Tropical
Guides
Achilini
Achilini is a tribe of planthoppers within the family Achilidae, characterized by their flattened, often cryptically colored bodies and association with fungal substrates. Members of this tribe are distinguished from other achilid tribes by specific wing venation patterns and genitalia structures. The group is primarily tropical and subtropical in distribution, with many species exhibiting complex host relationships with fungi. Achilini represents one of the more species-rich tribes within Achilidae.
Achlyodidini
Achlyodidini is a tribe of skipper butterflies in the subfamily Pyrginae, characterized by unusually-shaped wings with squarely truncated forewing tips and often vivid coloration. The tribe comprises approximately 16 genera and is restricted to the Americas, primarily in tropical regions. Formerly included within a broad concept of Pyrgini, Achlyodidini is now recognized as a distinct tribe based on phylogenetic studies, though it remains the closest relative to Pyrgini sensu stricto. The tribe includes notable genera such as Eantis (sicklewings) and Achlyodes.
Agaonidae
fig wasps
Agaonidae is a family of minute chalcidoid wasps comprising the pollinating fig wasps, which maintain an obligate mutualism with Ficus species. Females are winged and darkly pigmented, while males are typically wingless and pale. The family has undergone significant taxonomic revision based on molecular phylogenetics, with former subfamilies Epichrysomallinae, Otitesellinae, Sycoecinae, Sycoryctinae, and Sycophaginae excluded and transferred to other families.
Alaruasa
Alaruasa is a genus of planthoppers in the family Fulgoridae, described by Distant in 1906. Members belong to the tribe Poiocerini within the subfamily Lystrinae. The genus is part of the diverse and visually striking fulgorid fauna of tropical regions. As with many fulgorid genera, Alaruasa species likely exhibit the elongated head processes characteristic of this family, though specific morphological details require individual species examination.
Amblypsilopus
Amblypsilopus is a large genus of long-legged flies (Dolichopodidae) containing approximately 350 described species. The genus is distributed across tropical and subtropical regions worldwide, with particularly high diversity in the Afrotropical region where about 60 species occur, including 25 on Madagascar alone. The genus is possibly polyphyletic and requires further taxonomic revision. Species identification relies heavily on male genitalia morphology, particularly the surstylus and cercus, along with male secondary sexual characters on the legs.
Amblypygi
whip spiders, tailless whip scorpions, amblypygids
Amblypygi is an ancient order of arachnids comprising approximately 280 species across five families. These nocturnal predators are characterized by extremely elongated first pair of legs modified as sensory "whips" and raptorial pedipalps for capturing prey. They lack venom glands, silk production, and the tail-like flagellum present in their relatives the whip scorpions (Uropygi). Several species exhibit unusual social behaviors including maternal care and kin recognition.
Ammodonus tropicus
Ammodonus tropicus is a species of darkling beetle in the family Tenebrionidae, described by Kirsch in 1866. It belongs to the tribe Ammodoniini, a group of small to medium-sized tenebrionids often associated with sandy or arid habitats. The species epithet 'tropicus' suggests a tropical distribution, which aligns with records from Colombia and Mexico.
Ampulex
cockroach wasps, jewel wasps
Ampulex is a large cosmopolitan genus of cockroach-hunting wasps in the family Ampulicidae, comprising over 130 species concentrated in tropical regions of the Old World. Fewer than 15 species occur in the New World, and fewer than 5 are native to Europe or the United States. The genus is notable for its specialized parasitoid biology: females sting cockroaches with venom that induces a state of hypokinesia—suppressed escape response and reduced locomotion without paralysis—then lead the subdued host to a shelter, lay eggs on its legs, and seal it inside where the larva consumes the living host. The emerald jewel wasp Ampulex compressa is the best-studied species and has spread globally alongside its host cockroaches.
Ancyloscelis apiformis
Apiform Morning glory-Digger
Ancyloscelis apiformis is a solitary bee in the family Apidae, tribe Emphorini. It is known for its association with morning glory flowers (Ipomoea species), from which it derives its common name. The species has a broad distribution across the Americas, from the southern United States through Central America and into South America. As a member of the subfamily Apinae, it exhibits pollen-collecting behavior typical of this group.
Ancyloxypha arene
Tropical Least Skipper
Ancyloxypha arene, commonly known as the Tropical Least Skipper, is a small grass skipper butterfly in the family Hesperiidae. It is one of the smallest skippers in North America. The species occurs from the southern United States through Central America. Adults are active throughout much of the year in tropical regions, with more restricted flight periods in temperate areas.
Anteos
Angled Sulphurs, angled-sulphurs
Anteos is a genus of butterflies in the family Pieridae, commonly known as angled-sulphurs. The genus contains three recognized species: Anteos clorinde (white angled sulphur), Anteos maerula (angled sulphur), and Anteos menippe (orange-tipped angled-sulphur). These butterflies are found in tropical regions of the Americas. Anteos menippe has been used in physiological research, including the first direct electrocardiographic characterization in Lepidoptera.
Anteos maerula
Yellow Angled-Sulphur, angled sulphur
Anteos maerula is a large Pieridae butterfly commonly known as the yellow angled-sulphur. Its native range extends from Peru through Central America to Mexico, with occasional vagrant individuals recorded as far north as the central and eastern United States. The species is distinguished by its angular wing margins and substantial wingspan, making it one of the larger sulphur butterflies in the Americas.
Antigastra catalaunalis
Sesame Leafroller, Sesame Pod-borer, Sesame Webworm, Sesame Capsule Borer, Sesame Leaf Webber
Antigastra catalaunalis is a crambid moth whose larvae are major agricultural pests of sesame (Sesamum indicum). Native to tropical and subtropical regions of Africa and Asia, it has spread globally through human-mediated transport and its own migratory capacity. The species has been documented attacking multiple plant families including Scrophulariaceae and Pedaliaceae, though sesame remains its economically significant host. Laboratory studies indicate a complete life cycle of approximately 26.5 days under controlled conditions.
Aphrissa statira
statira sulphur
Aphrissa statira is a medium-sized yellow butterfly known for its dramatic annual migrations in tropical regions of the Americas. The species exhibits sexual dimorphism, with males displaying brighter lemon-yellow upper wings and females appearing paler yellow to greenish-white. It has been extensively studied for its navigational abilities, including use of Earth's magnetic field for orientation during migration. The species ranges from the southern United States through Central America to northern Argentina, with notable population densities in the Amazon basin.
Araecerini
Araecerini is a tribe of fungus weevils within the family Anthribidae. Members are characterized by their association with fungal resources and distinctive morphological features. The tribe contains multiple genera distributed across tropical and subtropical regions. These beetles are primarily mycophagous, feeding on fungi at various life stages.
Argyrodes
Dewdrop Spiders
Argyrodes is a genus of comb-footed spiders (Theridiidae) commonly known as dewdrop spiders. The genus contains approximately 85 species distributed worldwide, with highest diversity in tropical regions. These spiders are best known for kleptoparasitism—living on the webs of larger orb-weaver spiders and feeding on small prey items that the host ignores. Some species exhibit arachnophagy, preying upon host spiders or their eggs when opportunities arise. The genus exhibits notable sexual dimorphism in cephalothorax structure, with males possessing modified cephalic regions used during copulation.
Ascalaphinae
split-eyed owlflies, owlflies
Ascalaphinae is the type subfamily of the owlfly family Myrmeleontidae (order Neuroptera), distinguished by the diagnostic apomorphy of a ridge dividing each large compound eye—hence 'split-eyed owlflies.' This trait is shared with the subfamily Ululodinae. The subfamily is predominantly tropical in distribution and represents one of two main lineages of living Ascalaphidae, the other being Haplogleniinae with unsplit eyes. The first fossil record dates to the Miocene, suggesting Paleogene origin.
Augochloropsis
metallic sweat bees
Augochloropsis is a genus of metallic sweat bees in the family Halictidae, comprising at least 140 described species. These bees are characterized by brilliant metallic coloration, typically bright green or blue-green, though some species exhibit gold, red, or purple hues. The genus displays remarkable behavioral plasticity, with social organization ranging from solitary to communal, semisocial, and primitively eusocial nesting. Augochloropsis is restricted to the New World, with the majority of species occurring in tropical and subtropical regions and a smaller number extending into temperate North America.
Aulacodes
Aulacodes is a genus of moths in the family Crambidae, first described by Achille Guenée in 1854. The genus comprises approximately 40 described species distributed across tropical and subtropical regions, primarily in the Americas, Africa, and Asia. Species were historically classified in the subfamily Hydrocampinae, though modern Crambidae taxonomy has restructured many of these groups. The genus is distinguished from related crambid genera by specific wing venation patterns and genitalia characteristics, though detailed biological studies of most species remain limited.
Banisia
Banisia is a genus of moths in the family Thyrididae, established by Walker in 1863. The genus is classified within the subfamily Striglininae and contains approximately 12 described species distributed across tropical and subtropical regions. Species within this genus exhibit the characteristic wing patterns and morphology typical of thyridid moths, including intricate reticulate or banded forewing markings. The genus has been documented from Africa, Asia, and Indian Ocean islands including the Seychelles.
Banisia myrsusalis
sapodilla borer, sapota midrib folder
Banisia myrsusalis is a small moth in the family Thyrididae, described by Francis Walker in 1859. It is widely distributed across tropical and subtropical regions including the Americas, Africa, Asia, and Australia. The species is known for its association with sapodilla and related trees, where larvae fold leaf midribs and mine tissues. Adults are distinguished by greyish-brown wings with linear dark striations and yellow costal margins.
Biblidini
Biblidini is a tribe of brush-footed butterflies within the subfamily Biblidinae, commonly known as tropical brushfoots. The tribe contains numerous genera distributed primarily in tropical and subtropical regions of the Americas, with some representatives in the Old World tropics. Members of this tribe are characterized by reduced forelegs typical of the family Nymphalidae, and many species exhibit striking wing patterns with bold colors and distinctive markings.
Buthidae
fat-tailed scorpions, bark scorpions, arrowbreasted scorpions
Buthidae is the largest family of scorpions, containing approximately 100 genera and 1300 species as of 2025. Members are typically mid-sized to small, with weak, slender pedipalps and characteristically thickened tails. The family has a cosmopolitan distribution throughout tropical and subtropical environments worldwide. Buthidae includes nearly all medically significant scorpion species, with venoms containing potent neurotoxins that affect ion channels.
Caccoplectus
Caccoplectus is a genus of myrmecophilous (ant-loving) rove beetles in the family Staphylinidae, subfamily Pselaphinae. The genus was established by Sharp in 1887 and contains approximately nine described species. These beetles are associated with ant colonies, a common ecological strategy among pselaphine beetles. Most species have been described from the Neotropical region, particularly Central America.
myrmecophileant-associatedpselaphinerove-beetleNeotropicalStaphylinidaePselaphinaeArhytodinitropicalant-colony-inhabitantinquilinemicrohabitat-specialistleaf-littersoil-dwellingcrypticrarely-collectedsmall-beetlemorphologically-specialized1887-descriptionSharpCentral-AmericaPanamaColeopteraPolyphagaStaphyliniformiaStaphylinoideaPselaphitaegenus-levelnine-speciesconicusdegallierilucidusnuttingipectinatusschwarzisentisspinipessucineasspine-legged-pselaphidChandlerWoldaSchaeffer190619761986type-species-unknownrarely-observediNaturalist:-2-observationsCatalogue-of-Life-acceptedGBIF-acceptedNCBI-acceptedEukaryotaMetazoaHexapodaInsectaArthropodaAnimaliabeetleinsectarthropodanimalCalliscelio
Calliscelio is a genus of parasitoid wasps in the family Scelionidae, comprising 97 described species worldwide. The genus was erected by Ashmead in 1893. Members are egg parasitoids of crickets (Gryllidae), with at least one species, C. elegans, recognized as a widespread "tramp species" likely dispersed by human commerce.
Calvatomina
Calvatomina is a genus of globular springtails (order Symphypleona) in the family Dicyrtomidae, established by Yosii in 1966. These small hexapods are characterized by their rounded body form and are distributed across tropical and subtropical regions including the Amazon, Andes, Caribbean, and Southeast Asia. The genus belongs to the subfamily Dicyrtominae, a group known for their distinctive body shape and reduced mouthpart structures. Records from iNaturalist indicate active observation and documentation of this genus, with approximately 170 observations contributing to its study.
Camarotini
Camarotini is a tribe of weevils within the family Curculionidae, subfamily Curculioninae. Members of this tribe are characterized by their association with palms (Arecaceae), with larvae typically developing in palm tissues. The tribe contains several genera of economic importance due to their impact on coconut and other palm crops.
Carcharodini
Carcharodini is a tribe of skipper butterflies within the subfamily Pyrginae, comprising approximately 35 genera distributed throughout tropical regions worldwide. The group is considered plesiomorphic and morphologically inconspicuous compared to other Pyrginae tribes. Taxonomic boundaries have been revised based on phylogenetic studies to maintain monophyly, with Carcharodini now treated as distinct from the historically broader Pyrgini. Members occur in both New World and Afrotropical regions, with most genera restricted to the Americas.
Carebara
Marauder Ants, Carebara Thief Ants
Carebara is a large genus of myrmicine ants comprising over 200 species distributed worldwide in tropical and Afrotropical regions. These ants are among the smallest known, with workers often barely visible to the naked eye. The genus exhibits remarkable worker polymorphism, including specialized soldier castes with phragmotic (door-blocking) head shapes in some African species. Queens are notably much larger than workers, creating one of the most extreme size dimorphisms in ants. Many species are cryptic inhabitants of soil and leaf litter, with poorly known biology.
Carventinae
Carventinae is a subfamily of flat bugs (Aradidae) comprising over 364 species across 118 genera. The group is predominantly tropical in distribution and exhibits a strong trend toward flightlessness, with only seven genera retaining large, functional wings. New Zealand hosts eight recognized genera, six of which are endemic to the region.
Chalcedectus
Chalcedectus is a genus of chalcid wasps constituting the sole genus of the monotypic family Chalcedectidae. Formerly classified within the subfamily Cleonyminae of Pteromalidae, molecular phylogenetic studies placed it in a distinct lineage within the 'weird clade' of Chalcidoidea. The genus comprises approximately 20 described species distributed across tropical and subtropical regions. Most species are parasitoids of wood-boring beetles.
