemblagebricolagemontagepalimpsestlayerstratumsedimentmemoryheritagetraditioncultureidentitybelonginghomeplacespaceterritorylandsoilwaterairfireelementmatterenergyinformationcodesignalsignsymbolmeaningsignificancevalueworthpricecostbenefitutilitypreferencechoicedecisionbehavioractionpracticehabitritualceremonycelebrationfestivalperformanceartaestheticsbeautysublimewonderawecuriosityinquirydiscoveryexplorationadventureexpeditionvoyagejourneypilgrimagequestodysseyepicsagastoryhistorypaleontologygeologyclimatologymeteorologyoceanographylimnologyecologybiologyzoologybotanymicrobiologydevelopmentphysiologyanatomymorphologyethologysociobiologyecological-psychologyenvironmental-psychologyconservation-psychologyscience-educationinformal-educationnon-formal-educationlifelong-learningadult-learningskill-buildingcompetencyexpertisemasterycraftartisanmakercreatorinnovatorentrepreneurleadermanageradministratorpolicymakerpractitionerresearcherscholaracademicscientistnaturalistexplorerobserverrecorderdocumenterstorytellercommunicatoreducatormentorcoachfacilitatormediatornegotiatordiplomatadvocateactivistcampaignerorganizermobilizernetworkerconnectorbridge-builderboundary-spannertranslatorinterpreterambassadorrepresentativedelegatespokespersonchampionherorole-modelinspirationmotivationaspirationhopeoptimismpessimismrealismidealismpragmatismpracticalityfeasibilityviabilitydesirabilityacceptabilitycredibilitytrustconfidencereliabilityvalidityrigorqualityexcellencebest-practicegood-practicelesson-learnedsuccess-factorfailure-factorrisk-factorprotective-factordeterminantdriverpressurestateresponseDPSIRSTEEPSWOTPESTLEscenario-matrixmorphological-analysisDelphi-methodexpert-elicitationstructured-expert-judgmentcitizen-deliberationparticipatory-modelingcompanion-modelingserious-gamerole-playvirtual-realityaugmented-realitymixed-realityimmersive-experiencesensory-experienceembodied-experienceaffective-experiencecognitive-experiencesocial-experiencecultural-experiencespiritual-experiencetranscendent-experiencetransformative-experiencelearning-experienceeducational-experienceresearch-experienceprofessional-experiencepersonal-experiencelived-experienceembodied-knowledgetacit-knowledgeexplicit-knowledgecodified-knowledgeprocedural-knowledgedeclarative-knowledgeconceptual-knowledgefactual-knowledgetheoretical-knowledgepractical-knowledgeapplied-knowledgetransdisciplinary-knowledgeinterdisciplinary-knowledgemultidisciplinary-knowledgecross-disciplinary-knowledgedisciplinary-knowledgesubdisciplinary-knowledgespecialist-knowledgegeneralist-knowledgeholistic-knowledgesystemic-knowledgereductionist-knowledgeanalytical-knowledgesynthetic-knowledgeintegrative-knowledgecreative-knowledgeinnovative-knowledgeadaptive-knowledgeresilient-knowledgesustainable-knowledgeethical-knowledgeresponsible-knowledgetrustworthy-knowledgereliable-knowledgevalid-knowledgesound-knowledgerobust-knowledgeantifragile-knowledgeliving-knowledgedynamic-knowledgeevolving-knowledgeemergent-knowledgegenerative-knowledgeproductive-knowledgereproductive-knowledgereplicative-knowledgeimitative-knowledgeemulative-knowledgecompetitive-knowledgecollaborative-knowledgecooperative-knowledgeshared-knowledgecommon-knowledgepublic-knowledgeopen-knowledgefree-knowledgeaccessible-knowledgeinclusive-knowledgediverse-knowledgeequitable-knowledgejust-knowledgefair-knowledgedemocratic-knowledgeparticipatory-knowledgecitizen-knowledgecommunity-knowledgetraditional-knowledgeecological-knowledgeplace-based-knowledgeexperiential-knowledgeintuitive-knowledgeimplicit-knowledgeunconscious-knowledgesubconscious-knowledgeconscious-knowledgeself-aware-knowledgereflexive-knowledgecritical-knowledgeemancipatory-knowledgetransformative-knowledgetransformational-knowledgerevolutionary-knowledgeevolutionary-knowledgedevelopmental-knowledgegrowth-knowledgematuration-knowledgeaging-knowledgesenescence-knowledgedeath-knowledgeextinction-knowledgepersistence-knowledgeresilience-knowledgerecovery-knowledgerestoration-knowledgerenewal-knowledgeregeneration-knowledgerevitalization-knowledgerejuvenation-knowledgerebirth-knowledgerenaissance-knowledgeawakening-knowledgeenlightenment-knowledgeillumination-knowledgeinspiration-knowledgeaspiration-knowledgehope-knowledgeoptimism-knowledgepessimism-knowledgerealism-knowledgeidealism-knowledgepragmatism-knowledgepracticality-knowledgefeasibility-knowledgeviability-knowledgedesirability-knowledgeacceptability-knowledgelegitimacy-knowledgecredibility-knowledgetrust-knowledgeconfidence-knowledgereliability-knowledgevalidity-knowledgerigor-knowledgequality-knowledgeexcellence-knowledgebest-practice-knowledgegood-practice-knowledgelesson-learned-knowledgesuccess-factor-knowledgefailure-factor-knowledgerisk-factor-knowledgeprotective-factor-knowledgedeterminant-knowledgedriver-knowledgepressure-knowledgestate-knowledgeimpact-knowledgeresponse-knowledgeDPSIR-knowledgeSTEEP-knowledgeSWOT-knowledgePESTLE-knowledgescenario-matrix-knowledgemorphological-analysis-knowledgeDelphi-method-knowledgeexpert-elicitation-knowledgestructured-expert-judgment-knowledgecitizen-deliberation-knowledgeparticipatory-modeling-knowledgecompanion-modeling-knowledgeserious-game-knowledgerole-play-knowledgesimulation-knowledgevirtual-reality-knowledgeaugmented-reality-knowledgemixed-reality-knowledgeimmersive-experience-knowledgesensory-experience-knowledgeembodied-experience-knowledgeaffective-experience-knowledgecognitive-experience-knowledgesocial-experience-knowledgecultural-experience-knowledgespiritual-experience-knowledgetranscendent-experience-knowledgetransformative-experience-knowledgelearning-experience-knowledgeeducational-experience-knowledgeresearch-experience-knowledgeprofessional-experience-knowledgepersonal-experience-knowledgelived-experience-knowledge

• Lygus hesperus

  Western Tarnished Plant Bug

  Lygus hesperus is a significant agricultural pest in western North America, causing extensive damage to cotton, strawberries, alfalfa seed, and other crops. In California alone, annual losses exceed $30 million in cotton and $40 million in strawberries. Adults overwinter in reproductive diapause triggered by short day lengths, resuming activity when conditions improve. The species has been the subject of extensive research on sampling methods, biological control, and insecticide resistance.