Charaxinae
leafwings, leafwing butterflies
Charaxinae is a subfamily of approximately 400 species of nymphalid butterflies commonly known as leafwings. They are primarily tropical in distribution, with some species extending into temperate regions of North America, Europe, China, and southern Australia. Adults are robust, fast-flying butterflies that frequently feed on non-floral liquid sources including carrion, dung, and rotting fruit. The subfamily exhibits substantial morphological diversity across its constituent tribes.
Chloroprocta
Chloroprocta is a genus of blow flies in the family Calliphoridae, subfamily Chrysomyinae. The genus was described by Wulp in 1896. Species in this genus are associated with carrion and decomposing organic matter. The genus contains relatively few described species and is primarily distributed in the Old World tropics and subtropics.
Chonocephalus
Chonocephalus is a genus of scuttle flies in the family Phoridae, first described by Wandolleck in 1898. The genus contains approximately 80 described species distributed across tropical and subtropical regions worldwide. Members are associated with decaying organic matter and some species have documented relationships with army ants (Ecitoninae). The genus is characterized by distinctive morphological features of the head and antennae.
Chrysaster on-canavalia
Chrysaster on-canavalia is a species of lady beetle (family Coccinellidae) in the subfamily Chilocorinae. This species is known from limited documented records, primarily associated with tropical regions. It belongs to a genus characterized by small, often inconspicuous coccinellids that differ in morphology from the more familiar brightly colored lady beetles. The specific epithet references Canavalia, a legume genus, suggesting a potential ecological association.
Coccotrypes distinctus
Coccotrypes distinctus is a species of bark beetle in the family Curculionidae. It has a broad, disjunct distribution spanning tropical and subtropical regions across multiple continents and oceanic islands. The species was described by Wood and Bright in 1992 and has been recorded from Sri Lanka, Pacific Islands from New Guinea to Hawaii, the southern United States, Honduras, Puerto Rico, Jamaica, Suriname, and Guiana. As a member of the genus Coccotrypes, it likely exhibits the typical morphology of small, cylindrical bark beetles adapted for life beneath bark.
Coecobrya
Coecobrya is a genus of springtails (Collembola: Entomobryidae) characterized by pronounced troglomorphic adaptations in cave-dwelling species. The genus includes both surface and subterranean species, with Thai cave species exhibiting the most extreme troglomorphy known for Collembola in Southeast Asia. Many species display elongated antennae, legs and furca, reduced pigmentation, and eye loss. The genus has been recorded from caves in Thailand, South Africa, and other regions, with molecular studies supporting species discrimination using COI, 16S rDNA and 28S rDNA markers.
Coenobitidae
Land Hermit Crabs, Terrestrial Hermit Crabs
Coenobitidae is the family of terrestrial hermit crabs, comprising approximately 17-18 species in two genera. Adults are fully terrestrial but depend on marine environments for reproduction. Females return to the ocean to release eggs; larvae develop through planktonic zoeal stages before settling. Juveniles acquire empty gastropod shells and migrate to land, where they continue development. The family is distributed throughout coastal tropical regions worldwide.
Collomeninae
Collomeninae is a subfamily of moths within the family Nolidae, established in 2012 by Zahiri, Lafontaine, and Schmidt. The subfamily comprises approximately ten genera distributed primarily in tropical regions of South America and Southeast Asia. The type genus is Collomena. The subfamily is distinguished from other Nolidae by a combination of morphological characters related to wing venation and genitalia structure.
Colobopsis obliqua
Oblique Gate-keeper Ant
Colobopsis obliqua is a species of ant in the subfamily Formicinae, first described by Smith in 1930. It belongs to a genus known for specialized defensive behaviors, including the 'exploding ant' phenomenon where minor workers rupture their bodies to release toxic secretions. The species is commonly referred to as the 'Oblique Gate-keeper Ant' due to the characteristic head shape of major workers used to block nest entrances.
Corethrellidae
frog-biting midges
Corethrellidae are a family of tiny hematophagous flies in the order Diptera. The family contains a single genus, Corethrella, with approximately 105 extant and seven fossil species worldwide. Females are obligate external parasites of frogs, locating hosts by eavesdropping on male anuran mating calls using their Johnston's organ. The family has a fossil record extending to the Lower Cretaceous, approximately 110 million years ago.
Cryphalus mangiferae
mango bark beetle
A tiny tropical bark beetle in the weevil family Curculionidae (subfamily Scolytinae) that attacks mango trees (Mangifera indica). Native to southern Asia, it has spread to tropical regions worldwide and is recognized as a vector of plant-pathogenic fungi causing mango wilt disease. In Pakistan and other regions, it poses a serious threat to mango cultivation.
Cryptochetidae
Cryptochetidae is a small family of minute flies (2–4 mm) in the order Diptera. Adults are typically metallic blue-black with a stout build, broad high head, and clear wings. The family is distinguished by reduced or absent aristae on the antennae, a trait reflected in its name meaning 'hidden bristles'. Larvae are endoparasitoids of scale insects (Coccidae), with some species used in biological control. Approximately 20–30 species are known across three genera, primarily distributed in tropical regions.
Cryptognatha
Cryptognatha is a genus of lady beetles (family Coccinellidae) established by Mulsant in 1850. The genus contains at least 40 described species, with members distributed across tropical and subtropical regions. At least one species, Cryptognatha nodiceps, has been studied as a potential biological control agent against scale insects.
Ctenodactylomyia watsoni
Sea Grape Gall Midge
Ctenodactylomyia watsoni is a gall midge species in the family Cecidomyiidae, commonly known as the Sea Grape Gall Midge. It induces galls on sea grape (Coccoloba uvifera), a coastal shrub native to tropical and subtropical regions of the Americas. The species is well-documented through iNaturalist observations, with over 790 records, indicating it is relatively common and readily observed by naturalists in its range. As a gall-forming insect, it manipulates host plant tissue to create protected structures for larval development.
Ctenotrachelus shermani
Ctenotrachelus shermani is a species of assassin bug in the family Reduviidae, subfamily Stenopodainae. It is a predatory true bug found across a broad geographic range spanning the Caribbean, North America, and South America. The species was described by Barber in 1929. Observations suggest it is established and active in tropical and subtropical regions.
Cubaris murina
little sea isopod, little sea roly poly, little sea pillbug, little sea pill woodlouse
Cubaris murina is a small terrestrial isopod (woodlouse) in the family Armadillidae, notable for its ability to conglobate—roll into a complete ball when disturbed. The species reaches approximately 11 mm in length and 5 mm in width. It has a remarkably broad geographic distribution spanning tropical and subtropical regions across multiple continents, with populations in the Caribbean, South America, Southeast Asia, and the Pacific. The species has become popular in the exotic pet trade due to its bioactive utility in terrariums and the development of several color morphs through selective breeding.
Cyladini
Cyladini is a tribe of weevils in the family Brentidae, subfamily Apioninae. The tribe includes economically significant pests of sweet potato, particularly the sweetpotato weevil (Cylas formicarius), which causes substantial damage to storage roots in tropical and subtropical production regions. Members of this tribe are characterized by their association with Convolvulaceae host plants and their status as specialized root-feeding pests.
pestagriculturesweet-potatoConvolvulaceaeintegrated-pest-managementCylas-formicariustropical-agriculturesubtropical-agricultureroot-feeding-weevilstorage-root-damageeconomic-pestbiological-controlcrop-protectionsoutheastern-United-Statesglobal-food-securitylow-input-farmingdrought-tolerant-cropnematode-interactionsBeauveria-bassianaentomopathogenic-nematodesresistant-varietiescrop-rotationcover-cropsIPMBrentidaeApioninaeColeopteraInsectaHexapodaArthropodaAnimaliaClaire-SchloemerAuburn-UniversityUniversity-of-Wisconsin-MadisonJournal-of-Integrated-Pest-ManagementScott-GrahamKathy-LawrenceCovingtonBonitaBeauregardOrleansguava-root-knot-nematoderoot-knot-nematodewirewormcucumber-beetleflea-beetlePurpureocillium-lilacinumbiopesticidegreen-bridge-effectmustardglucosinolatepeanutbahiagrasssandy-soildrought-adaptationbiofuelanimal-feednutritional-valuefood-securitysustainable-agricultureenvironmental-impactmicrobial-controlfungal-pathogenentomopathogenic-fungusbiological-nematicidenematode-egg-parasitismpest-managementagricultural-entomologycrop-lossyield-reductionroot-qualitymarketabilityintegrated-managementcultural-controlselective-chemical-useproductivitynatural-processesversatilityglobal-cultivationtropical-regionssubtropical-regionssoutheastern-U.S.domestic-productionrevenueacreageharvestfarminggrowerbreedingresearchcultivar-developmentevolving-threatspest-pressuresoil-healthfield-preparationwinter-habitatinsect-habitatparasitisminfestationdamagelosschallengedefensearsenalbattlewarresilienceadaptationinnovationstrategysustainabilitylivelihoodnourishmentfood-productionagricultural-researchentomologyplant-protectioncrop-sciencehorticultureroot-croptuberstorage-organfeeding-injurygallingcracked-rootsstunted-growthwater-uptakenutrient-uptakepathogen-interactionexacerbated-damagevariety-selectionhardy-varietyrobust-performancehigh-yieldnematode-resistancepest-resistancevulnerabilityspreading-pestpopulation-reductionsoil-improvementspring-plantingtoxic-compoundnatural-propertymicrobial-productformulationapplicationevaluationmaximizationpotentialurgencygrowing-threatcomprehensive-strategybalanceenablementessential-cropsecuritydefiancedifficult-conditionsmenacing-pestsformidable-threatsproduction-continuationface-to-facethreatdiseaseresilient-cropgrowing-conditionsmenacestorysurfacebeneathrelentlessadversaryfavorconditionpowerfulfoetinyparasiteattackformationdiminishabilityresultunattractiveworsematterinteractionsignificantdevastatingruininflictfurthercompromisegrapplethankfullyfarmerbeginselecthardywithstandtraditionalgaintractionvulnerablehighlightneedcontinuebreedeffortdevelopcapableopposeevolveaftersturdyculturalmanagementrotationcovercroppinglinetakeyearoffgrowrotatenon-hostproveeffectivereducepopulationbreathelifeimprovehealthsuppressprepareexamplecontaincompoundcallbreakdownreleasesubstancewaryproviderepresentmethodharnesshelpwinsporefungusinfectkilltypetapdifferentmicroscopicanimalparasitizeplususecombatattentioneggaidfightminimizeimpactdespiteadvancequestionremainrequiremaximizeparticularlyurgentposekeyenhanceapproachintegratepracticecontrolselectivechemicalenablenaturalprocessnutritionalvalueessentialcropglobalfoodregionsupportmillionaddresspressureinnovativesustainableensurelivemanyformidableproductionalthoughcomefaceresilientabledefydifficultreadmorejournalintegratedClaireSchloemerPh.D.studentconductearnmasterdegreeemailsharelinkfriendopennewwindowprintFacebookLinkedInBlueskyMastodonXRedditThreadsrelateddiscoverfromtodaysubscribegetlatestpostsendyourCylasformicariussweetpotatosweetpotatoweevilphotocourtesyshowherecucumberbeetleroot-knotnematodeharmU.S.guidedetailvarietyoptionbeloveddelicioustastebenefitbrightcolorrankseventhmostimportantworldtropicalsubtropicalareaaroundservefeedsourcegoodpicklow-inputstylewelladaptedsandysoildroughtUnitedStates2022over130,000acregeneratenearly600southeasternleaddomesticAuburnUniversityweatherarticlepublishMarchcolleagueScottGrahamKathyLawrencevariousamongplant-parasiticspecificallyrootsystemcausegallplantwaternutrientstuntedgrowthyieldcrackmakeinteractpathogenexacerbateinsectknowstorage7annualsouthernfleaqualityleaveeconomicownresistancebettermeanwhilenewerhighrobustperformancehoweverresistguavaspeciesspreadnextseasonwinterfieldspringtoxicgreenbridgeeffecthabitatfeedersymptominfectionbiologicalpropertymicrobeBeauveriabassianaagentformulateenvironmentallyfriendlyproducteasyapplysimilarlybeneficialentomopathogenicnematicidePurpureocilliumlilacinumsolutionenvironmentalresistantnematode-resistantcultivarcomprehensivecultivationWisconsin-MadisoncschloemerwisceduCyrestinae
Daggerwing and Map Butterflies
Cyrestinae is a small subfamily of brush-footed butterflies (Nymphalidae) comprising three genera: Cyrestis, Chersonesia, and Marpesia. The subfamily was established after taxonomic revision split the former Cyrestini and Pseudergolini tribes, which were briefly combined before being recognized as separate subfamilies. Cyrestinae is now considered the sister group to the larger Nymphalinae subfamily. The group exhibits a disjunct tropical distribution, with Marpesia restricted to the Neotropics and Cyrestis and Chersonesia occurring primarily in the Oriental region with some Afrotropical representation.
Deinopidae
Net-casting Spiders, Ogre-faced Spiders
Deinopidae is a family of cribellate spiders known for their distinctive net-casting hunting strategy. They construct small rectangular capture webs held between their elongated front legs, which they stretch to two or three times their relaxed size before propelling themselves forward to entangle prey. The family includes three genera: Deinopis and Asianopis (ogre-faced spiders with enlarged posterior median eyes for night vision), and Menneus (humped-back spiders lacking enlarged eyes). These spiders are sit-and-wait predators with excellent night vision, hunting primarily after dark while resting cryptically during daylight hours.
Deinopis
net-casting spiders, gladiator spiders, ogre-faced spiders, American Ogre-faced Spiders
Deinopis is a genus of net-casting spiders characterized by their distinctive hunting strategy of throwing a rectangular cribellate web at prey. The genus is distinguished by enlarged posterior median eyes that are among the most light-sensitive of any animal, enabling nocturnal hunting. These spiders exhibit specialized sensory adaptations including the use of trichobothria and slit sensillae on their legs to detect prey vibrations and sounds. The genus has a tropical and subtropical distribution with a complex biogeographic history involving Gondwanan origins and subsequent dispersal events.