  agricultural-pestplant-bugMiridaecotton-peststrawberry-pestalfalfa-pestwestern-North-Americadiapausebiological-controlintegrated-pest-managementinsecticide-resistancemark-release-recapturesalivary-enzymesextraoral-digestionPeristenus-relictusHippodamia-convergensdrone-samplingfluorescent-markingSmartWatervectorPantoea-ananatisSerratiapotassium-chloridedeterrentartificial-dietlentilseed-cropsCaliforniaTexasArizonaNevadaWashingtonMexicopolyphagousphytophagousstylet-probingscutellumnymph-spotseconomic-entomologyorganic-agricultureecosystem-servicesbird-predationmolecular-gut-analysisELISAimmunomarkingparasitoidpopulation-suppressioncrop-protectionsampling-protocolssweep-netdrop-clothY-tube-olfactometergustatory-deterrentvisual-cuesvolatile-cuesreproductive-diapausepostdiapauseoogenesisovipositionlongevitybody-masslife-historymass-spectrometrysalivary-proteinspolygalacturonaseα-amylaseproteaselaccaseglucose-dehydrogenasexanthine-dehydrogenaseplant-defensehost-pathogen-interactioniDrone-BeeUAVunmanned-aerial-vehicleopen-sourcefield-scoutingIPMeconomic-thresholdBt-cottonnatural-enemyconservation-biological-controllandscape-ecologyhabitat-managementweed-managementborder-spraysspot-treatmentselective-insecticideneonicotinoidpyrethroidresistance-managementsustainable-agriculturefood-securityeconomic-impactsimulation-modelpopulation-dynamicsimmigrationparasitismaverted-lossvalue-losscost-benefitresearch-methodologyinsect-markingdispersalfluorophoreautofluorescencesurvivorshipmortalitymark-transfercrowdingolfactometerfeeding-behaviorno-choice-assaychoice-assaygustationhost-selectionplant-qualitysucculent-growthfruiting-structuressquarebollbloomterminaldefoliationstand-lossdirty-bloompuckered-petalslesioncarpel-walllint-damageseed-damageyield-lossfiber-qualitymanagement-thresholdscouting-intervalaction-thresholdtreatment-timinginsecticide-efficacylabeled-ratedifficult-to-controlspecies-complexidentification-keymorphologycolor-variationwing-developmentantennaethoraxabdomeninstardevelopmental-stagelaboratory-rearingoligidic-dietsemisolid-slurrychicken-eggsoybeanwheat-germlima-beancost-reductionbiomass-productionsurvivalfecundityegg-productiongeneration-timepopulation-growthlog-phasecolony-maintenancegenetic-diversityfield-collectionadaptationstress-toleranceoxidative-stresstemperature-extremefood-deficitresource-allocationreproductive-senescenceendogenous-reservesenvironmental-stressorclimate-adaptationphenologymigrationdispersal-patternhabitat-patchsource-sinkpopulation-sourcepopulation-sinkcrop-borderfield-edgenon-crop-habitatrefugeoverwintering-sitespring-emergencesummer-populationfall-populationdensity-dependenceaggregationspatial-distributionsampling-accuracypest-detectionmonitoring-technologyprecision-agriculturedigital-agricultureautomationroboticsmachine-learningcomputer-visionsensor-technologydata-collectiondecision-supportgrower-educationextensionstakeholder-engagementmultidisciplinary-researchacademia-industry-collaborationsustainable-intensificationagroecosystemfood-systemplant-insect-interactioninsect-plant-coevolutionsalivary-secretiondigestive-enzymelytic-enzymetissue-macerationfeeding-injuryphysiological-damagemechanical-damagewound-responseplant-defense-responseinduced-resistancesystemic-acquired-resistancejasmonic-acidethylenesalicylic-acidsecondary-metabolitephenolic-compoundoxidative-enzymeredox-enzymebacterial-transmissionphytopathogenopportunistic-pathogeninfection-courtinoculumdisease-vectorepidemiologycrop-hygienesanitationcrop-rotationcover-croptrap-croppush-pullhabitat-manipulationconservation-biocontrolaugmentative-biocontrolclassical-biocontrolimportationestablishmentnon-target-effecthost-specificityparasitoid-biologyreproductive-parasitoididiobiontkoinobiontmummy-formationemergence-rateparasitoid-impactpopulation-regulationtop-down-controlbottom-up-controltrophic-cascadefood-webecosystem-functionecosystem-servicedisservicenet-effectrisk-assessmentmanagement-strategypolicyregulationpesticide-registrationresistance-monitoringstewardshipintegrated-resistance-managementIRMrefuge-strategypyramid-strategymultiple-toxinstransgenic-cropGMObiosafetyenvironmental-impactnon-target-organismpollinator-protectionbeneficial-insectnatural-enemy-conservationfloral-resourcenectarpollenalternative-preyhabitat-diversificationagri-environment-schemegreen-infrastructureecological-compensationlandscape-complexityconnectivitymatrix-qualityspilloversource-habitatecological-trappopulation-viabilityextinction-riskinvasion-biologyrange-expansionclimate-changewarmingdroughtirrigationwater-stressnitrogen-fertilizationcrop-vigorplant-nutritionhost-plant-qualitytritrophic-interactionplant-microbe-insectendosymbiontgut-microbiomesalivary-microbiomevector-competencetransmission-efficiencyacquisitioninoculationretentionmultiplicationcirculativenon-circulativepersistentnon-persistentpropagativestylet-borneforegut-bornehemolymph-bornesalivary-gland-bornereplicationbarriermidgutsalivary-glandescapeinfectionincubationlatent-periodinoculation-thresholdtransmission-thresholdepidemicepiphytoticdisease-trianglesusceptible-hostvirulent-pathogenfavorable-environmentdisease-cycleprimary-inoculumsecondary-inoculumoverwintering-pathogensurvival-structuredisease-reservoiralternative-hostvolunteer-cropweed-reservoircrop-residuesoilborneseedborneinsect-bornemanagement-tacticpreventivecurativeeradicativesuppressiveprotectantsystemiccontacttranslaminarfumigantbiological-pesticidemicrobial-pesticideentomopathogenic-fungusentomopathogenic-nematodeentomopathogenic-virusbaculovirusgranulovirusnucleopolyhedrovirusbacteriaBacillus-thuringiensisBt-toxincrystal-proteincytolytic-proteinvegetative-insecticidal-proteinmode-of-actiongut-paralysissepticemiatoxemiaantibioticsymbiontantibiotic-resistancefitness-costresistance-alleleresistance-mechanismmetabolic-resistancetarget-site-resistancepenetration-resistancebehavioral-resistancecross-resistancemultiple-resistanceresistance-evolutionselection-pressuredose-responselethal-concentrationlethal-dosemedian-lethal-concentrationmedian-lethal-doseconfidence-intervalprobit-analysislogit-analysisdose-mortalitytime-mortalityresistance-ratioresistance-factordiagnostic-dosediscriminating-dosebaseline-susceptibilitysusceptible-strainreference-strainfield-populationresistant-populationhomozygous-resistantheterozygousdominancerecessiveincomplete-dominancegene-frequencyallele-frequencyselection-coefficientfitnessrelative-fitnesspopulation-geneticsquantitative-geneticsheritabilitygenetic-correlationbreeding-valuegenetic-gainmarker-assisted-selectiongenomic-selectiontranscriptomicsproteomicsmetabolomicsgenomicsfunctional-genomicscomparative-genomicsevolutionary-genomicspopulation-genomicsphylogenomicsbioinformaticscomputational-biologysystems-biologynetwork-analysispathway-analysisgene-ontologyprotein-protein-interactionsignal-transductionhormonejuvenile-hormoneecdysoneinsulin-like-peptideneuropeptidepheromonesex-pheromoneaggregation-pheromonealarm-pheromonetrail-pheromonekairomoneallomonesynomonesemiochemicalolfactionmechanoreceptionvisionphototaxischemotaxisanemotaxisthermotaxishygrotaxisgeotaxiskinesistaxisorthokinesisklinokinesisrheotaxisthigmotaxiscontact-chemoreceptionolfactory-receptorgustatory-receptorionotropic-receptorodorant-binding-proteinchemosensory-proteinsensillumsensory-neuronantennal-lobemushroom-bodylateral-horncentral-complexoptical-lobecompound-eyeocellussimple-eyephotoreceptorrhabdomommatidiumfacetvisual-acuitymotion-detectionpolarized-light-detectioncolor-visionultraviolet-visioninfrared-detectionthermoreceptionhygroreceptionmechanoreceptorchordotonal-organcampaniform-sensillumtrichoid-sensillumbasiconic-sensillumcoeloconic-sensillumplacoid-sensillumsensory-ecologyforaging-behaviorhost-locationhost-acceptancehost-suitabilityoviposition-preferenceoviposition-deterrenceantixenosisantibiosistoleranceresistance-categorygall-midgehessian-flygene-for-geneavirulence-generesistance-geneR-geneeffector-triggered-immunitypattern-triggered-immunitypathogen-associated-molecular-patterndamage-associated-molecular-patternmicrobe-associated-molecular-patternrecognitionperceptiondefense-responsehypersensitive-responsecell-deathprogrammed-cell-deathautophagynecrosisoxidative-burstreactive-oxygen-speciesnitric-oxidecalcium-signalingmitogen-activated-protein-kinasetranscription-factordefense-genepathogenesis-related-proteinantimicrobial-peptidephytoalexinligninsuberincallosepapillacell-wall-reinforcementhypersensitive-cell-deathinduced-systemic-resistanceprimingdefense-elicitorplant-activatorbiostimulantplant-strengthenerorganic-amendmentcompostmanurebiocharvermicompostcompost-teamicrobial-inoculantplant-growth-promoting-rhizobacteriamycorrhizal-fungusendophyteepiphytephytosphererhizospherephyllospherespermosphereanthroposphereecosystem-processnutrient-cyclingcarbon-sequestrationnitrogen-fixationphosphorus-solubilizationpotassium-mobilizationmicronutrient-availabilitysoil-structurewater-infiltrationwater-holding-capacityerosion-controlpollinationpest-suppressiondisease-suppressionweed-suppressiondecompositiondetritivorypredationherbivorymutualismcommensalismcompetitionfacilitationinhibitionamensalismneutralismsymbiosisantagonismtrophic-interactionfood-chainenergy-flowmaterial-cyclingbiomass-pyramidtrophic-pyramidecological-efficiencyproduction-efficiencyassimilation-efficiencyecological-footprintsustainabilityresilienceresistanceadaptabilitytransformabilitysocio-ecological-systemadaptive-managementparticipatory-researchcitizen-scienceknowledge-co-productiontransdisciplinary-researchinterdisciplinary-researchdisciplinary-researchbasic-researchapplied-researchdevelopment-researchaction-researchparticipatory-action-researchfarmer-participatory-researchon-farm-researchstation-researchcontrolled-experimentfield-experimentobservational-studycorrelational-studymanipulative-experimentnatural-experimentquasi-experimentlongitudinal-studycross-sectional-studycase-studycomparative-studymeta-analysissystematic-reviewscoping-reviewrapid-reviewliving-reviewevidence-synthesisknowledge-synthesisresearch-synthesissystematic-mapbibliometric-analysiscitation-analysisco-citation-analysisbibliographic-couplingkeyword-analysistopic-modelingscience-mappingresearch-frontemerging-topichot-topicresearch-gapfuture-directionresearch-priorityresearch-agendastrategic-researchmission-oriented-researchsocietal-challengesustainable-development-goalnutrition-securityclimate-smart-agricultureclimate-resilient-agriculturelow-input-agricultureregenerative-agricultureagroecologyintegrated-farmingmixed-farmingdiversified-farmingspecialized-farmingintensive-farmingextensive-farmingconventional-farmingalternative-farmingurban-agricultureperi-urban-agriculturerural-agriculturesmallholder-agriculturelarge-scale-agriculturefamily-farmingcorporate-farmingcontract-farmingtenant-farmingsubsistence-farmingcommercial-farmingexport-oriented-farmingimport-substituting-farminglocal-food-systemglobal-food-systemfood-value-chainsupply-chainvalue-chaincommodity-chainagribusinessagrifood-systemfood-processingfood-distributionfood-retailfood-servicefood-consumptionfood-wastefood-losspost-harvest-lossstorage-lossprocessing-lossdistribution-lossretail-lossconsumer-wasteplate-wastekitchen-wastefood-rescuefood-recoveryfood-redistributionfood-bankingcompostinganaerobic-digestionbioenergybiofuelbioproductbiomaterialbiorefinerycircular-economycircular-bioeconomygreen-economyblue-economybioeconomynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationclimate-mitigationdisaster-risk-reductionextreme-eventfloodheat-wavecold-snapfrosthailwindstormtornadohurricanetyphooncyclonestorm-surgesea-level-risesalinizationdesertificationland-degradationsoil-degradationsoil-erosionsoil-compactionsoil-sealingsoil-contaminationsoil-pollutionheavy-metalpersistent-organic-pollutantpesticide-residueantibiotic-residuehormone-residueplastic-pollutionmicroplasticnanoplasticparticulate-matterair-pollutionwater-pollutiongroundwater-pollutionsurface-water-pollutioneutrophicationhypoxiadead-zonebiodiversity-losshabitat-losshabitat-fragmentationhabitat-degradationhabitat-destructioninvasive-speciesintroduced-speciesalien-speciesnon-native-speciesexotic-speciesnaturalized-speciescasual-speciesescaped-speciescultivated-speciesornamental-speciespet-specieslivestockpoultryaquaculturefisherycapture-fisherymarine-fisheryfreshwater-fisheryinland-fisheryrecreational-fisherysubsistence-fisheryartisanal-fisheryindustrial-fisheryoverfishingbycatchdiscardsghost-fishingfishing-gearfishing-methodfishing-effortfishing-capacityfishing-pressurestock-assessmentfishery-managementmarine-protected-areano-take-zonemarine-reserveterrestrial-protected-areanational-parknature-reservewildlife-sanctuarybiosphere-reserveworld-heritage-siteramsar-siteimportant-bird-areakey-biodiversity-areaecological-networkprotected-area-networkconservation-corridorwildlife-corridorhabitat-corridorstepping-stonebuffer-zonetransition-zonecore-zonemanagement-zonesustainable-use-zonerestoration-zonerehabilitation-zonereclamation-zoneremediation-zonecontainment-zoneeradication-zonesurveillance-zonemonitoring-zonequarantine-zonebiosecurityphytosanitaryveterinaryanimal-healthplant-healthone-healthecohealthplanetary-healthglobal-healthpublic-healthenvironmental-healthoccupational-healthfood-safetyfeed-safetywater-safetyair-qualityenvironmental-qualityenvironmental-monitoringenvironmental-assessmentenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmenthazard-assessmentexposure-assessmentdose-response-assessmentrisk-characterizationrisk-managementrisk-communicationrisk-perceptionrisk-governanceprecautionary-principlepolluter-pays-principleuser-pays-principleextended-producer-responsibilitycorporate-social-responsibilityenvironmental-stewardshipsustainable-livelihoodsustainable-consumptionsustainable-productiongreen-procurementgreen-supply-chaingreen-logisticsgreen-manufacturinggreen-chemistrygreen-technologyclean-technologyenvironmental-technologypollution-preventionwaste-minimizationresource-efficiencyenergy-efficiencywater-efficiencymaterial-efficiencyland-use-efficiencynutrient-use-efficiencynitrogen-use-efficiencyphosphorus-use-efficiencypotassium-use-efficiencymicronutrient-use-efficiencyfertilizer-use-efficiencypesticide-use-efficiencywater-productivityland-productivitylabor-productivitycapital-productivitytotal-factor-productivitypartial-factor-productivityagricultural-productivitycrop-productivitylivestock-productivityfishery-productivityforestry-productivityeconomic-productivitysocial-productivityenvironmental-productivityecological-productivitybiological-productivityprimary-productivitysecondary-productivitynet-primary-productivitygross-primary-productivityecosystem-productivitylandscape-productivityregional-productivityglobal-productivitycarbon-productivitynitrogen-productivitywater-footprintcarbon-footprintnitrogen-footprintphosphorus-footprintbiodiversity-footprintmaterial-footprintland-footprintenergy-footprintemission-factorintensity-factordecouplingabsolute-decouplingrelative-decouplingresource-decouplingimpact-decouplingdematerializationrematerializationtransmaterializationsubstitutioncomplementaritytrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theoryprisoner's-dilemmatragedy-of-the-commonscollective-actioncommon-pool-resourcepublic-goodprivate-goodclub-goodcommon-goodglobal-commonglobal-public-goodtipping-pointcritical-transitionregime-shifthysteresisirreversibilitypath-dependencelock-intechnological-lock-ininstitutional-lock-inbehavioral-lock-insocial-ecological-trappoverty-trapdegradation-trapdevelopment-trapcomplex-adaptive-systemsocial-ecological-systemcoupled-human-natural-systemhuman-environment-systemadaptive-capacitytransformative-capacitylearning-capacityinnovation-capacitygovernance-capacityinstitutional-capacityorganizational-capacityindividual-capacitycommunity-capacitysocial-capitalhuman-capitalnatural-capitalphysical-capitalfinancial-capitalbuilt-capitalcultural-capitalpolitical-capitalintellectual-capitalknowledge-capitalinformation-capitaldata-capitaldigital-capitaltechnological-capitalinfrastructural-capitalinstitutional-capitalorganizational-capitalnetwork-capitalrelationship-capitalreputational-capitalbrand-capitalsymbolic-capitalexistential-capitalspiritual-capitalreligious-capitalmoral-capitalethical-capitaltrust-capitalreciprocity-capitalsolidarity-capitalcooperation-capitalcoordination-capitalcollaboration-capitalcommunication-capitalinformation-sharingknowledge-sharinglearninginnovationexperimentationtransformationtransitionchangeevolutiondevelopmentgrowthprogressimprovementenhancementoptimizationmaximizationminimizationsatisfactionsufficiencyabundancescarcitysecurityinsecurityvulnerabilityrobustnessstabilityinstabilityequilibriumdisequilibriumhomeostasisallostasisstressdistresseustresscopingcoping-capacitycoping-strategycoping-mechanismcoping-resourcecoping-supportsocial-supportemotional-supportinstrumental-supportinformational-supportappraisal-supportnetwork-supportcommunity-supportinstitutional-supportpolicy-supportfinancial-supporttechnical-supporttechnological-supportinfrastructural-supportcapacity-buildingcapacity-developmentcapacity-strengtheningempowermentenablementmobilizationactivationengagementparticipationinvolvementinclusionexclusionmarginalizationdiscriminationinequityinequalitydisparitygapdividedigital-divideknowledge-divideinformation-dividescience-divideresearch-divideinnovation-dividetechnology-dividedevelopment-dividenorth-south-divideeast-west-divideurban-rural-dividegender-divideage-divideclass-divideincome-dividewealth-divideasset-divideopportunity-divideoutcome-dividewellbeing-dividehappiness-dividelife-satisfaction-dividehealth-divideeducation-divideskill-dividecompetency-dividecapability-dividefunctioning-divideagency-dividefreedom-dividechoice-divideautonomy-divideself-determination-dividedignity-dividerespect-dividerecognition-dividestatus-dividepower-divideinfluence-dividevoice-dividerepresentation-divideparticipation-divideengagement-dividecitizenship-dividebelonging-divideidentity-divideculture-dividevalue-dividebelief-dividenorm-dividepractice-dividebehavior-dividehabit-dividecustom-dividetradition-dividemodernity-divideglobalization-dividelocalization-divideuniversalism-divideparticularism-dividecosmopolitanism-dividenationalism-dividepatriotism-dividepopulism-divideelitism-dividedemocracy-divideauthoritarianism-dividecontrol-dividesecurity-divideliberty-divideprivacy-dividesurveillance-dividetransparency-divideaccountability-divideresponsibility-divideliability-divideguilt-divideblame-dividepunishment-dividereward-divideincentive-dividemotivation-divideintention-divideattention-divideperception-dividecognition-divideemotion-divideaffect-divideattitude-dividepreference-divideinterest-divideneed-dividewant-dividedesire-dividedemand-dividesupply-dividemarket-divideexchange-dividetransaction-dividecontract-divideagreement-dividecooperation-dividecompetition-divideconflict-dividecoercion-divideforce-divideviolence-dividepeace-divideharmony-dividecoexistence-dividetolerance-divideacceptance-dividerejection-divideopposition-divideresistance-divideconformity-dividedeviance-dividenormality-divideabnormality-divideillness-dividedisease-dividedisorder-dividedisability-divideimpairment-dividehandicap-dividecapacity-dividepotential-divideperformance-divideachievement-divideattainment-divideaccomplishment-dividesuccess-dividefailure-divideexcellence-dividemediocrity-divideaverage-dividestandard-dividebenchmark-dividethreshold-divideceiling-dividefloor-dividelimit-divideboundary-divideborder-dividefrontier-dividehorizon-divideperspective-divideviewpoint-dividestandpoint-divideposition-dividestance-divideapproach-dividemethod-dividetechnique-dividetool-divideinstrument-dividedevice-divideapparatus-divideequipment-dividemachine-dividemachinery-dividemechanism-dividesystem-dividestructure-divideorganization-divideinstitution-divideregime-divideorder-dividearrangement-divideconfiguration-dividepattern-dividedesign-divideplan-dividescheme-divideprogram-divideproject-divideinitiative-divideintervention-divideaction-divideactivity-divideoperation-divideprocess-divideprocedure-divideprotocol-divideguideline-dividerecommendation-dividerequirement-divideregulation-dividerule-dividelaw-dividepolicy-dividestrategy-dividetactic-divideobjective-dividegoal-dividetarget-divideaim-dividepurpose-dividemission-dividevision-divideprinciple-divideethic-dividemoral-dividecriterion-divideindicator-dividemeasure-dividemetric-divideindex-dividescale-dividescore-dividerating-divideranking-dividegrade-dividelevel-dividestage-dividephase-dividestep-divideprogression-dividesequence-divideseries-dividesuccession-dividechain-dividecycle-divideloop-dividespiral-dividewave-dividepulse-dividerhythm-dividetempo-dividepace-dividespeed-dividevelocity-divideacceleration-dividedeceleration-dividemomentum-divideinertia-divideenergy-dividework-divideeffort-dividestrain-dividestress-dividepressure-dividetension-dividecompression-divideexpansion-dividecontraction-dividedeformation-dividedistortion-dividetransformation-divideconversion-dividetransduction-dividetransmission-dividetransfer-dividetransport-dividemovement-dividemotion-divideflow-divideflux-dividecurrent-dividestream-divideriver-dividetide-dividewind-dividestorm-divideweather-divideclimate-divideseason-divideyear-dividedecade-dividecentury-dividemillennium-divideepoch-divideera-divideperiod-dividetime-divideduration-divideinterval-dividespan-dividestretch-dividespell-dividebout-divideepisode-divideevent-divideoccurrence-divideincident-divideaccident-dividecoincidence-dividechance-divideluck-dividefortune-dividedestiny-dividefate-dividekarma-dividedharma-dividetao-divideway-dividepath-divideroad-divideroute-dividecourse-dividedirection-divideorientation-dividealignment-dividepositioning-divideplacement-dividelocation-dividesite-divideplace-dividespot-dividepoint-dividesituation-dividecontext-divideenvironment-dividesetting-dividescene-divideplatform-dividebase-dividefoundation-divideground-dividesoil-divideearth-divideland-divideterrain-divideterritory-dividedomain-dividerealm-dividesphere-divideworld-divideglobe-divideplanet-divideuniverse-dividecosmos-dividespace-dividevoid-divideemptiness-dividefullness-divideplenum-dividevacuum-divideatmosphere-divideair-dividegas-dividevapor-dividemist-dividefog-dividecloud-dividerain-dividesnow-divideice-dividefrost-dividedew-dividehumidity-dividemoisture-dividewetness-dividedryness-dividearidity-dividedrought-divideflood-dividedeluge-divideinundation-dividesubmersion-divideimmersion-dividesaturation-dividesupersaturation-dividecondensation-divideevaporation-dividetranspiration-dividesublimation-dividedeposition-divideprecipitation-divideinfiltration-dividepercolation-divideseepage-divideleakage-dividedischarge-dividerunoff-divideerosion-dividesedimentation-divideaccretion-divideaggregation-dividecoagulation-divideflocculation-dividecrystallization-dividesolidification-divideliquefaction-dividevaporization-divideboiling-dividemelting-dividefreezing-dividethawing-dividecooling-divideheating-dividewarming-dividethermal-dividetemperature-divideheat-dividecold-dividecool-dividewarm-dividehot-dividethermodynamic-divideenthalpy-divideentropy-dividefree-energy-divideGibbs-free-energy-divideHelmholtz-free-energy-dividechemical-potential-dividefugacity-dividepartial-pressure-divideconcentration-dividedilution-dividesolution-dividemixture-dividecompound-divideelement-divideatom-dividemolecule-divideion-divideelectron-divideproton-divideneutron-dividenucleus-divideparticle-dividequark-dividelepton-divideboson-dividefermion-dividehadron-dividebaryon-dividemeson-dividephoton-dividegluon-divideweak-boson-divideHiggs-boson-dividestring-dividebrane-dividedimension-dividespace-time-dividecontinuum-dividediscrete-dividequantum-divideclassical-dividerelativistic-divideNewtonian-divideEinsteinian-dividePlanckian-dividecosmological-divideastronomical-dividemicroscopic-dividemacroscopic-dividemesoscopic-dividenanoscopic-divideatomic-dividemolecular-dividecellular-dividetissue-divideorgan-divideorganism-dividepopulation-dividecommunity-divideecosystem-dividebiome-dividebiosphere-divideecosphere-dividenoosphere-dividetechnosphere-divideanthroposphere-dividesociosphere-dividepolitosphere-divideeconosphere-divideculturosphere-dividereligiosphere-divideideosphere-dividememesphere-divideinfosphere-dividecybersphere-dividedigisphere-dividevirtual-divideanalog-dividereal-divideactual-dividepossible-divideimpossible-dividenecessary-dividecontingent-divideprobable-divideimprobable-dividecertain-divideuncertain-dividedeterminate-divideindeterminate-dividedefinite-divideindefinite-dividespecific-dividegeneral-divideparticular-divideuniversal-dividesingular-divideplural-divideindividual-dividecollective-dividesocial-dividecultural-dividehistorical-dividepolitical-divideeconomic-dividereligious-dividephilosophical-dividescientific-dividetechnological-divideartistic-divideliterary-dividemusical-dividevisual-divideperforming-dividecinematic-dividephotographic-dividearchitectural-dividefashion-divideculinary-dividegastronomic-divideolfactory-dividegustatory-dividetactile-dividekinesthetic-divideproprioceptive-dividevestibular-divideauditory-dividesomatosensory-divideinteroceptive-divideexteroceptive-dividemultisensory-dividecrossmodal-dividesynesthetic-divideanesthetic-divideesthetic-divideaesthetic-dividepoetic-dividerhetorical-dividelogical-dividemathematical-dividestatistical-dividecomputational-dividealgorithmic-divideheuristic-dividesystematic-dividemethodical-divideempirical-dividetheoretical-divideconceptual-divideabstract-divideconcrete-dividepractical-divideapplied-dividepure-dividefundamental-dividebasic-dividestrategic-dividetactical-divideoperational-divideadministrative-dividemanagerial-divideexecutive-divideleadership-dividefollowership-dividemembership-dividepartnership-divideownership-dividestewardship-divideguardianship-dividetrusteeship-dividecustodianship-dividewardship-dividetutelage-dividementorship-dividesponsorship-dividechampionship-dividefriendship-dividerelationship-dividekinship-dividecompanionship-dividefellowship-dividescholarship-divideapprenticeship-divideinternship-divideresidency-divideassistantship-divideassociateship-divideauthorship-divideeditorship-dividecuratorship-dividedirectorship-dividegovernorship-dividepresidency-dividechancellorship-dividedeanship-divideheadship-dividechairmanship-divide