Derbidae
Derbid Planthoppers, Derbids
Derbidae is a large and diverse family of planthoppers within the superfamily Fulgoroidea, comprising over 1,700 described species in 166 genera. Adults are small sap-sucking insects typically 5–10 mm in length, with highly variable morphology across subfamilies and tribes. The family exhibits striking diversity in wing shape, head structure, and antennae form. Nymphs develop in decaying organic matter, particularly under bark of dead trees and in palm debris, where they feed on fungi—an unusual life history trait among planthoppers. Several species are economically significant as suspected vectors of phytoplasma diseases affecting palms, including lethal yellowing and related syndromes, though clear evidence of transmission remains limited.
Desmia ploralis
mournful desmia moth
Desmia ploralis, commonly known as the mournful desmia moth, is a species of snout moth in the family Crambidae. It was first described by French entomologist Achille Guenée in 1854. The species is distributed across tropical and subtropical regions of the Americas, including parts of Central America, South America, the Caribbean, and the southern United States. Like other members of the genus Desmia, it is likely associated with host plants in the grape family (Vitaceae), though specific host records for this species are limited.
Dichomeris acuminatus
Alfalfa Leaf Tier, Alfalfa Leaftier Moth
Dichomeris acuminatus is a small moth in the family Gelechiidae, commonly known as the alfalfa leaf tier. It has an exceptionally broad distribution spanning multiple continents including Africa, Asia, Australia, Europe, and the Americas. The species was first described by Otto Staudinger in 1876. Despite its common name suggesting association with alfalfa, the species appears to be a generalist with a wide ecological tolerance given its cosmopolitan range.
Diclidophlebia
Diclidophlebia is a pantropical genus of psyllids (jumping plant-lice) established by Crawford in 1920. The genus contains approximately 25 described species distributed across the Americas, Africa, Asia, and Australia. Multiple species are documented crop and forestry pests, with known associations to hosts in Melastomataceae, Sterculiaceae, Irvingiaceae, and other plant families. Some species have been investigated as potential biological control agents for invasive plants.
Dictis striatipes
Striped Spitting Spider
Dictis striatipes is a spitting spider in the family Scytodidae, known for the common name "Striped Spitting Spider." The species has been introduced to regions outside its native range, including Hawaii, Mexico, and Yemen. As a member of Scytodidae, it possesses the characteristic spitting ability that defines this family—immobilizing prey by ejecting a mixture of silk, venom, and adhesive from the chelicerae. It is a synanthropic species often found in human-modified environments.
Dioprosopa
drone flies
Dioprosopa is a genus of hoverflies (family Syrphidae) in the tribe Syrphini, containing two described species found in the New World. The genus was elevated from subgenus rank in 2018 based on phylogenetic studies. Both species occur in tropical and subtropical regions of the Americas, where they contribute to ecosystem services through adult pollination and larval predation on agricultural pests.
Diphleps
jumping tree bugs
Diphleps is a genus of jumping tree bugs in the family Miridae, established by Bergroth in 1924. The genus contains five described species distributed in the New World tropics. Species in this genus are arboreal and possess enlarged hind femora adapted for jumping. The genus is relatively poorly studied compared to other mirid genera.
Diphthera festiva
Hieroglyphic Moth
Diphthera festiva, commonly known as the Hieroglyphic Moth, is a distinctive moth species in the family Erebidae. It is the sole member of its genus Diphthera within the subfamily Calpinae. The species exhibits a wide tropical and subtropical distribution across the Americas, with occasional northern strays extending its recorded range. Its common name derives from the striking wing patterns that resemble hieroglyphic inscriptions.
Dirhininae
Dirhininae is a subfamily of chalcidid wasps established by Ashmead in 1904, containing four genera and over 100 species, many of which remain undescribed. Members of the tribe Dirhinini are distinguished by a pair of prominent head horns and are primarily distributed in tropical regions. These wasps are parasitoids that develop within various Brachycera flies, with the adult wasp using its horns, mandibles, and robust body to forcefully emerge from the host.
Ditemnus freemani
Pale-sutured Tropical Soldier Beetle
Ditemnus freemani is a species of soldier beetle in the family Cantharidae. The common name "Pale-sutured Tropical Soldier Beetle" refers to a distinctive pale line along the elytral suture. Like other cantharids, it has soft, flexible elytra. The species is known from a limited number of observations, primarily in tropical regions.
Dolichognatha
Dolichognatha is a genus of long-jawed orb-weaving spiders in the family Tetragnathidae, distributed across tropical and subtropical regions worldwide. The genus was established by Octavius Pickard-Cambridge in 1869 and has undergone several taxonomic revisions, having been placed in Archaeidae, then Araneidae, before its current placement in Tetragnathidae. It contains 32 recognized species found across Africa, Asia, the Americas, and the Pacific.
Drapetes niger
Tropical Black Click Beetle
Drapetes niger, known as the Tropical Black Click Beetle, is a species of click beetle in the family Elateridae. The genus Drapetes belongs to a diverse family characterized by the ability to produce an audible clicking sound using a prosternal process that engages with a mesosternal groove. As of current records, this species has been documented in 8 observations on iNaturalist, indicating it is rarely encountered or poorly surveyed.
Dryophthorinae
Dryophthorinae is a subfamily of weevils (Curculionidae) comprising approximately 1,200 species in 153 genera and ten tribes. The subfamily includes numerous economically significant agricultural pests, particularly of palms, bananas, rice, maize, sugarcane, and bromeliads. Many species are distributed in tropical and subtropical regions worldwide, with several having achieved global distributions through international trade in ornamental and agricultural plants. The taxonomic status of Dryophthorinae remains contested; while traditionally treated as a subfamily, at least one major revision has elevated it to family rank as Dryophthoridae.
Dynamine dyonis
blue-eyed sailor
Dynamine dyonis, commonly known as the blue-eyed sailor, is a species of tropical brush-footed butterfly in the family Nymphalidae. It was described by Hübner in 1837. The species is found in North America and has been assigned the MONA/Hodges number 4534.
Ectatomminae
Ectaheteromorph Ants
Ectatomminae is a subfamily of ants established in 2003 when Barry Bolton divided the former Ponerinae into six subfamilies. It currently comprises two tribes (Ectatommini and Heteroponerini) with approximately 13 extant genera and three extinct genera. The subfamily was further consolidated in 2022 when Heteroponerinae was merged into Ectatomminae, and this taxonomic position was upheld by genomic reanalysis in 2024. Members are primarily distributed in tropical and subtropical regions, particularly in the Neotropics.
Emesopsis
Emesopsis is a genus of small tropical assassin bugs (family Reduviidae, subfamily Emesinae) containing at least 22 described species. Most species are restricted to tropical Asia and Australia, with E. nubila being the only pantropical species, also occurring in southern Europe. These bugs are characterized by their unusual locomotion using middle and hind legs while the raptorial front legs are reserved for prey capture. They are generalist predators of various small insects.
Emmelina buscki
Tropical Morning Glory Plume Moth
Emmelina buscki is a plume moth in the family Pterophoridae, first described by Barnes and Lindsey in 1921. It is known from North America (Florida, Mexico), Central America, and northern South America. The species has a wingspan of 20–23 mm and exhibits distinct tawny or brownish white coloration with characteristic wing markings. Larvae are specialized feeders on Ipomoea indica, skeletonizing young leaves of this host plant.
Epichrysomallidae
Epichrysomallidae is a family of minute gall-forming wasps in the superfamily Chalcidoidea. Formerly classified as a subfamily of Pteromalidae, it was elevated to family rank based on molecular phylogenetic evidence showing closer relationships to other gall-forming chalcid wasps. Members are obligate associates of fig trees (Ficus), inducing galls in figs, on leaves, or on twigs. The family contains approximately 20 described genera distributed across tropical and subtropical regions.
Epipsocidae
Elliptical Barklice
Epipsocidae is a family of barklice (Psocodea: Psocomorpha) comprising 16 genera and over 140 species. The family is primarily tropical in distribution, with the notable exception of the European endemic Bertkauia lucifuga, which is almost always apterous. Epipsocids share diagnostic morphological features with other members of the infraorder Epipsocetae, including a labrum with two sclerotized ridges and a hairy ventral surface of the forewing.
Erastria
Erastria is a genus of geometrid moths erected by Jacob Hübner in 1813. The genus contains approximately 30 described species distributed primarily in tropical and subtropical regions of Africa and Asia. Adults are characterized by distinctive morphological features including upturned palpi, minutely ciliated antennae in males, and abdominal dorsal tufts. Larvae possess four pairs of abdominal prolegs, consistent with the family Geometridae.
Erginulus subserialis
Erginulus subserialis is a harvestman (order Opiliones) in the family Cosmetidae, originally described by Pickard-Cambridge in 1905. The species belongs to the subfamily Metergininae, a group of tropical harvestmen characterized by often ornate dorsal ornamentation. It is one of several species in the genus Erginulus, which is distributed across Central and South America. The species has been documented through iNaturalist observations, indicating ongoing contemporary study.
Erosia incendiata
Erosia incendiata is a moth species in the family Uraniidae, first described by Guenée in 1857. It has been treated under both the genus Erosia and Epiplema, reflecting historical taxonomic uncertainty. The species is part of a small family of moths that includes both day-flying and nocturnal species, some with distinctive wing shapes. Observations on iNaturalist suggest it occurs in tropical regions, though detailed biological information remains limited.
Eublemma
Eublemma is a genus of small moths in the family Erebidae, containing over 400 species distributed across tropical and subtropical regions worldwide. The genus was described by Jacob Hübner in 1829 and has undergone taxonomic revision, previously placed in Noctuidae or as the type genus of subfamily Eublemminae. Several species are economically significant as predators of scale insects, particularly E. amabilis, which attacks lac insects (Kerria spp.) and has been investigated as a biological control agent.
Eublemma cinnamomea
Eublemma cinnamomea is a small moth in the family Erebidae, first described in 1868. It has a wingspan of approximately 17 mm. The species is widespread across the New World tropics, ranging from the southern United States through Central America to Argentina.
Eudocima
Fruit-piercing Moths
Eudocima is a genus of moths in the family Erebidae, established by Gustaf Johan Billberg in 1820. The genus contains numerous tropical species and is notable for the fruit-piercing behavior of its adults, which use their specialized mouthparts to puncture fruit and feed on juices. This feeding habit has made several species significant agricultural pests. The genus has undergone taxonomic revisions, with species historically placed in various other genera.
Eumastacidae
Monkey Grasshoppers, Matchstick Grasshoppers
Eumastacidae is a family of grasshoppers commonly known as monkey grasshoppers or matchstick grasshoppers. They are considered primitive within the Orthoptera and are characterized by their distinctive body posture with thin legs held at right angles to the body, often near the horizontal plane. Many species are wingless. The family exhibits its greatest diversity in the Neotropics, with most species inhabiting tropical regions. They feed on algae, ferns, and gymnosperms—ancient plant groups that reflect their primitive evolutionary status.
Eupariini
eupariine dung beetles, small dung beetles
Eupariini is a diverse tribe of small dung beetles in the subfamily Aphodiinae (Scarabaeidae). The tribe comprises over 40 genera and approximately 640 described species globally, with exceptional diversity in the Neotropics where around 28 genera and 333 species occur. Members are smaller than their sister lineage Scarabaeinae. The tribe has a broad geographic distribution spanning the Australian, Oriental, and Neotropical zoogeographical regions, with fossil representatives known from Eocene Baltic amber.
Euphthiracaroidea
Euphthiracaroidea is a superfamily of oribatid mites within the infraorder Mixonomata, established by Jacot in 1930. It comprises several families including Euphthiracaridae, Synichotritiidae, and Oribotritiidae. Members of this group are primarily known from leaf litter habitats in tropical and subtropical regions, with documented diversity in Southeast Asia including Thailand.
Eupyrrhoglossum sagra
Cuban Sphinx
Eupyrrhoglossum sagra is a medium-sized sphinx moth (Sphingidae) native to tropical and subtropical lowlands of the Caribbean and Central and South America. Adults have a wingspan of 51–53 mm and display distinctive wing patterning including a semi-transparent submarginal spot on the forewing and a median yellow band on the hindwing. The species was first described by Felipe Poey in 1832 based on Cuban specimens. Larvae feed on Rubiaceae species, with documented hosts including Guettarda and Chomelia.
Eurema albula
Ghost Yellow
Eurema albula, commonly known as the ghost yellow, is a small butterfly in the family Pieridae. It ranges from southern Texas through the West Indies and tropical Central and South America to Brazil. Adults are active year-round in tropical regions and feed on flower nectar. The species inhabits tropical forests and second-growth vegetation.
Eustrotiini
Eustrotiini moths
Eustrotiini is a tribe of moths in the subfamily Boletobiinae, family Erebidae. Members are small to medium-sized noctuoid moths with generally dull coloration. The tribe is primarily distributed in tropical and subtropical regions, with greatest diversity in the Old World tropics. Many species exhibit cryptic forewing patterns that provide camouflage against bark or leaf litter.
Euxestidae
Euxestidae is a small family of beetles in the superfamily Coccinelloidea, containing approximately 70 extant species across 10 genera. Formerly treated as a subfamily of Cerylonidae, they were elevated to family status based on morphological and phylogenetic evidence. Members are primarily tropical and subtropical in distribution, with most species occurring in the Afro-Eurasian region. They inhabit concealed microhabitats including decomposing wood, leaf litter, and the nests of social insects.
Exelastis pumilio
Dwarf Plume Moth
A small plume moth with a wingspan of 12–15 mm, found throughout tropical regions worldwide. Adults are recorded on wing in March, April, and June. The genus Hepalastis is treated as a synonym of Exelastis.
Flatinae
Flatinae is a subfamily of planthoppers within the family Flatidae, erected by Maximilian Spinola in 1839. Adults are distinguished by bodies that are flattened laterally and tegmina held in a tent-like posture, unlike the related Flatoidinae. The subfamily is cosmopolitan in tropical and subtropical regions, with records from all continents except Antarctica.