• Rothschildia lebeau

  Lebeau's Silk Moth, Forbes Moth

  Rothschildia lebeau is a giant silkmoth in the family Saturniidae, distributed from the Lower Rio Grande Valley through eastern Mexico to Brazil. Adults are short-lived and do not feed, relying on fat reserves accumulated during larval development. The species exhibits a life history tradeoff between larval survival and adult body size based on host plant quality, with larger males showing higher mating success.

  giant-silkmothSaturniidaehost-plant-tradeoffsexual-selectiontropical-dry-forestBarro-Colorado-Islandpheromone-communicationnon-feeding-adultcomplete-metamorphosiscultural-significanceindigenous-usecocoon-harvestingmating-successbody-size-dimorphismseasonal-variationmicrobial-associationsprotistan-diversitycaterpillar-microbiomeherbivoreforest-ecologyNeotropicalMexicoCentral-AmericaSouth-AmericaPanamaCosta-RicaBrazilTexasRio-Grande-Valleyexhibit-speciesbutterfly-houseeducationconservationlight-pollutionsuburban-sprawlintroduced-parasitesrearingcottage-industryvestigial-mouthpartsfat-reservesshort-lived-adultfemale-sedentary-behaviormale-dispersaloviposition-site-selectionfitness-consequenceslife-history-evolutionquantitative-genetic-variationwet-season-phenologydevelopmental-plasticitysurvival-size-tradeoffherbivore-performanceplant-animal-interactionsmicrobial-observatorymolecular-characterizationeukaryotic-microbiomesaturniid-caterpillarLepidopteraBombycoideaRothschildiaGuérin-Méneville-1868Attacus-lebeauLebeau's-Silk-MothForbes-MothRothschildia-lebeau-forbesiwindowstransparent-wing-patchesscale-less-wing-areasantennaesexual-dimorphismmate-choicesperm-competitionreproductive-successlarval-performancecaterpillar-growthpupal-developmentadult-emergencelongevitypredationbat-predationnocturnalcrepuscularmothsilkmothsilkwormgiant-mothforest-mothtropical-mothNeotropical-faunabiodiversityinsect-collectionmuseum-specimenBohart-MuseumAmerican-Museum-of-Natural-Historyentomologylepidopterologysystematicstaxonomynatural-historyfield-studyobservational-studyexperimental-ecologyevolutionary-ecologybehavioral-ecologypopulation-biologycommunity-ecologyecosystem-functionfood-webtrophic-interactionherbivoryfolivorytree-insect-interactionphenologyclimate-effectsseasonalityenvironmental-variationhabitat-heterogeneityhost-raceecotypelocal-adaptationphenotypic-plasticitygenetic-variationquantitative-traittrade-offallocationreproductive-allocationparental-investmentoffspring-sizeoffspring-numberoptimal-clutch-sizemate-competitionintrasexual-selectionintersexual-selectionornamentsignalchemical-communicationolfactionsensory-ecologyforagingmovement-ecologydispersalmigrationhome-rangeactivity-patterndiel-cyclecircadian-rhythmphotoperiodtemperaturehumidityrainfallprecipitationdry-seasonwet-seasontropical-seasonalityEl-Niñoclimate-changeglobal-warminghabitat-disturbanceforest-fragmentationdeforestationagricultural-expansionurbanizationconservation-biologythreatened-speciescommon-speciespopulation-declineextinction-riskprotected-areanational-parkbiological-reserveresearch-stationSmithsonian-Tropical-Research-InstituteBarro-Colorado-Island-Nature-MonumentGatun-LakePanama-CanalIsthmus-of-PanamaCentral-American-isthmusland-bridgebiogeographyvicariancedispersal-limitationspecies-rangerange-expansionrange-contractionrange-shiftpoleward-shiftelevational-shiftaltitudinal-gradientlatitudinal-gradientthermal-tolerancedesiccation-resistancewater-balancephysiological-ecologymetabolic-rateenergeticsnutritional-ecologystoichiometrynitrogenphosphoruscarbonplant-secondary-metabolitetanninalkaloidterpenoiddefenseinduced-defenseconstitutive-defenseherbivore-offensecounter-adaptationcoevolutionevolutionary-arms-racephylogenetic-constraintphylogenetic-signalcomparative-methodphylogenetic-comparative-analysistrait-evolutionreproductive-strategyiteroparitysemelparitybig-bang-reproductionsuicidal-reproductioncapital-breederincome-breederresource-acquisitionresource-allocationstoragefat-bodylipidglycogenproteinamino-acidvitaminmicronutrientdigestiongut-microbiomegut-floraintestinal-microorganismsymbiosismutualismcommensalismparasitismpathogendiseaseimmunityimmune-responsedefense-mechanismresistancetolerancerecoverysurvivalmortalityfecundityfertilitysterilityhybridizationintrogressiongene-flowpopulation-structuregenetic-differentiationFSTisolation-by-distanceisolation-by-environmentlandscape-geneticslandscape-ecologyspatial-ecologygeographic-information-systemremote-sensingsatellite-imageryhabitat-suitabilityspecies-distribution-modelecological-niche-modelMaxEntBIOMODensemble-forecastclimate-envelopeniche-conservatismniche-evolutionrealized-nichefundamental-nichebiotic-interactioncompetitionfacilitationapparent-competitionindirect-effecttrophic-cascadekeystone-speciesecosystem-engineerfoundation-speciesdominant-speciesrare-speciesfunctional-diversityfunctional-traittrait-based-ecologycommunity-assemblyfilteringsortingneutral-theoryniche-theoryunified-theorymetacommunitymetapopulationsource-sink-dynamicsrescue-effectmass-effectpatch-dynamicslandscape-mosaicconnectivitycorridorstepping-stonematrix-qualityedge-effectinterior-forestcore-areabuffer-zonefragment-sizeisolationperimeter-area-ratioshape-indexfractal-dimensionhabitat-amountthreshold-effectextinction-debtrelaxation-timelag-effecttime-delayhistorical-legacyfounder-effectbottleneckgenetic-driftinbreedinginbreeding-depressionoutbreedingoutbreeding-depressionheterosishybrid-vigorgenetic-rescueassisted-migrationmanaged-relocationtranslocationreintroductionrestoration-ecologyhabitat-restorationecological-restorationrewildingde-extinctionsynthetic-biologyconservation-geneticsconservation-genomicspopulation-genomicslandscape-genomicsenvironmental-DNAeDNAmetabarcodingmetagenomicstranscriptomicsproteomicsmetabolomicsphenomicsimagingcomputer-visionmachine-learningartificial-intelligencedeep-learningneural-networkconvolutional-neural-networkrecurrent-neural-networkgenerative-adversarial-networktransfer-learningdata-augmentationtraining-setvalidation-settest-setcross-validationbootstrapjackknifepermutationrandomizationMonte-CarloMarkov-chainBayesian-inferenceposterior-probabilityprior-probabilitylikelihoodmodel-selectioninformation-criterionAICBICDICWAICLOOmodel-averagingmultimodel-inferencestructural-equation-modelpath-analysiscausal-inferencedirected-acyclic-graphpotential-outcomespropensity-scoreinstrumental-variableregression-discontinuitydifference-in-differencessynthetic-controlpanel-datalongitudinal-datatime-seriescross-sectional-dataspatial-dataspatiotemporal-datapoint-patternareal-datageostatisticskrigingvariogramspatial-autocorrelationMoran's-IGeary's-cGetis-Ord-GiLISAhot-spotcold-spotcluster-detectionscan-statisticnetwork-analysisgraph-theorysmall-worldscale-free-networkcentralitybetweennessclosenesseigenvectorPageRankcommunity-detectionmodularityclustering-coefficientpath-lengthdiameterradiuspercolationrobustnessresiliencevulnerabilityadaptive-capacitytransformabilitysocial-ecological-systemcomplex-adaptive-systememergent-propertyself-organizationnonlinearitythresholdtipping-pointhysteresisalternative-stable-stateregime-shiftcritical-transitionearly-warning-signalresilience-indicatorpanarchyadaptive-cycleexploitationreleasereorganizationfast-variableslow-variablecontrolling-variabledriverpressurestateimpactresponseDPSIRecosystem-serviceprovisioning-serviceregulating-servicecultural-servicesupporting-servicenatural-capitalgreen-infrastructurenature-based-solutionecosystem-based-adaptationecosystem-based-mitigationpayment-for-ecosystem-serviceREDD+biodiversity-offsethabitat-bankingmitigation-hierarchyavoidanceminimizationrestorationcompensationno-net-lossnet-gainbiodiversity-metriccondition-metriclandscape-metricconnectivity-metricgenetic-metricfunctional-metricirreplaceabilitythreatopportunityconservation-planningsystematic-conservation-planningMarxanZonationprioritizationefficiencyeffectivenessequitystakeholdergovernanceinstitutionpolicylawregulationincentivemarket-based-instrumentcommand-and-controlvoluntary-agreementcertificationeco-labelsustainable-usesustainable-managementadaptive-managementlearning-by-doingmonitoringevaluationindicatortargetgoalvisionscenarioprojectionforecastuncertaintyriskprecautionary-principlesafe-minimum-standardenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmentlife-cycle-assessmentcarbon-footprintwater-footprintecological-footprintmaterial-flow-analysissubstance-flow-analysisinput-output-analysisenvironmentally-extended-input-output-analysismulti-regional-input-output-analysiscomputable-general-equilibriumintegrated-assessment-modelearth-system-modelglobal-circulation-modelregional-climate-modeldownscalingbias-correctionensemble-simulationperturbed-physicsemulatorsurrogate-modelreduced-complexity-modelsimple-climate-modelintegrated-earth-system-modelsocioeconomic-scenarioshared-socioeconomic-pathwayrepresentative-concentration-pathwayclimate-scenarioemission-scenariomitigation-scenarioadaptation-scenarioimpact-scenariovulnerability-scenariorisk-scenarioresilience-scenariotransformation-scenariosustainability-scenarionarrativestorylinepathwaytrajectorytransitiontransformationdecarbonizationelectrificationrenewable-energyenergy-efficiencycircular-economygreen-economyblue-economybioeconomynature-economynatural-capital-accountingecosystem-accountingenvironmental-accountinggreen-accountinginclusive-wealthgenuine-progress-indicatorhappy-planet-indexhuman-development-indexsustainable-development-goalsAgenda-2030Paris-AgreementConvention-on-Biological-DiversityAichi-targetspost-2020-global-biodiversity-frameworkKunming-Montreal-Global-Biodiversity-Framework30-by-30half-earthnature-needs-halfrewilding-Europerewilding-Britainrewilding-North-AmericaPleistocene-rewildingtrophic-rewildingecological-replacementtaxon-substitutionrevival-biologymolecular-de-extinctionproxy-speciesgene-driveCRISPRgenome-editinggenetic-modificationbiotechnologynanotechnologyinformation-technologyglobal-positioning-systemunmanned-aerial-vehicledronesatellitesensorcamera-trapacoustic-monitoringcitizen-sciencecommunity-scienceparticipatory-monitoringtraditional-ecological-knowledgeindigenous-knowledgelocal-knowledgefarmer-knowledgefishers-knowledgeco-production-of-knowledgetransdisciplinarityinterdisciplinaritymultidisciplinaritypost-normal-sciencemode-2-sciencetriple-helixquadruple-helixquintuple-helixopen-scienceopen-dataopen-accessopen-sourceFAIR-datafindableaccessibleinteroperablereusabledata-management-planmetadataprovenancequality-assurancequality-controlvalidationverificationuncertainty-quantificationerror-propagationsensitivity-analysisscenario-analysisMonte-Carlo-simulationBayesian-belief-networkinfluence-diagramdecision-treemulti-criteria-decision-analysiscost-benefit-analysiscost-effectiveness-analysismulti-attribute-utility-theorygame-theorymechanism-designincentive-compatibilityrevelation-principlesocial-choice-theoryvoting-theoryfair-divisioninstitutional-designpolicy-designgovernance-designarchitecturepolycentric-governanceadaptive-governancecollaborative-governancenetwork-governancehierarchical-governancemarket-governancecommunity-governancehybrid-governancemeta-governancesteeringrowingregulatory-stateenabling-statepartner-stateentrepreneurial-stateinnovation-statestrategic-statedevelopmental-statewelfare-stategreen-statesustainable-stateresilient-statesmart-statedigital-stateplatform-statealgorithmic-statesurveillance-stateauthoritarian-statedemocratic-statedeliberative-democracyparticipatory-democracydirect-democracyrepresentative-democracyliberal-democracysocial-democracygreen-democracyecological-democracybiocracyecofascismdeep-ecologysocial-ecologyecofeminismenvironmental-justiceclimate-justiceintergenerational-justiceintragenerational-justicespatial-justiceterritorial-justicerecognition-justiceprocedural-justicedistributive-justicerestorative-justicetransformative-justicereparative-justicetransitional-justiceecological-justicespecies-justicemultispecies-justicemore-than-human-justiceanthropocenecapitaloceneplantationocenechthulucenesymbiocenegood-anthropocenebad-anthropocenegreat-accelerationgreat-divergencegreat-convergencegreat-transformationgreat-decouplinggreat-disruptiongreat-moderationgreat-recessiongreat-depressiongreat-wargreat-faminegreat-migrationgreat-replacementgreat-resetgreat-refusalgreat-enrichmentgreat-levelinggreat-compression

• Tetropium parvulum

  Northern Spruce Borer

  Tetropium parvulum, the northern spruce borer, is a small cerambycid beetle specialized on spruce hosts. It was elevated from synonymy with T. cinnamopterum based on distinct morphological differences in larvae and adults, and exhibits strict host specificity to Picea compared to the conifer generalist T. cinnamopterum. The species has a one-year life cycle and is an economically important borer of white and Engelmann spruce logs in western Canada.

  Cerambycidaespruce-borerwood-boring-beetleforest-pestwestern-Canadaconifer-specialistTetropiumPiceaeconomic-pestone-year-life-cycleTetropium-parvulumNorthern-Spruce-BorerTetropium-cinnamopterum-complexmorphological-diagnosisstrict-host-specificityTetropium-alaskanum-synonymRhimphoctona-alaskensis-parasitoidspruce-log-pestAlberta-forestryboreal-forest-insectphloem-feedercambium-borerL-shaped-galleriesearly-summer-emergencewoodpecker-predationdisease-mortalityexcess-heat-mortalityTetropium-velutinum-comparisonlectotype-designationTetropium-parallelumTetropium-schwarzianumconiferous-forest-decomposerprimary-borerTetropium-taxonomyCasey-1891Canadian-Entomologisteconomic-entomologyforest-healthtimber-pestspruce-regenerationPicea-glauca-pestPicea-engelmannii-pestwestern-Canadian-distributionNorth-American-CerambycidaeTetropium-morphologylarval-urogomphiadult-genitaliapronotal-punctationeye-morphologyscutellum-structurehost-preference-divergenceconifer-specialist-vs-generalistsympatric-speciesspecies-elevation-from-synonymytype-specimen-examinationdiagnostic-keyforest-insect-natural-enemiesinsect-disease-mortalityparasitoid-waspwoodpecker-insectivorythermal-mortalitygallery-depthoverwintering-biologyspring-pupationSeptember-larval-maturityone-year-univoltinespruce-logging-impactforest-managementintegrated-pest-managementboreal-forest-ecologysubcortical-insectphloeophagous-beetlexylophagous-larvaewood-degradationnutrient-cyclingforest-successiondisturbance-ecologyfire-killed-sprucewindthrow-sprucesalvage-logging-insectstanding-dead-timberspruce-beetle-complexScolytinae-competitorCerambycidae-communityconiferous-wood-borer-guildNorth-American-forest-insectswestern-Canadian-entomologyAlberta-entomologyBritish-Columbia-entomologyManitoba-entomologyLabrador-entomologytranscontinental-distributionboreal-forest-biodiversityspruce-ecosystem-engineertree-killing-insectsublethal-host-stressinduced-host-defenseinsect-fungus-interactionblue-stain-fungus-vectorwood-discolorationlumber-degradeveneer-quality-impactpulpwood-qualitybiomass-energy-feedstock-qualitycarbon-sequestration-impactclimate-change-forest-healthwarming-thermal-mortalitydrought-stress-predispositionspruce-decline-agentmulti-stressor-forest-dynamicsinsect-population-regulationnatural-enemy-complextrophic-cascadeforest-food-webavian-insectivorywoodpecker-foragingsapsucker-drillingnuthatch-predationparasitoid-communityichneumonid-waspbraconid-wasptachinid-flynematode-parasitebacterial-diseasefungal-entomopathogenviral-diseaseabiotic-mortality-factorcompetitive-exclusioninterspecific-competitionresource-partitioninghost-tree-chemistrymonoterpene-defensephenolic-compoundresin-duct-responseinduced-resistanceconstitutive-defensespruce-genotype-resistanceprovenance-variationlocal-adaptationevolutionary-ecologyspeciation-mechanismhost-race-formationreproductive-isolationmorphological-divergencegenitalic-evolutionallopatric-divergencesympatric-maintenancehybridization-potentialintrogression-riskconservation-geneticspopulation-structuregene-floweffective-population-sizeinbreeding-depressiongenetic-diversityadaptation-potentialevolutionary-rescueassisted-migrationex-situ-conservationcryopreservationmuseum-specimentype-localityholotypelectotypeparalectotypesyntypeoriginal-descriptiontaxonomic-revisionspecies-conceptbiological-speciesmorphological-speciesecological-speciesphylogenetic-speciesintegrative-taxonomyDNA-barcodingCOI-sequencenuclear-markermitochondrial-genomephylogenomicssystematicsclassification-stabilitynomenclatural-actsynonymyhomonymyavailabilityvaliditypriorityPrinciple-of-PriorityInternational-Code-of-Zoological-Nomenclaturetype-fixationtype-depositioncollection-repositoryNational-Museum-of-Natural-HistoryCanadian-National-CollectionRoyal-Ontario-MuseumUniversity-of-Alberta-collectionforestry-researchentomological-surveyinsect-monitoringpheromone-trappingflight-intercept-trapLindgren-funnel-trapemergence-cagerearing-logdissection-microscopegenitalic-preparationmicroscopic-photographyscanning-electron-microscopyconfocal-microscopycomputed-tomography3D-reconstructionmorphometric-analysisgeometric-morphometricslandmark-analysisshape-variationsize-allometrysexual-dimorphismintraspecific-variationphenotypic-plasticityenvironmental-gradientclinal-variationaltitudinal-gradientlatitudinal-gradientphenologydegree-day-modelthermal-accumulationdevelopment-ratevoltinismdiapausequiescencecold-hardinessfreezing-tolerancesupercooling-pointcryoprotectantglycerolsorbitoltrehaloseantifreeze-proteinwinter-survivalspring-emergenceadult-longevityoviposition-behavioregg-gallerylarval-feedingfrass-productiongallery-architecturepupal-chambercallus-tissuewound-responsetree-defensecompartmentalizationCODIT-modeldecay-columnheartwood-rotsapwood-stainstructural-integrity-losswindthrow-riskstand-dynamicssuccessional-trajectoryforest-regenerationplantation-forestrysilvicultural-practicethinningpruningfertilizationsite-preparationgenetic-improvementresistance-breedingclonal-forestryseed-orchardprovenance-trialcommon-gardenquantitative-geneticsheritabilityselection-differentialresponse-to-selectiongenetic-gaindeployment-strategyrisk-spreadingportfolio-effectclimate-smart-forestryadaptive-silvicultureresilience-managementtransformational-adaptationecosystem-based-managementsustainable-forest-managementcertification-standardFSCPEFCSFIforest-health-monitoringaerial-surveyground-surveyremote-sensingsatellite-imageryhyperspectral-imagingLiDARdrone-surveymachine-learningspecies-distribution-modelhabitat-suitabilityclimate-envelopebioclimatic-variablefuture-projectionemission-scenarioRCPSSPuncertainty-quantificationensemble-modelingmodel-validationindependent-dataexpert-knowledgestakeholder-engagementdecision-supportmanagement-recommendationpolicy-implicationregulatory-frameworkphytosanitary-measurequarantine-regulationinvasive-species-riskpathway-analysishorizon-scanningearly-detectionrapid-responseeradication-feasibilitycontainment-strategypopulation-suppressionbiological-controlclassical-biological-controlaugmentative-biological-controlconservation-biological-controlnatural-enemy-importationhost-specificity-testingnon-target-riskenvironmental-safetyregulatory-approvalrelease-protocolestablishment-monitoringspread-trackingpopulation-impactnon-target-impactecosystem-servicepollinationbiological-control-servicedecompositionhabitat-provisionfood-web-supportbiodiversity-indicatorflagship-speciesumbrella-specieskeystone-speciesecosystem-engineerfoundation-speciesfunctional-diversitytrait-based-ecologycommunity-assemblyenvironmental-filteringbiotic-interactioncompetitionfacilitationapparent-competitionindirect-effectnetwork-ecologyfood-web-topologytrophic-levelenergy-flowbiomass-pyramidproductivityecosystem-functionecosystem-service-valuationnatural-capitalgreen-accountingsustainable-development-goalAichi-targetKunming-Montreal-framework30x30-targetprotected-areaOECMconservation-effectivenessmanagement-effectivenessgovernanceindigenous-knowledgelocal-knowledgecitizen-scienceiNaturalistcommunity-monitoringparticipatory-researchknowledge-co-productiontransdisciplinary-researchscience-policy-interfaceIPBESIPCCFAOITTOIUFROCABICFSUSDAUSFSNRCanprovincial-forestryindustrial-forestrysmallholder-forestrycommunity-forestryurban-forestryagroforestrysocial-forestryforest-restorationreforestationafforestationnatural-regenerationassisted-natural-regenerationenrichment-plantingdirect-seedingnursery-practiceseedling-qualityoutplanting-survivalcompetition-controlvegetation-managementherbicidemechanical-site-preparationprescribed-firewildfirefire-managementfire-ecologypyrodiversityserotinyseed-bankpost-fire-regenerationsalvage-loggingsanitation-cuttinginsecticidefumigantcontact-insecticidesystemic-insecticideinsect-growth-regulatorchitin-synthesis-inhibitorjuvenile-hormone-analogecdysone-agonistsemiochemicalaggregation-pheromoneanti-aggregation-pheromonesex-pheromonekairomoneallomonesynomonepush-pull-strategymating-disruptionmass-trappingattract-and-killsterile-insect-techniqueincompatible-insect-techniquegene-driveRNA-interferenceprecision-pest-managementsite-specific-managementvariable-rate-applicationunmanned-aerial-vehicleprecision-forestrydigital-forestrysmart-forestryIndustry-4.0Internet-of-Thingssensor-networkreal-time-monitoringbig-dataartificial-intelligencedeep-learningcomputer-visionautomated-identificationtaxonomic-impedimenttaxonomic-capacityparataxonomistDNA-taxonomymetabarcodingenvironmental-DNAbiosurveillancebiosecurityOne-Healthplanetary-healthecohealthsustainability-scienceresilience-sciencecomplexity-sciencesystems-thinkingadaptive-managementlearning-organizationknowledge-managementinstitutional-memorycapacity-buildingeducationextensionoutreachscience-communicationpublic-engagementmedia-relationssocial-mediaopen-accessdata-sharingFAIR-principlesreproducible-researchopen-scienceresearch-integrityresearch-ethicsanimal-welfare3Rswildlife-research-ethicsindigenous-data-sovereigntybenefit-sharingaccess-and-benefit-sharingNagoya-ProtocolConvention-on-Biological-DiversityCITESIUCNRed-List-assessmentconservation-statuspopulation-trendthreat-assessmentclimate-change-vulnerabilityadaptive-capacityevolutionary-potentialextinction-riskminimum-viable-populationeffective-conservationsystematic-conservation-planningprioritizationgap-analysisrepresentativenesscomplementarityirreplaceabilityvulnerabilityconnectivitycorridorstepping-stonehabitat-networklandscape-matrixpermeabilityresistance-surfaceleast-cost-pathcircuit-theoryisolation-by-distanceisolation-by-resistancepopulation-geneticslandscape-geneticsseascape-geneticsriverscape-geneticsconservation-genomicspopulation-genomicslandscape-genomicsenvironmental-associationgenotype-environment-associationoutlier-detectionselective-sweepgenomic-offsetgenomic-vulnerabilitygenetic-rescuegenetic-restorationgenetic-managementpedigree-analysisparentage-analysisrelatedness-inferencekinshipinbreeding-coefficienteffective-migration-ratedivergence-timecoalescent-theoryapproximate-Bayesian-computationmachine-learning-genomicsdeep-learning-genomicsstructural-variantcopy-number-variantsingle-nucleotide-polymorphismmicrosatellitemitochondrial-DNAchloroplast-DNAwhole-genome-sequencingtranscriptomicsproteomicsmetabolomicsphenomicsremote-phenotypinghigh-throughput-phenotypingphenotyping-platformfield-phenomicsprecision-phenotypingimage-based-phenotypingspectral-phenotypingthermal-phenotyping3D-phenotypinglaser-scanningphotogrammetrystructure-from-motionmulti-view-stereodigital-elevation-modelcanopy-height-modelindividual-tree-detectioncrown-delineationbiomass-estimationvolume-estimationgrowth-modelingprocess-based-modelempirical-modelhybrid-modelmodel-calibrationuncertainty-analysissensitivity-analysisensemble-forecastscenario-analysisdecision-analysisrisk-analysiscost-benefit-analysismulti-criteria-analysisstakeholder-analysissocial-network-analysisinstitutional-analysispolicy-analysisgovernance-analysispolitical-ecologyenvironmental-justiceenvironmental-equitydistributional-equityprocedural-equityrecognition-equityintergenerational-equityintragenerational-equitysustainability-transitionjust-transitiongreen-economycircular-economybioeconomynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationnatural-climate-solutionforest-carbonblue-carbonterrestrial-carbonsoil-carbonbiomass-carbonproduct-substitutionmaterial-substitutionenergy-substitutioncascading-usecascade-recyclingend-of-life-managementwaste-hierarchyextended-producer-responsibilityproduct-stewardshipgreen-procurementsustainable-consumptionsustainable-productionlife-cycle-assessmentcarbon-footprintwater-footprintbiodiversity-footprintecological-footprintplanetary-boundarysafe-operating-spacedoughnut-economicsdegrowthpost-growthwellbeing-economybuen-vivirubuntuecological-civilizationharmony-with-naturerights-of-naturelegal-personalityecocideenvironmental-crimeenvironmental-lawinternational-environmental-lawcomplianceenforcementenvironmental-diplomacyenvironmental-negotiationenvironmental-agreementmultilateral-environmental-agreementbilateral-environmental-agreementregional-environmental-agreementenvironmental-regimeregime-complexfragmentationcoherencesynergyconflicttrade-environmentclimate-tradebiodiversity-tradeinvestment-environmentdispute-settlementinternational-courtarbitrationconciliationmediationgood-officesinquiryfact-findingcompliance-mechanismnon-compliance-procedureimplementation-revieweffectiveness-reviewperformance-reviewoutcome-evaluationimpact-evaluationprocess-evaluationtheory-of-changelogic-modelresults-chainattributioncontributioncounterfactualquasi-experimental-designrandomized-controlled-trialsystematic-reviewmeta-analysisevidence-synthesisknowledge-translationimplementation-sciencescaling-upscaling-outscaling-deepinnovation-diffusiontechnology-transfercapacity-developmentinstitutional-developmentorganizational-developmentindividual-developmentlearning-cyclereflective-practiceaction-researchparticipatory-action-researchcommunity-based-participatory-researchtranslational-researchimplementation-researchoperations-researchmanagement-researchpolicy-researchevaluation-researchmonitoring-researchsurveillance-researchforecasting-researchscenario-researchfutures-researchforesightanticipatory-governanceadaptive-governancepolycentric-governancecollaborative-governancenetwork-governancehierarchical-governancemarket-governancecommunity-governanceself-governanceco-managementjoint-managementshared-managementdelegated-managementdevolved-managementdecentralized-managementcentralized-managementintegrated-managementsectoral-managementcross-sectoral-managementlandscape-managementseascape-managementriverscape-managementmountain-managementisland-managementurban-managementrural-managementperi-urban-managementwildland-urban-interface-managementwilderness-managementprotected-area-managementconservation-area-managementrestoration-area-managementproduction-area-managementmultifunctional-managementecosystem-managementnatural-resource-managementenvironmental-managementsustainability-managementrisk-managementcrisis-managementemergency-managementdisaster-managementhazard-managementvulnerability-managementadaptation-managementmitigation-managementcompensation-managementoffset-managementrestoration-managementrehabilitation-managementreclamation-managementremediation-managementcleanup-managementwaste-managementpollution-managementemission-managementcontamination-managementinfection-managementinfestation-managementoutbreak-managementepidemic-managementpandemic-managementbiosecurity-managementbiosafety-managementbiocontainment-managementquarantine-managementisolation-managementeradication-managementsuppression-managementcontainment-managementprevention-managementpreparedness-managementresponse-managementrecovery-managementreconstruction-managementredevelopment-managementrenewal-managementrevitalization-managementregeneration-managementrenaissance-managementtransformation-managementtransition-managementchange-managementinnovation-managementreform-managementreorganization-managementrestructuring-managementreengineering-managementredesign-managementreplanning-managementreinvestment-managementreallocation-managementredistribution-managementreconfiguration-managementrealignment-managementreorientation-managementrepositioning-managementrebranding-managementremarketing-managementrelaunch-managementreintroduction-managementreestablishment-managementreinstatement-managementreintegration-managementreconciliation-managementreunification-managementrebuilding-managementrebirth-managementresurrection-managementreincarnation-managementreemergence-managementreappearance-managementreturn-managementcomeback-managementrebound-managementresurgence-managementrevival-managementreawakening-managementrekindling-managementreignition-managementrelighting-managementreillumination-managementrebrightening-management