Flatoides
Flatoides is a genus of planthoppers in the family Flatidae, subfamily Flatoidinae. Members of this genus are characterized by their flattened, often broad body shape typical of flatid planthoppers. The genus was established by Félix Édouard Guérin-Méneville in 1844. Species within Flatoides are distributed primarily in tropical and subtropical regions, particularly in the Old World tropics including parts of Africa, Asia, and associated islands. Like other flatids, they are sap-feeding insects that inhabit vegetation where they feed on plant phloem.
Fulgoridae
lanternflies, lanthorn flies
Fulgoridae is a large family of planthoppers within the order Hemiptera, containing over 125 genera worldwide with exceptional diversity in tropical regions. Members range from moderate to large size and often exhibit brilliant, varied coloration that superficially resembles Lepidoptera. The family is commonly known as "lanternflies," a name derived from the historical misconception that the elongated head processes of some species could produce light. These insects possess piercing-sucking mouthparts adapted for feeding on plant phloem sap.
Gabunillo
Gabunillo is a genus of small, eyeless, pigmentless woodlice in the family Armadillidae. Described in 1983 from Gabon, it now includes four species found in Gabon, Brazil, and São Tomé. Members of this genus are characterized by their ability to fully conglobate (roll into a ball), complete absence of eyes, and lack of pseudotracheae. The genus is distinguished from the similar Synarmadillo by cephalon structure, telson shape, and the absence of ventral teeth on thoracic segments.
Garriscaphus
Garriscaphus is a genus of soil-dwelling centipedes in the family Himantariidae, established by Chamberlin in 1941. Members of this genus belong to the order Geophilomorpha, characterized by elongated bodies with numerous leg pairs. The genus is part of a family distributed primarily in tropical and subtropical regions. Specific details about the biology and ecology of Garriscaphus remain poorly documented in published literature.
Garypus
Garypus is a genus of pseudoscorpions in the family Garypidae, comprising at least 20 described species. These arachnids are primarily restricted to seashore habitats, occupying supralittoral and littoral zones in tropical and subtropical regions. The genus was established by Ludwig Carl Christian Koch in 1873 and shows highest diversity in the Indo-West Pacific region. Species-level taxonomy remains incompletely resolved, with many species known from single localities.
Gecarcinidae
land crabs
Gecarcinidae is a family of true crabs (Brachyura) adapted for terrestrial existence, commonly known as land crabs. Members possess modified gill chambers called branchiostegal lungs that allow aerial respiration. Adults are primarily terrestrial but require marine environments for reproduction; larvae develop in seawater. The family includes approximately eight genera distributed across tropical regions worldwide.
Glutophrissa drusilla
Florida White, tropical white
Glutophrissa drusilla is a pierid butterfly known as the Florida White or tropical white. It occurs from tropical America northward to southern Florida and the Florida Keys, with occasional records as far north as Nebraska and Colorado. The species is associated with tropical lowland forests and is the only representative of its genus in North America. It is frequently observed in coastal Texas and has been recorded from multiple localities in Colombia.
Goniotropis
Goniotropis is a genus of ground beetles in the family Carabidae, subfamily Paussinae, containing at least 40 described species. Adults are large, parallel-sided beetles found in the New World tropics. Larvae are burrow-dwelling predators with a distinctive terminal disk composed of modified urogomphi and dorsal plates. The genus ranges from southern Arizona to northern Argentina.
Gryllodes
decorated crickets, tropical house crickets
Gryllodes is a genus of crickets in the family Gryllidae, tribe Modicogryllini. The genus contains at least three described species, with Gryllodes sigillatus being the most widely known and economically significant. This species, commonly called the tropical house cricket or decorated cricket, has a cosmopolitan distribution associated with human habitation and is extensively cultured for pet food and human consumption. The genus is notable for its specialized mating behavior involving nuptial gifts.
Halocoryza
Halocoryza is a genus of small, intertidal ground beetles (Carabidae) restricted to tropical and subtropical coastal habitats. The genus comprises four described species distributed across shorelines of the Atlantic, Pacific, and Indian Oceans, including Caribbean islands and the Gulf of Mexico. All species are nocturnal predators associated with sandy or coralline substrates near mangroves, coral reefs, or seaweed accumulations. The genus is characterized by reduced flight capability, slow running speed, and adaptations for burrowing in coastal sediments.
Heliconiinae
longwings, heliconians, fritillaries and longwings
Heliconiinae is a subfamily of brush-footed butterflies (Nymphalidae) comprising 45–50 genera, commonly known as longwings or heliconians. Members are distinguished by elongated forewings and predominantly reddish-black coloration. They are notable among butterflies for actively consuming pollen, which extends adult longevity. The subfamily exhibits complex coevolutionary relationships with Passifloraceae host plants and serves as a classic model for studies of Müllerian and Batesian mimicry.
Heliopetes macaira
Turk's-cap White-Skipper
Heliopetes macaira is a small skipper butterfly in the family Hesperiidae, ranging from southern Texas through Central America to Paraguay. It is closely associated with Turk's-cap (Malvaviscus drummondii), which serves as its larval host plant. Adults are active from spring through late autumn in the northern part of its range, with multiple generations produced annually.
Hemipepsis
tarantula hawks, Old and New World Tarantula-hawk Wasps
Hemipepsis is a genus of large spider wasps in the family Pompilidae, commonly known as tarantula hawks. The genus contains approximately 180 species distributed throughout tropical and subtropical regions worldwide, with significant diversity in Africa, Asia, and the Americas. Hemipepsis wasps are distinguished from the related genus Pepsis by subtle differences in wing venation patterns. In South Africa, Hemipepsis wasps serve as exclusive pollinators for 18 plant species across three families (Apocynaceae, Orchidaceae, and Asparagaceae subfamily Scilloodeae). The genus has been extensively studied for its complex male territorial behavior, particularly in the North American species H. ustulata.
Hemipsocus africanus
Hemipsocus africanus is a species of barklouse in the family Hemipsocidae, first described by Enderlein in 1907. It belongs to the order Psocodea, which encompasses both barklice and true lice. The species has been documented across a broad geographic range spanning sub-Saharan Africa, parts of Central America, and several island systems including the Krakatau Islands and Seychelles. Its wide distribution suggests either natural dispersal capabilities or human-mediated transport, though specific mechanisms remain undocumented.
Heteropogon
tanglehead
Heteropogon is a genus of tussock grasses in the family Poaceae, commonly known as tangleheads. The genus is widespread primarily in tropical and subtropical regions, with species occurring in Australia, Africa, Asia, and the Americas. Heteropogon contortus, the most studied species, is a perennial grass significant in pastoral agriculture, particularly in Australian rangelands. The genus exhibits considerable phenotypic plasticity, with documented variation in flowering time, ploidy levels, and growth habit across its range.
Hieroxestinae
Hieroxestinae is a subfamily of moths within the family Tineidae, comprising approximately 275 valid species across six genera. The group shows notable biogeographic patterns, with significant radiations of Opogona and Amphixystis on Indian Ocean islands and a distinct radiation of Opogona on St Helena in the South Atlantic. The subfamily is predominantly tropical in distribution and depauperate in the Americas.
Hodebertia testalis
Incolorous Pearl
Hodebertia testalis, known as the Incolorous Pearl, is a small crambid moth found primarily in tropical regions with occasional vagrant records reaching parts of Europe. It is the sole species in its genus, making Hodebertia monotypic. The species was first described by Fabricius in 1794 and has undergone taxonomic reclassification, with some sources placing it in the genus Pyrausta.
Hyblaeoidea
Teak Moths
Hyblaeoidea is a small superfamily of moths in the order Lepidoptera, containing a single family Hyblaeidae with two genera (Hyblaea and Erythrochrus) and approximately 20 species. The superfamily has an uncertain phylogenetic position within the group Obtectomera, sometimes placed near Pyraloidea. Members are distributed in tropical and subtropical regions worldwide. The genus Hyblaea includes significant forest pests, notably Hyblaea puera, the teak defoliator.
Hyboptera auxiliadora
Auxiliadora's humped-wing carabid beetle
Hyboptera auxiliadora is a species of ground beetle described by Erwin in 2004. It belongs to the genus Hyboptera, which is characterized by humped-wing morphology. The species occurs in Central America and parts of North America, with confirmed records from Colombia, Costa Rica, Honduras, Mexico, and Panama. It is a member of the subfamily Lebiinae within the family Carabidae.
Hybosoridae
scavenger scarab beetles, scavenger and pill scarab beetles
Hybosoridae is a family of scarabaeiform beetles comprising over 600 species in 78 extant genera. Members are small (5–7 mm), oval beetles with distinctive antennae bearing a deeply grooved 8th antennomere that houses the 9th and 10th segments. The family was historically recognized as distinct based on unique larval characteristics, particularly the stridulatory behavior of rubbing front legs against the epipharynx margin. Formerly, the family Ceratocanthidae was merged into Hybosoridae, expanding its constituency.
Hydrobiomorpha
Hydrobiomorpha is a genus of water scavenger beetles in the family Hydrophilidae, established by Blackburn in 1888. The genus contains 56 extant described species distributed across tropical and subtropical regions, with additional fossil species known from the Cenozoic. Members are aquatic beetles associated with freshwater habitats.
Hypothenemus
Hypothenemus is a genus of bark beetles in the family Curculionidae containing more than 200 described species. The genus is most diverse in tropical and subtropical regions worldwide, with reduced representation in temperate areas of eastern North America and eastern Asia. Members are minute beetles, ranging from 0.6 mm to 2.2 mm in length, with males consistently smaller than females. The genus includes several economically significant species, most notably H. hampei (coffee berry borer), which is considered the most destructive insect pest of coffee globally.
Jacobsoniidae
Jacobson's beetles
Jacobsoniidae is a small family of minute beetles within the superfamily Staphylinoidea, comprising three extant genera (Derolathrus, Sarothrias, Saphophagus) and approximately 28 described species. Adults and larvae inhabit cryptic microhabitats including leaf litter, rotting wood, fungal fruiting bodies, bat guano, and caves. The family exhibits remarkable morphological stasis since the Cretaceous, with fossil records from Cretaceous amber of Myanmar and France, Eocene Baltic amber, and Holocene copal. Members are among the smallest beetles, measuring 0.7–2.1 mm, and are exceptionally rare in collections.
Larra
Mole Cricket Hunters
Larra is a genus of parasitoid wasps in the family Crabronidae, commonly known as mole cricket hunters. These wasps are distributed throughout tropical regions worldwide and have gained prominence as biological control agents for mole cricket pests. The genus was established by Fabricius in 1793 and belongs to the subfamily Crabroninae within the tribe Larrini.
Lascoria orneodalis
Enigmatic Owlet
Lascoria orneodalis is a litter moth in the family Erebidae, subfamily Herminiinae. It occurs in tropical and subtropical regions of the Americas. The species is known to feed on Lycopersicon (nightshades) during its larval stage. It has been documented across North America and Caribbean regions including Jamaica.
Lathrotelinae
Spotted-costa Crambid Snout Moths
Lathrotelinae is a small subfamily of crambid moths comprising approximately 54 species in six genera, distributed mainly in tropical regions. The subfamily was established by Clarke in 1971 but remained classified within Spilomelinae until phylogenetic studies in the mid-2010s demonstrated its distinctiveness. Larvae are root-feeders on monocotyledonous plants, with some species causing economic damage to cultivated palms and sugarcane.
Lepadidae
Goose Barnacles
A family of pedunculate (stalked) barnacles established by Charles Darwin in 1852, commonly known as goose barnacles. Comprises approximately five genera and over 20 described species. Members are exclusively marine, with worldwide distribution in warm temperate and tropical seas. The family includes the well-known genus Lepas (goose barnacles) and Conchoderma (whale barnacles).
Leptocircini
Kite Swallowtails, Swordtails, and Jays
Leptocircini is a tribe of swallowtail butterflies (family Papilionidae) comprising approximately 162 species across nine genera. The group includes the kite swallowtails (Eurytides), swordtails (Graphium), and dragontails (Lamproptera). This tribe represents roughly 25% of global swallowtail diversity and is distributed throughout the tropics of Africa, Southeast Asia, and the Americas. Recent phylogenomic studies have clarified previously unresolved relationships within the tribe, leading to significant taxonomic revisions including the synonymization of several genera and subgenera.
Leptogenys
Razorjaw Ants
Leptogenys is the most diverse genus in the ant subfamily Ponerinae, with over 260 described species distributed throughout tropical and subtropical regions worldwide. The genus exhibits remarkable morphological and behavioral diversity, ranging from large-eyed epigaeic species that forage above ground to small-eyed cryptobiotic species inhabiting soil and leaf litter. Many species possess distinctive falcate, bowed mandibles and specialize on isopod prey. Most species have ergatoid (worker-like) queens rather than typical winged queens.
Leptoglossus
leaf-footed bugs
Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.
Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteranLeptotes cassius
Cassius blue, tropical striped blue
Leptotes cassius is a small, strikingly blue butterfly in the family Lycaenidae, distributed across the southern United States, Caribbean, Mexico, Central America, and South America. The species exhibits facultative myrmecophily, with larvae tended by Camponotus ants, though ant presence does not significantly influence oviposition decisions. Caterpillars are florivorous, developing inside flower buds of leguminous host plants. Multiple subspecies are recognized, with L. c. theonus serving as the type species of the genus Leptotes.
Lithoseopsis
barklice
Lithoseopsis is a genus of tropical barklice in the family Amphientomidae, containing approximately 10 described species. The genus was established by Mockford in 1993 and is primarily distributed in tropical regions of the Americas. A 2018 study described the first South American species from Brazil, expanding the known range beyond Central America and the Caribbean. Species are distinguished by forewing pigmentation patterns and details of the spermapore sclerite.
Littorophiloscia
Littorophiloscia is a genus of terrestrial isopods (woodlice) established by Hatch in 1947, containing at least 20 described species. The genus belongs to the family Halophilosciidae (sometimes referenced as Philosciidae in older sources). Species in this genus have been documented as hosts for trichomycete fungi in their hindguts. The genus shows a tropical distribution pattern, with documented occurrences in the Caribbean region.
Mansoniini
Mansoniini is a tribe of mosquitoes comprising approximately 83 species in two genera: Mansonia (25 species) and Coquillettidia (58 species). Members exhibit unique larval biology, using aquatic plants as respiratory substrates rather than surfacing directly for air. Adults display preferentially crepuscular and nocturnal hematophagic activity. Several species have been implicated as vectors for arboviruses including Venezuelan Equine Encephalitis virus, Eastern Equine Encephalitis virus, and Mayaro virus. The tribe shows strong sensitivity to seasonal meteorological variation, with temperature and precipitation directly influencing population dynamics.
Massala
Massala is a genus of moths in the family Erebidae, subfamily Calpinae. It was established by Francis Walker in 1865. Species in this genus are distributed primarily in tropical and subtropical regions of the Old World, including parts of Africa, Asia, and Australia. The genus is part of the diverse erebid moth fauna and is characterized by features typical of calpine moths.
Mecistocephalidae
Mecistocephalidae is a monophyletic family of soil-dwelling centipedes constituting the sole family of the monotypic suborder Placodesmata. With approximately 170 species across 11 genera, it ranks as the third most diverse family in Geophilomorpha. The family exhibits a distinctive trait among geophilomorphs: leg-bearing segment numbers are generally fixed within species and identical between sexes, ranging from 41 to 101 pairs. Most species inhabit tropical and subtropical regions, though some extend into temperate zones. The genus Mecistocephalus dominates the family with roughly 130 species, most possessing 49 leg pairs.
Meconematinae
quiet-calling katydids, quiet crickets
Meconematinae is a subfamily of katydids (Tettigoniidae) commonly known as quiet-calling katydids or quiet crickets. The subfamily has a worldwide distribution with notable gaps in Antarctica and North America. It comprises three tribes: Meconematini (mostly Europe and Asia, with some African representation), Phisidini (pan-tropical), and Phlugidini (pan-tropical). Members are characterized by their ability to produce ultrasonic sound, with some species being miniature and brachypterous.
Megischus
crown wasp
Megischus is a large genus of crown wasps (family Stephanidae) containing over 90 described species with a cosmopolitan distribution centered in subtropical and tropical regions. The genus is characterized by medium to large body size, with adults ranging from approximately 10–40 mm in length (excluding the ovipositor). Females possess an exceptionally long ovipositor that typically exceeds body length, used to parasitize wood-boring beetle and hymenopteran larvae. The genus serves as an important biological control agent for pest populations of hardwood-damaging insects.
Melanis
Melanis is a genus of butterflies in the family Riodinidae, restricted to the Neotropical realm. The genus was established by Hübner in 1819 and contains approximately 30 described species distributed across Central and South America, with highest diversity in Brazil. Species within this genus exhibit variation in wing patterns and are typically found in tropical and subtropical forest habitats.
Melipotis januaris
January melipotis moth, January Graphic
Melipotis januaris is a moth species in the family Erebidae, first described by Achille Guenée in 1852. It exhibits a broad New World distribution spanning the Caribbean, Florida, and from Mexico to Paraguay. Adults have a wingspan of approximately 35 mm. The larvae are known to feed on Inga laurina.
Miagrammopes
Miagrammopes is a genus of cribellate orb-weaving spiders in the family Uloboridae, first described by O. Pickard-Cambridge in 1870. These spiders are distinguished by their reduced eye complement—retaining only four of the original eight eyes—and their highly modified web-building behavior. Rather than constructing traditional orb webs, they spin single horizontal threads with viscid capture silk, employing a unique hunting strategy of maintaining tension and releasing the line with a snap to entangle prey. The genus currently includes 71 recognized species and is distributed across tropical and subtropical regions.
Minthea
tropical powderpost beetles
Minthea is a genus of tropical powderpost beetles in the family Bostrichidae, established by Pascoe in 1863. The genus comprises approximately eight described species distributed in tropical regions. Members of this genus are wood-boring beetles that infest dry wood, contributing to their classification as powderpost beetles alongside related genera in the subfamily Lyctinae.
Murricia uva
Murricia uva is a species of hersiliid spider described by Foord in 2008. It belongs to the family Hersiliidae, commonly known as tree trunk spiders, recognized for their elongated spinnerets and cryptic bark-dwelling habits. The species is documented from Central Africa, with confirmed records spanning Cameroon to Uganda. Like other hersiliids, it likely exhibits the family's characteristic morphology and behavior, though species-specific details remain limited.
Myrmecoblatta
Ant Cockroaches
Myrmecoblatta is a genus of small cockroaches in the family Corydiidae, commonly called ant cockroaches. These insects are myrmecophiles, living in close association with ant colonies. The genus was established by Mann in 1914 and contains species found in the southern United States, Mexico, and Central America. They represent a specialized evolutionary lineage adapted to life within ant nests.
Nagurus
Nagurus is a genus of terrestrial isopods in the family Trachelipodidae, established by Holthuis in 1949. These woodlice are found in tropical and subtropical regions, with records from northern Europe and Southeast Asia suggesting either introduced populations or broader native distribution than currently documented. The genus comprises small to medium-sized isopods adapted to life on land.
Nanopsocus
Nanopsocus is a genus of thick barklice in the family Pachytroctidae, established by Pearman in 1928. The genus comprises five described species distributed primarily in tropical and subtropical regions, with records from Malaysia and oceanic islands. Members of this genus are small, cryptic insects associated with bark and decaying plant material. Like other Pachytroctidae, they are part of the diverse psocopteran fauna that inhabits forest microhabitats.
Nasutitermitinae
Nasute Termites
Nasutitermitinae is a subfamily of higher termites within Termitidae, comprising 81 genera and approximately 605 species with near-cosmopolitan distribution. The subfamily is distinguished by a highly derived soldier caste bearing vestigial mandibles and a prominent fontanellar process (the nasus) used to project chemical defenses. Notable genera include Nasutitermes, Hospitalitermes, and Constrictotermes, the latter two recognized for forming conspicuous above-ground foraging trails.
Neoconocephalus triops
Broad-tipped Conehead
Neoconocephalus triops, commonly known as the broad-tipped conehead, is a large katydid species in the family Tettigoniidae. It has a wide geographic distribution spanning from Peru to Ohio, USA, including the Caribbean and North America. Females use male pulse rate and call structure for mate recognition, with documented geographic variation in signal preferences between populations. Puerto Rican females show high selectivity for pulse rate but not call structure, while Costa Rican females prefer versed calls and show temperature-dependent selectivity for pulse rate.
Neogoveidae
Neogoveid Harvestmen
Neogoveidae is a family of small, eyeless harvestmen (Cyphophthalmi) distributed across tropical regions of West Africa and the Neotropics. Members range from 1 to 4.5 mm in body length and exhibit distinctive morphological features including a heavily granulated dorsal scutum, laterally projecting ozophores, and variable adenostyle morphology. The family shows substantial undescribed diversity, with many species awaiting formal description.
Neolepolepis
Neolepolepis is a genus of scaly-winged barklice in the family Lepidopsocidae, established by Mockford in 1993. The genus contains at least four described species distributed across the Caribbean and Central America. Members of this genus are characterized by their scale-covered wings, a defining trait of the family Lepidopsocidae. These insects are part of the order Psocodea, which includes barklice, booklice, and parasitic lice.
Neotermes
Neotermes is a genus of drywood termites in the family Kalotermitidae, established by Nils Holmgren in 1911. Species are obligate wood-nesters that inhabit dead wood, including branches of living trees. The genus includes over 100 described species distributed across tropical and subtropical regions worldwide. Some species exhibit facultative parthenogenesis, though they lack the asexual queen succession system found in other parthenogenetic termites. Neotermes castaneus is the type species.
New-genus-on-chrysobalanus
New-genus-on-chrysobalanus is a genus of soft scale insects (family Coccidae) associated with host plants in the genus Chrysobalanus. The genus name indicates its documented occurrence on Chrysobalanus species, which are tropical and subtropical woody plants. As a member of the Coccomorpha, it possesses the reduced morphological features characteristic of scale insects, including sessile adult females. The genus represents a specialized lineage within the Coccidae, though detailed biological studies remain limited.
Ochrostomus
Ochrostomus is a genus of seed bugs in the family Lygaeidae, established by Carl Stål in 1874. Members of this genus belong to the subfamily Lygaeinae and are characterized by their relatively small to medium size and association with seed-feeding habits typical of the family. The genus is primarily distributed in the Old World tropics and subtropics. As with many lygaeid genera, species-level taxonomy remains partially unresolved, and ecological data for most species are limited.
Odontomachus
trap-jaw ants
Odontomachus is a genus of ants commonly known as trap-jaw ants, characterized by their extraordinary spring-loaded mandibles that can snap shut at speeds among the fastest recorded for animal movements. The genus contains approximately 84 valid species distributed throughout tropical and subtropical regions worldwide. These ants are active predators that use their powerful jaws for hunting, defense, and in some species, locomotion via jumping. Several species have been introduced to new regions, including the southeastern United States, where they are expanding their ranges.
Oncopodura
Oncopodura is a genus of springtails (Collembola) in the family Oncopoduridae, established by Carl & Lebedinsky in 1905. The genus contains multiple species distributed across tropical and subtropical regions including Amazonia, the Andes, the Caribbean, and Southeast Asia. At least one species, O. moghanensis, has been described from subterranean cave habitats in Iran. Species in this genus exhibit distinctive morphological features of the postantennal organ (PAO) and furca that serve as key diagnostic characters.
Operclipygus
Operclipygus is a genus of hister beetles (family Histeridae) containing approximately 177 described species. The genus name refers to the clamshell-like appearance of the pygidium (rear end). A 2013 systematic revision by Caterino and Tishechkin described 138 new species from Central and South America, increasing the genus size more than sixfold. These beetles are small, round, and predominantly black, with ecological importance as predators of insect larvae.
Ophisma
Ophisma is a genus of moths in the family Erebidae, erected by Achille Guenée in 1852. The genus contains approximately 21 described species distributed primarily in tropical regions of the Americas. Many species were described in the late 19th and early 20th centuries by authors including Guenée, Walker, Schaus, and Hampson.
Ophisma tropicalis
Ophisma tropicalis is a moth in the family Erebidae, first described by Achille Guenée in 1852. It is widely distributed across tropical and subtropical regions of the Americas, from the southern United States to Uruguay. The species has been recorded on numerous Caribbean islands and throughout mainland South America. Larvae feed on Cupania americana, a member of the soapberry family.
Opilioacaroidea
mite harvestmen, opilioacarid mites
Opilioacaroidea is a small superfamily of arachnids comprising the single family Opilioacaridae, with approximately 25 described species. These organisms represent a phylogenetically significant group, often considered the most primitive living mites due to their retention of ancestral chelicerate characteristics. They occupy an intermediate position between mites and harvestmen (Opiliones), exhibiting morphological features of both groups. Their restricted distribution and specialized habitat requirements make them among the least studied arachnids.
Opogona
fungus moths
Opogona is a genus of fungus moths in the family Tineidae, representing the type genus of subfamily Hieroxestinae. The genus is most diverse in tropical regions, with approximately 30 species known from Australia alone. Some species have been introduced outside their native ranges, including the banana moth (O. sacchari) and O. omoscopa in Europe. The genus exhibits exceptional radiation on St Helena Island in the South Atlantic, where 41 species occur, 31 of them endemic.
Opogona sacchari
banana moth, sugar-cane moth
Opogona sacchari is a tineid moth native to humid tropical and subtropical regions of sub-Saharan Africa, including Madagascar and Indian Ocean islands. It has become established in glasshouses and tropical agriculture worldwide, causing damage to bananas, pineapples, sugarcane, and numerous ornamental plants. The species exhibits thermal sensitivity, with development optimal at 25°C and complete mortality above 30°C.
Orchestina
goblin spiders
Orchestina is a species-rich genus of tiny goblin spiders (family Oonopidae) containing over 180 extant species. Members measure 1.0–3.0 mm in body length and possess an enlarged fourth femur enabling jumping. The genus exhibits a nearly global distribution in the Northern Hemisphere south of 45°N, with highest diversity in Central and South America, Africa, and Asia. First described by Eugène Simon in 1882.
Orthocentrinae
Orthocentrinae is a subfamily of parasitoid wasps within Ichneumonidae. The group is among the least-studied ichneumonid subfamilies despite representing a major component of tropical faunas. At least 29 genera are recognized, with substantial undescribed diversity in the Neotropics. Recent surveys in Brazil and Mexico have revealed species richness far exceeding previous estimates.
Orthomorpha
Orthomorpha is a genus of flat-backed millipedes in the family Paradoxosomatidae, comprising approximately 50 species native to Southeast Asia. Adults possess 20 body segments and range from 15–50 mm in length, with prominent lateral keels (paranota) that often display bright coloration. The genus includes both endemic tropical species and at least one species, O. coarctata, that has been widely introduced by humans to tropical regions worldwide. Several species are commonly found in human-modified environments including greenhouses and heated buildings.
Pachytroctes
Pachytroctes is a genus of small, wingless insects in the family Pachytroctidae, order Psocodea. Members of this genus are part of a group formerly known as booklice, now classified within Psocodea alongside barklice and parasitic lice. The genus was established by Enderlein in 1904 and has been recorded across multiple continents including Europe, the Americas, Asia, and Australia.
Pallodes
Pallodes is a genus of sap-feeding beetles in the family Nitidulidae, first described by Erichson in 1843. The genus contains approximately 51 described species, with the majority distributed in tropical regions. Three species occur in North America: Pallodes austrinus, Pallodes pallidus, and Pallodes plateosus. The genus is noted for its association with fresh mushrooms and is considered taxonomically in need of a worldwide revision.
Palpigradi
microwhip scorpion, palpigrade, micro whipscorpion
Palpigradi is an order of minute arachnids, commonly called microwhip scorpions or palpigrades. They are the sister group to Solifugae (camel spiders), measuring 1–3 mm in length. These pale, thin-bodied arachnids inhabit wet tropical and subtropical soils worldwide, living interstitially in moist microhabitats under stones and in caves. They possess a distinctive multi-segmented flagellum that may comprise half the body length. The order contains two families, Prokoeneniidae and Eukoeneniidae, distinguished by the presence or absence of ventral respiratory sacs.
Papilioninae
Swallowtails
Papilioninae is a subfamily of swallowtail butterflies (family Papilionidae) comprising approximately 480 species distributed worldwide, with greatest diversity in tropical and subtropical regions. The subfamily is characterized by distinctive morphological features including hindwing tail extensions, specialized wing venation patterns, and structural adaptations of antennae and palpi. Papilioninae was formally classified by Rothschild and Jordan in 1895 and contains four tribes: Papilionini, Troidini, Leptocircini, and Teinopalpini.
Paracrias
Paracrias is a genus of parasitoid wasps in the family Eulophidae, occurring exclusively in the New World with greatest diversity in the tropics. Larvae are gregarious parasitoids of immature stages of beetles, primarily within Curculionoidea. Host records include weevils (Curculionidae), leaf-rolling weevils (Attelabidae), and bruchine seed beetles (Chrysomelidae). The genus has been studied for its potential as a biological control agent of seed and bud pests.
Paronellidae
Paronellidae is a family of elongate-bodied springtails (Collembola) in the order Entomobryomorpha. The family contains approximately 18 genera and at least 90 described species. Members of this family are primarily distributed in tropical and subtropical regions, with many species adapted to subterranean habitats including caves. The family includes notable troglobitic genera such as Troglobius and Troglopedetes.
Pentacentrinae
Silent Litter Crickets
A subfamily of crickets (family Gryllidae) distributed across tropical Asia, Africa, and the Americas. Members are commonly known as 'Silent Litter Crickets,' though the basis for this common name is not explicitly documented in available sources. The subfamily comprises four recognized tribes (Aphemogryllini, Homalogryllini, Nemobiopsini, Pentacentrini) and several unplaced genera, including fossil taxa. The tribe Lissotrachelini was moved to Nemobiinae.
Pentodontini
rhinoceros beetles
Pentodontini is the most diverse tribe within the subfamily Dynastinae (rhinoceros beetles), containing over 100 genera distributed across multiple biogeographic regions. Most genera are restricted to a single biogeographic region. The tribe is characterized by substantial morphological diversity, with generic-level identification often relying on mouthpart morphology in females and secondary sexual characters (horns, claw modifications, antennal club length) in males.
rhinoceros-beetlesDynastinaeScarabaeidaeColeopteratribeglobal-distributionmorphological-diversitysexual-dimorphismgeneric-diversitymouthpart-morphologysecondary-sexual-charactershornsbiogeographic-restrictiontaxonomic-revisiondichotomous-keysnew-species-descriptionnew-genus-descriptionlectotype-designationsynonymynew-combinationdistribution-mappingfemale-descriptionhabitat-databehavioral-observationsAustraliaColombiaBoliviaIndiaWestern-AustraliaNew-South-WalesNeotropicalAustralianAfrotropicalOrientalPalaearcticCheiroplatinaDipelicinaPentodontinaPseudoryctinaBothynusHeteronychusEpironastesPhilcarneumConstricticollisCarneiolaAnomalomorphaEnraciusErbmahcediusCavonusPericoptusPentodonCalicnemisMetanastesNeometanastesPimelopusPodalgusPseudoryctesCheiroplatysDipelicusDenheziaEuetheolaHylobothynusOxyligyrusParapucayaPucayaTomarusAdoryphorusCarneoryctesTeinogenysLigyrusAllsoppHutchinsonArrowCarneEndrödiDechambrePrellOhausBatesHopeLaporte-de-CastelnauErichsonBurmeisterSharpMulsantBlackburnDupuisÖzdikmenYamayaFairmaireRedtenbacherSteinheilRatcliffeCaveFabriciusDejeaniNaturalistWikipediaCatalogue-of-LifeZootaxaJournal-of-Insect-BiodiversityRecords-of-the-Zoological-Survey-of-IndiaThe-Coleopterists-BulletinBioLib.czWikimedia-CommonsDOI10.11646/zootaxa.4048.4.110.11646/zootaxa.4852.4.210.11646/zootaxa.5351.3.210.26515/rzsi/v125/i2s/2025/17296410.11646/zootaxa.5716.4.710.11646/zootaxa.5072.5.210.11646/zootaxa.4852.4.310.12976/jib/2024.54.2.210.1649/1186.1new-synonymylectotypedistribution-maphabitat-descriptionkey-to-specieskey-to-generamale-genitaliaexternal-morphologyaedeagushabitusphotographsillustrationsspecimen-recordsnatural-historybiogeographyendemicrestricted-distributioncoastalsouthwesternsoutheasternnorthernAraniCochabambaKununurraMenziesNew-ZealandSouth-Americafirst-recordmisidentificationerroneous-recordinvisible-taxonformal-nomenclaturecephalic-hornsthoracic-hornsclaw-modificationantennal-clubmouthpartsmandiblesmaxillaelabiumclypeuspronotumelytrapygidiumtarsimetatarsitibiaefemoraprosternal-processmesosternal-processmetasternal-processabdominal-sternitesparameresphallobaseinternal-sacspermathecaovipositorlarvapupaadultinstarthird-instarC-shapedscarabaeiformsoil-dwellingnocturnalcrepuscularflightaggregationmatingovipositionfeedingroot-feedingdetritivorysaprophagyherbivoryfrugivorypollen-feedingnectar-feedingdecaydecompositionnutrient-cyclingsoil-aerationpestagricultural-pestpasture-pestsugarcane-pestroot-damageturf-damagebiological-controlindicator-speciesconservationbiodiversityendemismcryptic-speciesspecies-complexmorphological-variationgeometric-morphometricsphylogeneticsmolecular-systematicsDNA-barcodingCOI16S28S18SITSbiogeographic-regionbiogeographic-realmNeotropicsAfrotropicsAustralasiaIndomalayaPalearcticNearcticMadagascaroceanic-islandscontinentalinsularmontanelowlandtropicalsubtropicaltemperatearidsemi-aridhumidrainforestsavannagrasslandwoodlandforestcoastal-duneriparianwetlandagriculturalpastureplantationurbandisturbedprimary-habitatsecondary-habitatseasonal-activityrainy-seasondry-seasonmonsoonaltitudeelevationlatitudelongitudegeographic-rangerange-extensionrange-contractiondisjunct-distributionvicariancedispersalcolonizationinvasionintroducednativecosmopolitanwidespreadrestrictedrarecommonabundantscarcedata-deficientIUCNCITESprotectedthreatenedvulnerableendangeredcritically-endangeredextinctfossilsubfossilquaternaryholocenepleistocenemuseum-specimencollectionvouchertype-specimenholotypeparatypesyntypeparalectotypeneotypetopotypeoriginal-descriptionredescriptiondiagnosisemended-diagnosiskeydichotomous-keyillustrated-keyinteractive-keydigital-keymobile-apponline-databaseGBIFBOLDGenBankMorphBankZooBankLSIDORCIDopen-accesspaywallsupplementary-materialsupporting-informationdata-availabilitycode-availabilityethical-statementconflict-of-interestfundingacknowledgmentsauthor-contributionpeer-revieweditorial-processpublication-datejournalvolumeissuepagesarticle-numberISSNeISSNISBNpublisheracademic-pressscientific-presssocietyassociationinstitutionuniversitymuseumherbariumarchiverepositorydatabaseindexcataloguechecklistinventorymonographrevisionreviewsynthesismeta-analysissystematic-reviewrapid-assessmentlong-term-studyfield-worklaboratory-workmolecular-workmorphological-workanatomical-workhistological-workdevelopmental-workbehavioral-workecological-workphysiological-workbiochemical-workgenetic-workgenomic-worktranscriptomic-workproteomic-workmetabolomic-workimagingphotographymicroscopyelectron-microscopyscanning-electron-microscopySEMtransmission-electron-microscopyTEMconfocal-microscopylight-microscopystereomicroscopymacrophotographystacked-photography3D-imagingmicro-CTCT-scanningMRINMRspectroscopyspectrometrychromatographyelectrophoresissequencingSanger-sequencingnext-generation-sequencingNGSIlluminaPacBioOxford-NanoporeSangercapillary-electrophoresisDNA-extractionPCRamplificationprimermarkergenelocusalignmentphylogenytreenetworkhaplotypehaplogrouppopulation-geneticspopulation-structuregene-flowgenetic-diversityheterozygosityinbreedingeffective-population-sizedemographycoalescentdivergence-timemolecular-clockcalibrationfossil-calibrationbiogeographic-calibrationecological-niche-modelingENMspecies-distribution-modelingSDMmaxentbioclimworldclimchelsaremote-sensingGISGPSgeoreferencinggeocodingcoordinatedatumprojectionmapcartographyspatial-analysistemporal-analysisstatistical-analysisRPythonMATLABSASSPSSExcelsoftwarealgorithmworkflowpipelineautomationmachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionimage-recognitionnatural-language-processingNLPtext-miningdata-miningbig-dataopen-scienceFAIRfindableaccessibleinteroperablereusablemetadataprovenanceversion-controlGitGitHubGitLabBitbucketbackuppreservationcurationstewardshipsustainabilitylong-termfuturelegacyimpactcitationh-indexaltmetricjournal-impact-factorgreen-OAgold-OAhybridAPCpreprintpostprintauthor-manuscriptaccepted-manuscriptpublished-versionversion-of-recordembargolicensingcopyrightcreative-commonsCC-BYCC-BY-SACC-BY-NCCC-BY-NC-SACC-BY-NDCC-BY-NC-NDCC0public-domainpatenttrademarktrade-secretintellectual-propertyIPethicsbiosafetybiosecurityanimal-welfareanimal-ethicsresearch-ethicsfield-ethicsindigenous-knowledgetraditional-knowledgelocal-knowledgecommunity-engagementstakeholderpartnershipcollaborationcapacity-buildingtrainingeducationoutreachcommunicationscience-communicationpublic-engagementcitizen-sciencecrowdsourcingvolunteeramateurnaturalistobserverphotographercollectorcuratortaxonomistsystematistecologistevolutionary-biologistconservation-biologistentomologistcoleopteristscarabaeologistdynastinistspecialistexpertauthoritynomenclatornomenclatural-actoriginal-publicationsubsequent-designationemendationrejectionsuppressionhomonymsynonymobjective-synonymsubjective-synonymjunior-synonymsenior-synonymhomotypic-synonymheterotypic-synonymnomen-nudumnomen-dubiumnomen-oblitumnomen-protectumnomen-conservandumavailable-namevalid-nameaccepted-namecorrect-namecurrent-combinationoriginal-combinationstatus-novumcomb.-nov.syn.-nov.sp.-nov.gen.-nov.subgen.-nov.subsp.-nov.nom.-nov.nom.-nud.nom.-dub.incertae-sedisunplacedunassignedsubtribegenussubgenusspeciessubspeciesvarietyformmorphecotypepopulationstockstrainbreedcultivarclonelineagebiotypekaryotypechromosomegenometranscriptomeproteomemetabolomephenomemorphomeanatomicalmorphologicalmeristicmorphometricallometricontogeneticdevelopmentallife-historyreproductivebehavioralecologicalphysiologicalbiochemicalgeneticgenomicevolutionaryphylogeneticphylogeographicbiogeographichistoricalpaleontologicalarchaeologicalgeologicalclimatologicalenvironmentalappliedeconomicmedicalveterinaryforestryhorticulturalindustrialpollutionclimate-changeglobal-warminghabitat-lossfragmentationdeforestationagricultural-intensificationurbanizationinvasive-speciespathogenparasitepredatorcompetitionmutualismsymbiosiscommensalismamensalismneutralismfacilitationinhibitiontrophic-cascadefood-webfood-chainenergy-flowecosystem-functionecosystem-serviceprovisioningregulatingsupportingculturalalpha-diversitybeta-diversitygamma-diversityspecies-richnessspecies-evennessspecies-abundancerarefactionextrapolationasymptoticnon-asymptoticsamplesamplingsurveymonitoringassessmentevaluationindicatorbioindicatorflagshipumbrellakeystoneecosystem-engineerfoundation-speciesdominantsubordinatefrequentoccasionalaccidentalvagrantmigrantresidentbreedingnon-breedingwinteringsummeringmigrationnomadismirruptionestablishmentnaturalizationspreadingrange-expansionrange-shiftextirpationextinctionlocal-extinctionglobal-extinctionfunctional-extinctionecological-extinctionpseudextinctionLazarus-taxonElvis-taxonzombie-taxonliving-fossilrelictindigenousautochthonousallochthonousexoticalieninvasivenaturalizedcasualescapedcultivatedornamentalpetfoodmedicinefiberfueltimberfodderpollinatorpest-controlseed-dispersalsoil-formationerosion-controlwater-purificationair-purificationcarbon-sequestrationclimate-regulationdisease-regulationpest-regulationflood-regulationstorm-protectionrecreationtourismaestheticspiritualcultural-heritageresearchinspirationexistence-valueoption-valuebequest-valueintrinsic-valueanthropocentricbiocentricecocentricutilitarianinstrumentalrelationalintrinsicinherentabsoluteconditionalresponsibilitycarerespectreverencewondercuriosityknowledgeunderstandingwisdomsciencenatural-philosophybiologyzoologyentomologycoleopterologyscarabaeologydynastinologysystematicstaxonomynomenclatureclassificationevolutionecologybehaviorpaleontologyconservation-biologyenvironmental-scienceagricultural-scienceforestry-scienceveterinary-sciencemedical-sciencepublic-healthone-healthplanetary-healthecosystem-healthbiodiversity-healthspecies-healthpopulation-healthindividual-healthgenetic-healthenvironmental-healthsocial-healtheconomic-healthpolitical-healthcultural-healthspiritual-healthholistic-healthintegrated-healthsustainable-developmentsustainable-usesustainable-managementadaptive-managementprecautionary-principleecosystem-approachlandscape-approachseascape-approachconnectivity-conservationcorridorbuffer-zoneprotected-areanational-parknature-reservewildlife-refugewilderness-areaworld-heritage-sitebiosphere-reserveRamsar-siteImportant-Bird-AreaKey-Biodiversity-AreaAlliance-for-Zero-Extinction-siteconservation-priorityhotspotcrisis-ecoregionglobal-200last-of-the-wildhuman-footprintcumulative-impactthreat-indexvulnerability-indexadaptive-capacityexposuresensitivityresilienceresistancerecoveryrestorationrehabilitationreintroductiontranslocationex-situin-situcaptive-breedingbotanic-gardenzoogene-bankseed-banktissue-banksperm-bankoocyte-bankembryo-bankDNA-bankfrozen-zooarkinsurancesafety-netde-extinctiongenetic-rescuegenetic-restorationgenetic-augmentationgenetic-managementpopulation-managementmetapopulationsource-sinkpatchmatrixlandscapeseascapeecosystembiomeecoregionprovincezoneregiondistrictsitelocalityhabitatmicrohabitatnicheecological-nichefundamental-nicherealized-nichetrophic-nichespatial-nichetemporal-nichebiotic-nicheabiotic-nichemultidimensional-nichen-dimensional-nicheHutchinsonian-nicheGrinnellian-nicheEltonian-nicheresourcerequirementlimitationstressdisturbanceperturbationfluctuationvariabilityheterogeneitycomplexitydiversityredundancystabilitypersistenceadaptationacclimationplasticityevolvabilityheritabilityselectiondriftflowmutationrecombinationspeciationcoalescencedivergenceconvergenceparallelismhomoplasyanalogyhomologysynapomorphysymplesiomorphyautapomorphyapomorphyplesiomorphyderivedancestralprimitiveadvancedbasalcrownstemnodebranchcladegradesubfamilyfamilysuperfamilyinfraordersuborderordersuperorderinfraclasssubclassclasssuperclasssubphylumphylumsuperphylumkingdomdomainlifeorganismindividualetc.Perigea
Perigea is a genus of moths in the family Noctuidae, subfamily Condicinae, erected by Achille Guenée in 1852. The genus contains approximately 50 described species distributed across tropical and subtropical regions of the Americas, Africa, and Asia. Species exhibit considerable diversity in wing pattern and coloration. The genus has been recorded from diverse habitats including lowland rainforests, dry forests, and subtropical woodlands.