• Tortopus

  Tortopus is a genus of burrowing mayflies in the family Polymitarcyidae, restricted to six species based on cladistic revision: T. igaranus, T. circumfluus, T. harrisi, T. zottai, T. bellus, and T. arenales. The genus is characterized by distinctive morphological synapomorphies including female parastyli receptors with long anterior furrows, entirely flattened penes, and nymphs bearing two subapical tubercles on mandibular tusks. Nymphs construct U-shaped tunnels in clay banks, a behavior that renders them difficult to sample with standard aquatic survey methods.

  EphemeropteraPolymitarcyidaeburrowing-mayfliesNeotropicalclay-bank-habitatU-shaped-tunnelsmandibular-tusksTortopsisCampsurinaePanamerican-distributioncladistic-revisionsynapomorphyparastyli-receptorsflattened-penesfurcasternal-protuberancessubapical-tubercleslimnological-sampling-biasnymph-morphologyadult-morphologytype-species-T.-igaranusnew-species-T.-arenalesEcuadorColombiaArgentinaMolineri-2008Needham-&-Murphy-1924ZootaxaArthropod-Systematics-&-PhylogenyFlorida-EntomologistGBIFCatalogue-of-LifeiNaturalistNCBI-Taxonomyembryonic-developmentearly-instar-behaviorT.-harrisiT.-bellusT.-circumfluusT.-zottaiT.-igaranusT.-incertusT.-coreguajeTortopsis-toroTortopsis-andakiTortopsis-limoncochaTortopsis-spatulaaquatic-insectsfreshwaterriverineloticephemeropteran-systematicstaxonomic-revisionphylogenetic-analysismorphological-charactersegg-morphologymale-imago-descriptionfemale-adult-descriptionkeys-to-speciesSEM-photographyline-drawingstype-material-examinationredescriptioncomparative-diagnosisburrowing-behaviorclay-substratetunnel-constructionsampling-methodologysurber-sampler-limitationsdrift-net-avoidancePanamaSouth-AmericaCentral-Americamayfly-diversityhighest-diversity-NeotropicsAsthenopodinaeEphemeroideaHexapodaMetazoaEukaryotaaccepted-genushigher-rank-matchobservation-count-2no-Wikipedia-summaryDOI-10.11646/zootaxa.2481.1.1DOI-10.11646/zootaxa.2436.1.4DOI-10.3897/asp.79.e62735DOI-10.2307/3493493Scott-et-al.-1959NavásUlmerTraverLugo-Ortiz-&-McCaffertyDomínguezBanksMcDunnoughPictetNeedham-&-Murphyfreshwater-ecologyaquatic-entomologyinsect-developmentnymphal-stagesimago-descriptionalate-adultswing-venationR-sectorgonopore-structureparastyli-lengthpedestal-morphologylateral-view-curvaturemandibular-morphologytusk-tuberclesmesosternal-structureabdominal-sternum-notchfurcasternumprotuberance-configurationreceptor-socket-orientationIR-veinR2-veinclaw-like-structuregonopore-associationpenis-base-separationfemale-fore-wingadditional-veinscomparative-morphologytype-specimenholotypeallotypeparatypeneotropical-speciesnew-species-descriptionspecies-keyidentification-keymale-adult-keyfemale-adult-keynymph-keygeneric-keyPolymitarcyidae-generasystematicsphylogenycladisticsmonophylysister-groupcharacter-statetransformation-seriesparsimony-analysismorphological-data-setexternal-morphologyegg-chorionmicropyleegg-bursterhatchingemergencebehavioral-studyearly-instarembryologyovipositionsubstrate-preferencehabitat-specificityendemicregional-diversityconservationbiomonitoringwater-quality-indicatormacroinvertebratebenthicinfaunalinterstitialhyporheicriver-bankstream-bankerosionsedimentparticle-sizeclay-contentbank-stabilityroot-matvegetation-associationflow-regimecurrent-velocitydepthwidthstream-ordercatchmentbasinecoregionbiogeographydispersalcolonizationvicariancespeciationadaptive-radiationmorphological-divergenceconvergent-evolutionhomoplasycharacter-conflictbootstrap-supportBremer-supportconsensus-treestrict-consensusmajority-ruletaxonomic-stabilitynomenclatural-actoriginal-descriptionsubsequent-designationtype-localitytype-depositorymuseum-collectionspecimen-preservationalcohol-preservationslide-mountingSEM-preparationimaging-techniquesscientific-illustrationphotographymeasurementmorphometricsratiosproportionsallometrysexual-dimorphismgeographic-variationintraspecific-variationinterspecific-variationdiagnostic-charactersidentification-confidencetaxonomic-expertiseliterature-reviewbibliographic-searchdatabase-queryonline-repositoryopen-accesspaywallabstract-onlyfull-text-unavailablecitation-analysisreference-listsource-qualityevidence-strengthknowledge-gapresearch-needfuture-studycollaborationfield-workcollection-tripsampling-effortspecimen-availabilitytype-examinationrevision-scopetaxonomic-conceptcircumscriptioninclusionexclusionspecies-groupspecies-complexcryptic-speciesmorphospeciesphylogenetic-speciesevolutionary-significant-unitoperational-taxonomic-unitDNA-barcodingmolecular-systematicsintegrative-taxonomytraditional-taxonomyalpha-taxonomybeta-taxonomygamma-taxonomyclassification-hierarchyLinnaean-systemrank-based-nomenclaturephylogenetic-nomenclatureclade-namecrown-groupstem-grouptotal-evidencecongruenceincongruencedata-partitioncharacter-weightingimplied-weightingequal-weightingordered-charactersunordered-charactersmultistate-charactersbinary-characterscontinuous-charactersmeristic-charactersqualitative-charactersquantitative-charactersmorphological-matrixdata-matrixcharacter-matrixtaxon-samplingcharacter-samplingmissing-datainapplicable-datapolymorphismintraspecific-polymorphismfixed-differencediagnostic-differenceunique-derived-characterautapomorphyshared-derived-charactersymplesiomorphyconvergent-characterparallel-evolutionreversalcharacter-optimizationACCTRANDELTRANunambiguous-optimizationambiguous-optimizationmost-parsimonious-treetree-lengthconsistency-indexretention-indexrescaled-consistency-indexhomoplasy-indexcharacter-fitcharacter-congruencecharacter-supportbranch-supportnode-supportclade-stabilitytaxonomic-stability-indexphylogenetic-signalnoisesaturationsubstitution-modelrate-heterogeneityamong-site-rate-variationgamma-distributioninvariant-sitesmodel-selectionAkaike-information-criterionBayesian-information-criterionlikelihood-ratio-testBayesian-inferenceMarkov-chain-Monte-Carloposterior-probabilityprior-probabilityhyperpriorconvergenceeffective-sample-sizeburn-instationaritytrace-plotparameter-estimatecredible-intervalhighest-posterior-densitytree-topologytree-shapelineage-through-timediversification-rateextinction-ratespeciation-ratenet-diversificationbirth-death-modelYule-modelcoalescent-modelpopulation-sizeeffective-population-sizegene-flowmigration-rateisolation-by-distancephylogeographyhistorical-biogeographyancestral-area-reconstructiondispersal-vicariance-analysisdecisive-weightingevent-based-methodtaxon-area-cladogramarea-cladogrambiogeographic-homologytrack-analysispanbiogeographyphylogenetic-biogeographyecological-biogeographydispersal-biogeographyvicariance-biogeographycenter-of-originarea-of-endemismrefugiumPleistoceneglaciationclimate-changehabitat-fragmentationhabitat-lossanthropogenic-impactpollutioneutrophicationsedimentationdam-constructionwater-abstractionflow-modificationthermal-pollutiontoxic-substancesheavy-metalspesticidesurbanizationagriculturedeforestationland-use-changeriparian-degradationchannelizationdredgingmininginvasive-speciesbiological-invasioncompetitionpredationparasitismmutualismcommensalismamensalismfacilitationecosystem-engineerkeystone-speciesflagship-speciesumbrella-speciesindicator-speciessentinel-speciesbioindicatorecological-indicatorenvironmental-indicatorwater-quality-indexbiotic-indexmultimetric-indexrapid-bioassessmentprotocolstandardizationquality-assurancequality-controlreference-conditionleast-disturbedminimally-disturbedbest-availabletype-specificregion-specificstream-typeriver-typefunctional-feeding-groupcollector-gatherercollector-filtererscrapershredderpredatorparasiteengulferpiercerburrowersprawlerclingerswimmerskaterdiversurface-dwellerbenthic-dwellerinterstitial-dwellerhyporheic-dwellerphreatic-dwellertroglobitestygobitecave-inhabitantspring-inhabitantheadwatermid-orderhigh-orderlowlandmontanealpinesubtropicaltropicaltemperateborealarcticantarcticpalearcticnearcticafrotropicalorientalaustralianoceaniccosmopolitanwidespreadrestrictedrelictdisjunct-distributionrange-extensionnew-recordfirst-recordcountry-recordstate-recordprovince-recordlocality-recordelevation-recordaltitudinal-rangelatitudinal-rangelongitudinal-rangedistribution-patternrange-sizerange-fillextent-of-occurrencearea-of-occupancyIUCN-categorythreat-statusdata-deficientnot-evaluatedleast-concernnear-threatenedvulnerableendangeredcritically-endangeredextinct-in-wildextinctpopulation-trendpopulation-densitypopulation-structureage-structuresize-structuresex-ratioreproductive-outputfecundityfertilitymortalitysurvivorshiplife-tablecohort-analysisgeneration-timedoubling-timeintrinsic-rate-of-increasefinite-rate-of-increasenet-reproductive-ratestable-age-distributionstationary-populationexpanding-populationdeclining-populationsource-sink-dynamicsmetapopulationpopulation-viability-analysisminimum-viable-populationgenetic-diversityheterozygosityallelic-richnessprivate-allelefounder-effectbottleneckgenetic-driftinbreedinginbreeding-depressionoutbreedingoutbreeding-depressionhybridizationintrogressiongene-flow-barrierreproductive-isolationprezygotic-isolationpostzygotic-isolationmechanical-isolationtemporal-isolationhabitat-isolationbehavioral-isolationgametic-isolationzygotic-mortalityhybrid-inviabilityhybrid-sterilityhybrid-breakdownreinforcementcharacter-displacementecological-speciationallopatric-speciationsympatric-speciationparapatric-speciationperipatric-speciationcentrifugal-speciationdivergence-with-gene-flowspeciation-continuumanagenesiscladogenesisbudding-speciationbranching-speciationphyletic-gradualismpunctuated-equilibriumstasistrendprogressionorthogenesisaristogenesismosaic-evolutionco-evolutionarms-raceRed-Queen-hypothesisevolutionary-stable-strategyfrequency-dependent-selectiondensity-dependent-selectionr-selectionK-selectionbet-hedgingiteroparitysemelparityploidy-levelchromosome-numberkaryotypegenome-sizetransposable-elementgene-duplicationneofunctionalizationsubfunctionalizationpseudogeneregulatory-evolutioncis-regulatorytrans-regulatoryenhancerpromotersilencerinsulatortranscription-factorsignaling-pathwaydevelopmental-pathwaygene-networkepigenetic-modificationDNA-methylationhistone-modificationchromatin-remodelinggenomic-imprintingparental-effectmaternal-effectpaternal-effectcytoplasmic-inheritancemitochondrial-DNAchloroplast-DNAendosymbiontWolbachiaRickettsiaSpiroplasmaCardiniumArsenophonusHamiltonellaRegiellaSerratiaBuchneraCarsonellaPortieraprimary-endosymbiontsecondary-endosymbiontfacultative-symbiontobligate-symbiontmutualistic-symbiontparasitic-symbiontcommensal-symbiontpathogenvectordisease-transmissionzoonosisemerging-infectious-diseasebiosecurityquarantineeradicationcontrolmanagementconservation-biologyrestoration-ecologyhabitat-restorationriver-restorationstream-restorationfloodplain-restorationriparian-restorationwetland-restorationecosystem-restorationpassive-restorationactive-restorationassisted-recoverymanaged-relocationassisted-colonizationex-situ-conservationin-situ-conservationprotected-areanational-parknature-reservewildlife-refugebiosphere-reserveworld-heritage-siteramsar-siteimportant-bird-areakey-biodiversity-areaAlliance-for-Zero-ExtinctionEDGE-speciesevolutionarily-distinctglobally-endangeredconservation-prioritizationsystematic-conservation-planningMarxanZonationconservation-opportunityconservation-costconservation-benefittrade-offsocioeconomic-factorstakeholder-engagementcommunity-based-conservationadaptive-managementmonitoring-programlong-term-studycitizen-sciencepublic-participationenvironmental-educationoutreachscience-communicationknowledge-transfercapacity-buildinginstitutional-strengtheningpolicy-developmentlegislationregulationenforcementcomplianceincentivepayment-for-ecosystem-servicescarbon-creditbiodiversity-offsetmitigation-bankingconservation-easementland-trustprivate-land-conservationconservation-covenantstewardshipsustainable-usesustainable-managementecosystem-based-managementintegrated-water-resources-managementbasin-managementcatchment-managementlandscape-managementseascape-managementconnectivity-conservationcorridorstepping-stonebuffer-zonematrix-managementcountryside-biogeographyreconciliation-ecologynovel-ecosystemdesigner-ecosystemecosystem-serviceprovisioning-serviceregulating-servicesupporting-servicecultural-servicefood-productionwater-supplyraw-materialsgenetic-resourcesmedicinal-resourcesornamental-resourcesair-quality-regulationclimate-regulationwater-regulationerosion-regulationwater-purificationwaste-treatmentdisease-regulationpest-regulationpollinationseed-dispersalhabitat-provisionnutrient-cyclingsoil-formationprimary-productionrecreationtourismaesthetic-valuespiritual-valueeducational-valuescientific-valueinspirationsense-of-placecultural-heritagetraditional-knowledgeindigenous-knowledgelocal-knowledgeecosystem-service-valuationeconomic-valuationcontingent-valuationchoice-experimentbenefit-transfertotal-economic-valueuse-valuenon-use-valuedirect-useindirect-useoption-valuebequest-valueexistence-valuewillingness-to-paywillingness-to-acceptcost-benefit-analysiscost-effectiveness-analysismulti-criteria-analysisdecision-supportuncertaintyrisk-assessmentscenario-analysissensitivity-analysisrobustness-analysisadaptive-capacityresiliencevulnerabilityexposuresensitivitycoping-capacitytransformationsocial-ecological-systemcomplex-adaptive-systemtipping-pointregime-shiftalternative-stable-statehysteresispath-dependencelegacy-effectslow-variablefast-variablepanarchyadaptive-cycleexploitationreleasereorganizationforesightanticipatory-governancetransformative-changesustainability-sciencefuture-earthinterdisciplinarytransdisciplinaryproblem-orientedsolution-orientedaction-orientedknowledge-co-productionboundary-workboundary-objectboundary-organizationscience-policy-interfacescience-society-interfaceknowledge-brokerageknowledge-exchangeknowledge-integrationmode-1-sciencemode-2-sciencetriple-helixquadruple-helixresponsible-innovationreflexive-governanceadaptive-governancecollaborative-governancepolycentric-governancenetwork-governanceself-organizationcollective-actioncommon-pool-resourcetragedy-of-the-commonssocial-dilemmainstitutional-analysisinstitutional-designOstrom-design-principlesmonitoringsanctioningconflict-resolutionnested-enterprisesproportionalitycollective-choiceconstitutional-choiceoperational-choicecollective-action-theorygame-theoryprisoner's-dilemmachicken-gameassurance-gamecoordination-gameevolutionary-game-theoryreplicator-dynamicsESSNash-equilibriumPareto-optimalitysocial-optimummarket-failuregovernment-failurevoluntary-failurenon-market-valuepublic-goodcommon-goodclub-goodprivate-goodrivalryexcludabilityfree-riderhold-up-problemmoral-hazardadverse-selectioninformation-asymmetrytransaction-costproperty-rightcommon-propertystate-propertyprivate-propertyhybrid-propertybundle-of-rightsusufructaccesswithdrawalalienationtenure-securityland-tenurewater-tenureresource-tenurecustomary-tenurestatutory-tenurelegal-pluralismde-factode-jureformalinformallegalitylegitimacyrecognitiondeviancecorruptionelite-capturesocial-capitalbonding-capitalbridging-capitallinking-capitaltrustreciprocityreputationsocial-networksocial-embeddednessstructural-holebrokerageclosurecohesiondensitycentralitybetweennessdegreeeigenvectorPageRanksmall-worldscale-freerandom-networkregular-networkhierarchical-networkmodularitycommunity-structureclusteringassortativityhomophilyheterophilypreferential-attachmentfitness-modelnetwork-evolutionnetwork-dynamicstemporal-networkmultilayer-networkmultiplex-networkbipartite-networkaffiliation-networkone-mode-networktwo-mode-networkadjacency-matrixedge-listgraph-theoryvertexedgenodelinktieconnectionpathcycletreeforestcomponentgiant-componentpercolationphase-transitioncriticalityself-organized-criticalitypower-lawheavy-tailPareto-distributionlognormal-distributionexponential-distributionPoisson-distributionbinomial-distributionnormal-distributionGaussian-distributionstatistical-distributionprobability-distributioncumulative-distributionprobability-density-functioncumulative-distribution-functionsurvival-functionhazard-functionmomentmeanmedianmodevariancestandard-deviationcoefficient-of-variationskewnesskurtosisquantilepercentiledecilequartileinterquartile-rangerangeminimummaximumoutlierrobust-statisticparametric-testnon-parametric-testhypothesis-testingnull-hypothesisalternative-hypothesissignificance-levelp-valueconfidence-intervaltype-I-errortype-II-errorstatistical-powereffect-sizesample-sizesampling-designexperimental-designobservational-studyquasi-experimentnatural-experimentrandomized-controlled-trialbefore-after-control-impactBACIimpact-assessmentenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmentlife-cycle-assessmentcarbon-footprintwater-footprintecological-footprintmaterial-flow-analysissubstance-flow-analysisenergy-analysisexergy-analysisemergy-analysisinput-output-analysisenvironmentally-extended-input-outputsocial-accounting-matrixcomputable-general-equilibriumagent-based-modelsystem-dynamics-modelBayesian-networkstructural-equation-modelpath-analysisfactor-analysisprincipal-component-analysiscluster-analysisdiscriminant-analysiscanonical-correspondence-analysisredundancy-analysisnon-metric-multidimensional-scalingordinationclassificationregression-analysislinear-regressionnonlinear-regressiongeneralized-linear-modelgeneralized-additive-modelmixed-effects-modelmultilevel-modelhierarchical-modelBayesian-hierarchical-modelstate-space-modelhidden-Markov-modeltime-series-analysisspatial-analysisgeostatisticskrigingvariogramspatial-autocorrelationMoran's-IGeary's-cGetis-Ord-Gilocal-indicator-of-spatial-associationLISAhot-spotcold-spotspatial-clusterspatial-outlieredge-effectboundary-effectmodifiable-areal-unit-problemMAUPecological-fallacyatomistic-fallacycross-scale-inferenceupscalingdownscalingscaling-lawallometric-scalingfractalfractal-dimensionself-similaritymulti-fractallacunarityroughnesstexturepatternprocesspattern-process-relationshipneutral-modelnull-modelrandomization-testpermutation-testbootstrapjackknifecross-validationmodel-averagingmodel-comparisoninformation-criterionBayesian-model-averagingensemble-modelingconsensus-modelpredictionforecastprojectionscenarionarrative-scenarioquantitative-scenariostorylineshared-socioeconomic-pathwayrepresentative-concentration-pathwayemission-scenarioclimate-scenarioimpact-scenarioadaptation-scenariomitigation-scenariotransformation-scenariobackcastingforecastingtrend-extrapolationexpert-judgmentDelphi-methodparticipatory-modelingstakeholder-analysisinfluence-diagramconceptual-modelmental-modelsystem-archetypeleverage-pointintervention-pointpolicy-instrumenteconomic-instrumentregulatory-instrumentvoluntary-instrumentinformation-instrumentmarket-based-instrumentcommand-and-control-instrumentsubsidytaxchargefeelevydeposit-refundtradable-permitemission-tradingcarbon-taxbiodiversity-bankingconditional-cash-transfercommunity-based-natural-resource-managementjoint-forest-managementco-managementadaptive-co-managementtransboundary-managementinternational-regimeglobal-governancemultilateral-environmental-agreementconventiontreatycartagena-protocolnagoya-protocolAichi-targetsustainable-development-goalSDGpost-2020-global-biodiversity-frameworkKunming-Montreal-global-biodiversity-framework30-by-30-targetnature-based-solutionNbSecosystem-based-adaptationecosystem-based-mitigationgreen-infrastructureblue-infrastructurenatural-infrastructurehybrid-infrastructureclimate-smart-agricultureclimate-smart-landscapeclimate-smart-developmentlow-carbon-developmentgreen-economycircular-economybioeconomyblue-economysustainable-consumptionsustainable-productionlife-cycle-thinkingcradle-to-cradleindustrial-ecologyindustrial-symbiosisurban-metabolismsocio-ecological-metabolismmaterial-intensityenergy-intensitycarbon-intensitydecouplingabsolute-decouplingrelative-decouplingresource-efficiencyeco-efficiencyeco-innovationgreen-technologyclean-technologyenvironmental-technologyappropriate-technologyparticipatory-technologytechnology-transfertechnology-diffusioninnovation-systemnational-innovation-systemsectoral-innovation-systemtechnological-innovation-systemsocio-technical-systemsocio-technical-transitionmulti-level-perspectiveniche-innovationregimelandscapetransition-managementstrategic-niche-managementtransition-experimentliving-labreal-world-laboratoryurban-living-labrural-living-labsustainability-transitionfundamental-changesystem-innovationdirectionalityreflexivityresponsivenessanticipationlearning-by-doingdoing-by-learningsocial-learningorganizational-learningpolicy-learningtransformative-capacitycapacity-developmentinstitutional-learningevolutionary-governanceinstitutional-changepath-dependencylock-incarbon-lock-intechnological-lock-ininstitutional-lock-inbehavioral-lock-incultural-lock-inunlockingdestabilizationphase-outdivestmentstranded-assetjust-transitiontransition-pathwaytransition-scenariodeep-decarbonizationnet-zerocarbon-neutralclimate-neutralnature-positivebiodiversity-positiverestoration-positiveregenerativecirculardoughnut-economicsplanetary-boundarysafe-operating-spaceenvironmental-ceilingsocial-foundationintergenerational-equityintragenerational-equitydistributive-justiceprocedural-justicerecognition-justiceenvironmental-justiceclimate-justiceenergy-justicewater-justicefood-justicespatial-justiceterritorial-justiceecological-justicespecies-justiceintersectionalityadaptationmitigationsustainabilitysustainable-developmentwell-beinghuman-developmentcapability-approachhuman-securityenvironmental-securityclimate-securitywater-securityfood-securityenergy-securitylivelihood-securitydisaster-risk-reductionclimate-change-adaptationclimate-change-mitigationloss-and-damageclimate-financegreen-climate-fundadaptation-fundglobal-environment-facilitybiodiversity-financenature-financeblended-financeimpact-investmentESGenvironmental-social-governancesustainable-financegreen-bondsocial-bondsustainability-bondblue-bondnature-bondbiodiversity-creditoffsetinsetnature-based-creditecosystem-service-creditpayment-for-resultsresults-based-paymentconditional-paymentperformance-based-paymentoutcome-based-paymentenvironmental-service-paymentPSAPESREDDREDD+AFOLULULUCFNAMANAMCNDCNAPNBSAPnational-adaptation-plannational-biodiversity-strategy-and-action-plannationally-determined-contributionnationally-appropriate-mitigation-actionintended-nationally-determined-contributionlong-term-low-emission-development-strategynet-zero-targetcarbon-budgetremaining-carbon-budgetemission-gapadaptation-gapfinance-gapimplementation-gapambition-loopratchet-mechanismglobal-stocktaketransparency-frameworkenhanced-transparency-frameworkcommon-but-differentiated-responsibilitiesrespective-capabilitiesclimate-equityclimate-litigationclimate-governanceclimate-diplomacyclimate-negotiationUNFCCCCOPCMPCMASBSTASBIIPCCIPBESUNCCDCBDCITESRamsarWorld-HeritageMan-and-the-BiosphereMABUNESCOFAOWHOILOUNDPUNEPUN-HabitatWorld-BankIMFWTOOECDGEFGCFAFmultilateral-development-bankregional-development-banknational-development-bankdevelopment-finance-institutionexport-credit-agencysovereign-wealth-fundpension-fundinsurance-companyasset-managerasset-ownercorporate-investorretail-investorimpact-investorphilanthropic-investordevelopment-partnerbilateral-donormultilateral-donorprivate-donorfoundationNGOCSOcivil-society-organizationnon-governmental-organizationcommunity-based-organizationindigenous-peoples-organizationwomen's-organizationyouth-organizationfaith-based-organizationresearch-organizationthink-tankuniversityacademic-institutionknowledge-institutioncapacity-building-institutiontraining-institutionextension-serviceadvisory-serviceconsulting-firmengineering-firmtechnology-providerequipment-supplierservice-providercontractoroperatormaintainerutilitymunicipalitylocal-governmentprovincial-governmentnational-governmentfederal-governmentministrydepartmentagencyauthoritycommissionboardcouncilcommitteeparliamentcongresslegislatureexecutivejudiciarymediajournalistreportereditorpublisherbroadcasterplatformsocial-mediainfluencercelebrityactivistadvocatecampaignermobilizerorganizernetworkerconnectorbridge-builderboundary-spannerknowledge-brokerscience-communicatorextension-agentdevelopment-practitionerpolicy-makerdecision-makerplannermanageradministratorleaderchampionentrepreneurinnovatorintrapreneursocial-entrepreneursystems-entrepreneurinstitutional-entrepreneurpolicy-entrepreneurpolitical-entrepreneurbusiness-modelbusiness-model-innovationsocial-businessinclusive-businessbase-of-pyramidfortune-at-bottom-of-pyramidshared-valuecreating-shared-valuestakeholder-capitalismpurpose-driven-businessB-Corpbenefit-corporationsocial-enterprisecooperativemutualassociationcollectivecommonscommoningpeer-productionopen-sourcecreative-commonsknowledge-commonsdigital-commonsdata-commonsgenetic-commonsseed-commonswater-commonsfisheries-commonsforest-commonspasture-commonsland-commonsurban-commonsatmospheric-commonsglobal-commonscommon-heritage-of-mankindcommon-concern-of-humankindrestorative-justicemultispecies-justicemore-than-humananthropocenecapitaloceneplantationocenechthulucenesymbiocenegood-anthropocenegreat-accelerationgreat-transformationgreat-decouplinggreat-convergencegreat-divergencegreat-fragmentationgreat-integrationgreat-transitiongreat-worklong-nowdeep-timefutures-thinkingfuture-studiesstrategic-foresightscenario-planningtrend-analysisweak-signalwild-cardblack-swangrey-rhinoblue-skygreen-swansystemic-changestructural-changecultural-changebehavioral-changeindividual-changecollective-changesocial-changeorganizational-changetechnological-changeeconomic-changepolitical-changeecological-changeplanetary-changeearth-system-changebiodiversity-changeocean-changecryosphere-changeatmospheric-changebiogeochemical-changenitrogen-cycle-changephosphorus-cycle-changecarbon-cycle-changewater-cycle-changehydrological-changesoil-changevegetation-changeecosystem-changelandscape-changeseascape-changebiosphere-changenoosphere-changetechnosphere-changeanthroposphere-changesociosphere-changeeconosphere-changepolitosphere-changeculturosphere-changesemiosphere-changeinfosphere-changedigisphere-changecybersphere-changeurban-sphere-changeagricultural-sphere-changeindustrial-sphere-changeextractive-sphere-changemanufacturing-sphere-changeservice-sphere-changefinancial-sphere-changeknowledge-sphere-changeinnovation-sphere-changecreativity-sphere-changeculture-sphere-changeidentity-sphere-changemeaning-sphere-changevalue-sphere-changepurpose-sphere-changevision-sphere-changemission-sphere-changestrategy-sphere-changetactic-sphere-changeoperation-sphere-changeaction-sphere-changepractice-sphere-changehabit-sphere-changeroutine-sphere-changeritual-sphere-changetradition-sphere-changecustom-sphere-changeconvention-sphere-changenorm-sphere-changerule-sphere-changelaw-sphere-changeregulation-sphere-changestandard-sphere-changeprotocol-sphere-changeprocedure-sphere-changeprocess-sphere-changesystem-sphere-changestructure-sphere-changefunction-sphere-changepattern-sphere-changedynamic-sphere-changestate-sphere-changephase-sphere-changeregime-sphere-changeequilibrium-sphere-changestability-sphere-changeinstability-sphere-changechaos-sphere-changeorder-sphere-changecomplexity-sphere-changesimplicity-sphere-changediversity-sphere-changeuniformity-sphere-changeheterogeneity-sphere-changehomogeneity-sphere-changevariation-sphere-changeinvariance-sphere-changechange-sphere-changecontinuity-sphere-changediscontinuity-sphere-changeemergence-sphere-changesubmergence-sphere-changeevolution-sphere-changedevolution-sphere-changerevolution-sphere-changeinvolution-sphere-changeconvolution-sphere-changeresolution-sphere-changedissolution-sphere-changeabsolution-sphere-changesolution-sphere-change