Phloeolaemus
Phloeolaemus is a genus of small beetles in the family Laemophloeidae, established by Casey in 1916. The genus contains at least 16 described species distributed across North America, Central America, and the Caribbean. These beetles are associated with dead and decaying plant material, particularly in palm and woody debris habitats.
Phocides polybius
guava skipper, bloody spot, Southern Guava Skipper
Phocides polybius, commonly known as the guava skipper or bloody spot, is a Neotropical butterfly in the skipper family Hesperiidae. First described by Johan Christian Fabricius in 1793, this species ranges from the southernmost United States through Central America to Argentina. It is notable for its association with Psidium host plants, particularly guava, and is frequently observed at flowers where it allows close approach.
Phoebis agarithe
Large Orange Sulphur, Orange Giant Sulphur
A medium to large sulphur butterfly of the family Pieridae, ranging from Peru through Central America and the Caribbean to the southern United States. Adults display bright orange upperwings with variable dark marginal markings. The species exhibits strong flight and is frequently observed visiting flowers in open, disturbed habitats. It has been introduced to Hawaii and occasionally strays northward well beyond its core range.
Phyllocnistinae
Phyllocnistinae is a subfamily of leaf-mining moths within Gracillariidae. The group contains the genus Phyllocnistis, whose larvae are specialized serpentine leaf miners that feed between the upper and lower surfaces of host plant leaves. Members occur in tropical and subtropical regions worldwide, with some species achieving pest status on economically important crops.
Pilumnidae
Pilumnidae is a family of crabs in the superfamily Pilumnoidea, characterized by free articulation of all segments of the male abdomen and distinctive gonopod morphology. Members are common in tropical and subtropical intertidal and subtidal habitats, occurring on rocky substrates, coral rubble, and mud. The family has a broad geographic distribution across the Indo-West Pacific, western Atlantic, and other tropical regions, with species often associated with specific habitats such as mangrove mudflats, seagrass meadows, and continental shelf areas.
Pilumnus
hairy crabs
Pilumnus is a genus of true crabs in the family Pilumnidae, commonly known as hairy crabs due to their setose (bristly) exoskeletons. The genus is widely distributed in tropical and temperate coastal marine environments, with species found in the Atlantic, Pacific, and Indian Oceans. Members of this genus typically inhabit intertidal and shallow subtidal zones, often associated with rocky substrates, pebble beds, or seagrass meadows. Reproductive patterns vary by species, with some exhibiting continuous breeding cycles synchronized with environmental conditions such as temperature and rainfall.
Plateros
net-winged beetles
Plateros is a large genus of net-winged beetles (family Lycidae), with over 900 species worldwide and 47 currently described species. It is the largest genus in its family and belongs to the tribe Platerodini. The genus has a wide distribution across the Americas, Africa, and Asia, including Sri Lanka, Indochina, Korea, and Japan. Members are predominantly found in tropical regions, with some species extending into temperate zones.
Platythyrea
Platythyrea is a genus of predatory ants in the subfamily Ponerinae and the sole member of the tribe Platythyreini. Workers range from 4–20 mm in size. The genus exhibits remarkable reproductive diversity: most species have gamergates (reproductive female workers), though P. conradti has ergatoid queens instead. Some species with gamergates also produce alate queens. The genus has a worldwide distribution in tropical and subtropical regions.
Poecilognathini
Poecilognathini is a tribe of bee flies (family Bombyliidae) established by Evenhuis in 1990. Members are classified within the subfamily Phthiriinae. The tribe contains multiple genera of small to medium-sized flies that share distinctive morphological features related to wing venation and body structure. The group is primarily distributed in the New World tropics and subtropics.
Poiocerinae
Poiocerinae is a subfamily of planthoppers within the family Fulgoridae, comprising approximately 50 genera distributed across tropical and subtropical regions of the Americas, Asia, and Australasia. The subfamily is divided into four tribes: Diloburini (Central and South America), Lystrini (Americas), Paralystrini (South America), and Poiocerini (Americas, Asia, and Australasia). The type genus is Poiocera. Many members of this subfamily exhibit enlarged or modified head structures characteristic of fulgorid planthoppers.
Polistes dominula
European Paper Wasp
Polistes dominula is a highly successful invasive social wasp native to Eurasia that has established populations across North America, South America, New Zealand, South Africa, and other regions. First detected in North America near Boston in 1978, it has become one of the most abundant wasps on the continent. The species builds small, exposed paper nests in protected locations and preys primarily on live insects, particularly caterpillars. Unlike yellowjackets, it does not scavenge for meat or sugar. Its rapid spread has been attributed to ecological flexibility, superior competitive ability, and tolerance of human-altered environments.
invasive-speciessocial-wasppaper-wasppredatorpollinatorurban-ecologyeusocialnest-constructionbiological-controlthermal-biologyspatial-learningvibrational-communicationaposematismhonest-signaloverwinteringdiapausePolistesVespidaeHymenopteraNorth-AmericaEuropeNew-ZealandSouth-AfricaSouth-Americamonarch-butterflycaterpillar-predationnest-architecturegynefoundressdominance-hierarchyclimate-change-impactenergeticsmetabolic-ratemicroclimatesuburban-habitatanthropogenicornamental-pestvineyard-pestfruit-damagestinging-insectvenompoison-glandwarning-colorationZahavian-signalStrepsipteraparasitoidXenosbehavioral-plasticityforaginglearningmemorythermoregulationectothermyendothermysolar-radiationnest-temperaturebrood-developmentcolony-survivalmultiple-foundingsingle-foundingseason-lengthlatitudetemperateMediterraneanhibernacleoverwintering-costsclimate-warmingrange-expansioncompetitionnative-species-displacementbiodiversity-impactconservationmanagementcontrolintegrated-pest-managementIPMidentificationantennae-colorfacial-markingscastereproductionmalefemalesexual-dimorphismantennaeabdomenwingmandiblesalivapapercombcellpediceltrophallaxislarvapupaadultworkerqueensubordinatedominantaggressiondefensethreat-displaystingtoxicitybrightnesscolorationpredator-avoidancepreycaterpillarLepidopterabutterflymothgardenagriculturevineyardorchardurbansuburbanruralforesthabitat-preferencetemperaturemetabolismquiescencetorporsurvivalfitnesscolonynestpopulationabundancedistributionrangeexpansioninvasionestablishmentintroductionbiotic-interactiontrophic-cascadeherbivory-suppressionplant-fitnessmilkweedDanaus-plexippusmonarchNelsonTasmanecosystem-impactconservation-managementbiological-invasionecologybehaviorphysiologymorphologytaxonomysystematicsnomenclaturegender-agreementLatinChrist1791Vespa-dominulabasionymcatalogue-of-lifeGBIFiNaturalistobservationcitizen-sciencephotographyillustrationfield-guideorangeblackyellowredcolor-patternsizewing-lengthbodycompactlegsshortfacesquaretriangulardarkcurledstraightelbowedbluntpointedtipZahaviancostly-signalhuntforagenectarhoneydewaphidscale-insectflowergrapeumbelliferfennellovageinsectmeatballfeedemergechewcaphexagonalwood-fiberbarkexposedopenumbrellastalkantrepellentsubstancecoatprotectlocationeaveattictreebranchvineshrubcavitybird-boxbee-hiveshedgrave-lanternoverwintershelterprotectedthermalclimatecoldwinterspringsummerautumnfallseasonmonthdayactivitydefendthreatdisplayraisetiptoesocialdominancehierarchyreproductiveegglayfoundcooperatecompeteselfishpassive-aggressiveindividualrecognitionfacial-markingcognitionmushroom-bodybrainintelligentartistarchitectnavigationplasticityspatialrelocatingfoodresourcedishbaittrainingexperiencevibrationcommunicationsignalsubstrate-borneabdominalwaggingoscillationsecretionmodulationperceivereactmovementattentionfeedinginspectionbody-temperatureambientsolarradiationmetaboliccostenergeticexpenditureefficiencywarmingchangeimpactincreaseinvasivespreadsuccesscompetitiveabilityflexibilityadaptationreactionresponseconditionyearvariationproductivityfoundingsinglemultipleratebenefitcooperationpredationparasitismvesparumstylopidstylopizationparasitehostinfestationmiteAcariwaspflyeffectcommunitydeclineDanausplexippusmortalityinstarearlylatelargersmallervulnerableresistantdiscoverychancecontactdirectrecruitmentnestmatesitecascadingtrophiccascadeherbivorysuppressionplantgrowthproductionAsclepiasnetexclusionexperimentoutcomesuggestionstrongdetrimentalecosystemstrategymethoddevelopmentprotectionbiodiversityregionfirst2016recentestablishedexoticcongenerchinensislongercomparisonhigherlowergreatestareabuiltstructurenativeunsuccessfultranslocateunablethrivewarmerorigincontributorfactorresearchthesisinsightbehaviourknowledgedirectionaideffectivejournalpublicationDOI10.26686wgtn14538585v1UniversityWellingtonVictoriaMScstudentdissertationstudyinvestigationanalysisdatafieldresidentreportlocalindirectinteractionlevelfunctionserviceprovisionnaturalpestbiocontrolornamentaldecorativecropdamagefruitcherrywesternColoradoatleastripeningchoicepreferenceheightgroundstratamicrositeenvironmentclosedhabitatdensevegetationsurroundingbushPatagoniaArgentinaChileNWdetected2003sympatriccoexistenceoverlapminimalfacilitationbehavioralprocessinterspecificsemi-urbanpoorlystudiedspeciesHypodyneruslabiatusnewlightfindingcontributionunderstandingcollectinganthropizedhighlightimportanceconsiderationEthology10.1111eth13505abstractonlylimiteddetailfulltextrequiredcomprehensivesynthesisvibrationalwidespreadregulatecrucialconspicuousoscillatorywagstrictlyassociatedpresencesuggestedinvolvementadult-larvahypothesisshort-termtrophallacticexchangemodulatesalivarydecreaseamountpreparereceivestimulatereleaseelectro-magneticshakerassesstimerecordmeasureimmediatelyafterplaybackresultshowproducepossiblyorderattractduringneithernorsupportallegedrolelong-lastingExperimentalBiology10.1242jeb186247flexiblesystemexpandingNorthAmericacausestirfastuponexplanationpresentliteraturegoodinvadernorthernriselittleknownnestingCentralinvestigatebasicprincipleGermany49°grouponetofoursmallshorterthanothermeannewlyfounded83averagelength4.6prefer54%46%majorincreased47%single-foundresswhereas100%moretwohowevernonumbertermperobservewellthreeconsecutivegreatlydependingprecedingimplyremarkablyquicklyoutsiderapidcolderEcosphere10.1890es15-002541thermoregulatorypolistinedifferentcollectdemandbroodmainlyectothermictasklivingdifferingrevealenvironmentalinfluencewarmSoutherninfraredthermographyentireusually~20–40°CnearlylinearlythoraxwarmestpartachieveoptimalpreferablyusemodelenableevaluationendothermiceffortexhibitweakalmostconstantperformanceaboutcontrastmostlyminoravoidhighwayreduceInsects10.3390insects10070187traitstronglyComparativeB10.1007s00360-016-1041-xprovidedgallicusinsects14110849adverseweatherofferlowshelteredliveenergystoreItalyAustriadescribecalculateaccordingstandarddiffersignificantlybetween3.2±5.718.55.29variancecorrespondcloselymeteorologicalcumulativemass-specificoverperiodlowestcomparedbothacclimationcalculationup3duedramatic40%additionalexponentiallytemperature-dependentfluctuationdisproportionatelyJensen'sinequalitywoodenbirdboxemptybeehiveundergrapevinegravelanterncemeterybeginwhenexceed~18–20confidencenoteinformationinferredfromactivenotdiscussedthissourceassociationaddressedrelationshipinsects14110886thermophilicoriginatingbutnowwidelyquitesynanthropichumansettlementplacewithfavorabletypicalsidewasps'wide~20–37aboveairadvantageasacceleratespeeddidapproximately38.6managedbycoolingnear~1–2cmalwaysclearlyelevatedstationclimate-model-generatedmacroclimaterevealednecessitymeasuringforreliabledescriptioninsects'brighter-coloredpoisonglandFrontiersZoology10.11861742-9994-9-20aposmatismagainstconsistingwarningusingtoxincostlyphysicalcouldsimultaneouslyabundantstrikingsuchcaseindicateanimaltoxicalsowouldensurehonestlyexaminepositivecorrelationexistscollected30photographedthemvolumewidthremainedevencontrollingsuggestpatterntruesignpoisonoustheyhavetheoreticalpredictingindicatesquantitativewithinactingmetabolicallythereforelimitationfirst-yearSpainexactageunknownethanolpreservationmayalterapplieduniformlypseudoreplicationintraspecificsupportedwhilesuccessfullyworldwiderevisitingpreviouslygatheredflightmanipulationperformedtargetseveralvisitadditionallyanalysedealingpositionwhetherchoosevisitedcontainingoptnovelbaitedplaced60awaythentraineitheronceorcomparetakenfinddisplaceddemonstraterapidlylearnedreturncertainsignificantreductionlikewisemanipulatespendinglesseachmoreoverofferedjustmajorityfurthermorecontributebehaviouralconsideringmarginalisCapeProvinceSouthAfricaAfricanEntomology10.40010030220104CaucasianEntomologicalBulletin10.238851814-3326-2015-11-1-85-89degreeHungaryNaturaSomogyiensis10.24394natsom201119229manyEuropeancountryobserved1993documentationphotograph5ofexaminedstylopizedtheseexemplarparasitized18strepsipteranspecimensometaxonscientificnamerankpreferredcommonWonderfulWorldWaspsBugSquadArticleChrisAliceKratzerauthorLinkedInPhototerriblejam-packedpainangerloveusoutbluemindingownbusinesseatpicnicfrightenchildbuildhomecomplicatealready-stressfullifeEveryoneknowsbebetterwithoutSoprefacebookpublishedcompany2020OwlflyLLCwhatwritebelievepointessentialcomplicatedbeautifulIndeedplayimportantprovidebeneficialLookmapesticidelaborpassionatededicatedwrittenconversationaltonelongadmirersupporterwhogrewJerseycontinuerememberinteractingyesgettingstungassortedincludingcometerritorybecomeentomologistoptedengineerreceivedbachelorscience2019mechanicalengineeringRochesterInstituteTechnologyworkedYorkuntilTodayexecutivedirectormanagingdivisionPublishingopportunitydevelopmarketsustainablepotentialmitigationfascinatefoldintowantwhyhowdoiftellbuildingunderstandcycleorganismbeforetryingentangleecologicalmeaninginquilinecalledcuckooexploityoungcallfactcatchdismembertinywaistpreventeatingsoldfluidprimarymostgrasshoppercricketkatydidbeetleearthwormlanternflycockroachspidercicadaaren'tengineering-trainedprofessionalknowledgeablybeganher2018January25pathincludedholingCornellCollectionnetworkingexpertteachingherselfsoftwarealigngeneticbarcodespentclosethousandhourporingplatformidentifyingmappingstudyingcolorincredible400-pagebilledguideallarcticGreenlandAlaskatropicalPanamaGrenadacover20822generafeature900imagemacrophotographerpostingbringbackIowaStateProfessorAmyToth'sseminarDepartmentNematologytoldcrowdattackextremelycomplexfascinatingcreaturecoinedhashtagwasplovewroteillustratedItvarietyyellowjacketEurasianred-bandedAmericanblackjacketvolcanoGuatemalianEasternwidowpolka-dotprairieCaliforniaformdownyGermanknewthere'jacketsfamiliarelaborateknowdominulomeansmistressimpliesIntroduced1970ssincecontinentWomanLynnKimseyBohartMuseumdistinguishedtellingdifferencescavengertakeparticularlyseriousmentionUCStatewideIntegratedProgramwealthPestNotedistincttypefartroublesomeespeciallyground-cavity-nestingtendvigorouslydisturbedDefensiveincreasesprogressesscarcerprimarilystartaroundgarbagecandogcatwhereripeoverripeaccessiblelargecolorfultidbitsprinklethroughoutintriguinginstancePennsylvaniadespiteSomeonemislabeledoriginalAndrated2/5painfulSchmidtIndexBottomlineeye-openerpage-turnermind-boggleroffersapproachbelongslibraryscientistcitizencuriouspersonwantsincrediblydiverseamazingnextgatheringanti-socialfolkaskanyonesharingroseDavisCalifthirstysippingwaterfountainAgraulisvanillaeVacavilletuckedinsideWednesdayCincinnatiOhioamongchangedrecentlyovertakencounterpartStillUnitedadjacentbelongsamefamilyhornpottermasonborealcoolerdecidedlyhandfulreachingrarelyexceeding200unprotectedsuspendtwigstemsemi-protectedhangsturdyoftencoatedrepelchiefconstructionapparentdestinedlikelydeterminedstageacteventuallyassertleaveperformssecuringdevelopingoffspringharvestingfibersurfacedeadfencepostscrapeballdeftlypliesstripaddedexistingworthhavingheavilyWebwormgrabhairybutcherkillspotstrippingoffanyirritatinghairspineeasilyconsumeddirectlyshareturndistributeoccupyreachmaturityspinsilkendometopmoltshortlythereafterfreedomsolefertilizeWatchAugustSeptembereasythoughgenderselbowtapergoldenrodSolidagothroughwortEupatoriumevidentextremevariabilitypairdeepmarkingvaryconsiderablyDNAaddingmudsituationinsteadclarifyingshownbelowgoinglumpEnjoywatchingunlessantagonizegivestandingtip-toeraisingmakeperfectlypeacefulneighborPosted2:40AMEmailThisBlogThis!ShareXShareFacebookSharePinterestLabelsnature6commentShandaSeptember820105:26lovedgetneverfacedcan'twaitkidquestionleftendhibernateproducedReplyDeleteRepliesReplyOutprairieSeptember8:02keepingcabbagewormseenRepliesReplyAnonymousSeptember132:06PMbecominghereUpperPeninsulaMichiganpendulumseemsswungagoeverywherevanishinglyrarehaven'tagainhouserightRepliesReplyL.RShimerSeptember4:35headgalworkeverybodyelsekindaegalitarianRepliesReplyLarryMay9:34directedBevWigneyBTWlivedNEMissouridetailedpresentedThankscogentscientificallyaccuratesummaryinsect'slife-cycleRepliesBugEricMay3:47kindcomplimentsDeleteRepliesReplyReplyAddcommentLoadBlogcurrentlyreplyreaderhimselfWorkingresolveNewerOlderSubscribeAtomDemonizedhosting4p.m.SaturdayJan20Room1124AcademicSurge455CrockerLanecampusAttendeeschatcheck50,000vespideight-millionfreefriendlyParkingestimate2000describedinhabit500undescribedheadline-grabbinggiantVespamandariniaformerlyAsiannewsmediadubbedmurderhornetconfuseidentifysheetexamplehiddenrodentburrowwallhuge100,00willscavengemeatsugarsodahamburgerroadopen-facedcommonlylocatedannualdiecabbagewormwhitesuperbmuchdeliveredpresentationwebsiteinterestedmechanismevolutionhoneyCurrentprojectinvolvenovosequencinggenometranscriptomegenomicepigeneticregulatingnutritionvirushealthholddoctorateIllinoisUrbana–ChampaignGeneRobinsonpostdoctoralChristinaGrozingerunwelcomeyardpatioPreferringlikebeneathSometimesleglessgrublikeoutstretchedhand15relativelyunaggressiveproblemdoorwaylistearlierlepidopterancarryyeastwinemakingfermentationflavorwinefuscatusrecognizedevotedmotherdotefuryopinionhuman-likegreatcooperatoroverallundercurrentselfishnessmanifestperfectthemselvesmushroomlearning/memory10photogenicpeerpetalvisitorcampSierraNevadamountainwitnessedstingingcrowdedtableahsippedwonderedsayselsewherewhichfertilizedmustwarmsenoughlotproteinbabyneedsurvivedbecausedrierusualdealcompetinggomaintenancemodemaintainfuellargelyuselessstartedmidtrapsprayingremoved--thisdonenighthollowavailablenearbyhopewetbarbecueshyexceptdoorwindowhigh-trafficTypicallymatedmidsummerphaserequireceasesweetthingnormallymildcoastalSanFranciscosurviveinformativeYouTubevideoDistinguishingseethosedistinctiveputanotherOaklandRaiders'logoGiantssoakingsunabandonedPollinatorsArtistsdelightoverhangneighborhoodthoughtWowhangingliptrashvanishedTwitterassociateOrganismalPolykatianna radicula
Polykatianna sp-nr-radicula is a flatid planthopper in the family Flatidae, a group of fulgoroid insects characterized by broad, often flattened wings and a distinctive waxy coating. Members of this genus occur in tropical and subtropical regions and are primarily associated with woody vegetation. The species epithet "radicula" suggests possible association with root systems or basal plant parts, though this requires confirmation. Flatid planthoppers are generally sap-feeders on phloem and serve as hosts for parasitoid wasps.
Priocnemini
Priocnemini is a tribe of spider wasps within the family Pompilidae, subfamily Ctenocerinae. Members are distinguished by elongated, slender bodies and long legs adapted for pursuing spider prey. The tribe includes numerous genera distributed across tropical and subtropical regions worldwide. These wasps are solitary hunters that paralyze spiders to provision nests for their larvae.
Proceratiinae
Proceratiine Ants
Proceratiinae is a subfamily of ants in the poneromorph group, established by Barry Bolton in 2003 when Ponerinae was divided into six subfamilies. It contains three extant genera—Discothyrea, Proceratium, and Probolomyrmex—plus one extinct genus (Bradoponera). Most species are tropical or subtropical with worldwide distribution. These ants are characterized by their cryptobiotic lifestyle, small colony sizes, and specialized predatory habits.
Progomphus
sanddragons
Progomphus is a genus of medium-sized dragonflies in the family Gomphidae, commonly known as sanddragons. The genus is distinguished among Gomphidae by its colored wings, a relatively rare trait in this family. Species are found primarily in tropical regions of the Americas, with adults typically observed near freshwater sandy beaches and pools.
Prokoenenia
microwhip scorpions
Prokoenenia is a genus of microwhip scorpions (order Palpigradi) in the family Prokoeneniidae, established by Carl Julius Bernhard Börner in 1901. The genus comprises six recognized species distributed across tropical and subtropical regions of North America, South America, and Southeast Asia. Members of this genus are among the smallest arachnids, inhabiting soil and leaf litter habitats. As with all palpigrades, they possess a characteristic whip-like flagellum on the first pair of walking legs.
Prorastriopes
Prorastriopes is a genus of globular springtails in the family Bourletiellidae, established in 1947. These Collembola are characterized by their rounded, compact body form typical of the Symphypleona order. The genus has been recorded across diverse tropical and subtropical regions including Africa, the Caribbean, and Florida.
Psamathia
Psamathia is a genus of moths in the family Uraniidae, subfamily Epipleminae. The genus was established by Francis Walker in 1861. Species in this genus are found in tropical and subtropical regions, particularly in Asia. The genus belongs to a family known for moths with distinctive wing shapes and often iridescent coloration.
Psamathia placidaria
Psamathia placidaria is a species of moth in the family Uraniidae. The genus Psamathia belongs to a small family of moths that includes both day-flying and nocturnal species. This species is known from a limited number of observations, suggesting it may be uncommon or restricted in distribution. Members of Uraniidae are often associated with tropical and subtropical regions.
Psara
Psara is a genus of moths in the family Crambidae, subfamily Spilomelinae. The genus was established by Snellen in 1875 and contains multiple species distributed across tropical and subtropical regions. These moths are generally small to medium-sized with characteristic wing patterns typical of the subfamily.
Pseudocaecilius
false lizard barklice
Pseudocaecilius is a genus of false lizard barklice comprising more than 50 described species. The genus belongs to the family Pseudocaeciliidae and occurs across tropical and subtropical regions. At least one species, P. citricola, constructs silken webs on leaf surfaces where egg-batches are deposited. The genus has been recorded from the Caribbean, Central America, South America, and Asia.
Pseudosphinx
tetrio sphinx, giant gray sphinx, frangipani hornworm, plumeria caterpillar, Rasta caterpillar
Pseudosphinx is a monotypic moth genus in the family Sphingidae, containing only Pseudosphinx tetrio. The genus is notable for its highly specialized herbivory on toxic Apocynaceae plants and its striking aposematic larval coloration. Adults are large brown sphinx moths with 12.7–14 cm wingspans. The caterpillars are among the largest hornworms in the Americas, exceeding 15 cm in length, and are serious defoliators of ornamental Plumeria species throughout the tropical and subtropical Americas.
Psychomyioidea
net-tube caddisflies
Psychomyioidea is a superfamily of caddisflies (Trichoptera) in the suborder Annulipalpia, commonly known as net-tube caddisflies. The superfamily comprises five families: Psychomyiidae, Xiphocentronidae, Dipseudopsidae, Polycentropodidae, and Pseudoneureclipsidae. Members are characterized by specialized antennal sensilla and larval case-building behavior using silk nets or tubes. The group is primarily distributed in tropical and subtropical regions worldwide, with significant diversity in the Neotropics, Oriental region, and Brazilian Amazon.
Rhinacloa manleyi
Rhinacloa manleyi is a species of plant bug in the family Miridae, described by Schuh & Schwartz in 1985. The genus Rhinacloa belongs to the diverse mirid subfamily Cylapinae, a group of small predatory or mycophagous bugs often associated with leaf litter and decaying vegetation. Records indicate presence across Middle America, North America, and South America including Brazil (Mato Grosso). Like other members of its genus, it likely inhabits tropical and subtropical forest floor environments.
Rhopalosomatidae
Rhopalosomatid Wasps
Rhopalosomatidae is a small family of aculeate wasps containing approximately 68 extant species in four genera: Rhopalosoma, Olixon, Liosphex, and Paniscomima. Adults are solitary and often ant-like in appearance. Larvae are obligate ectoparasitoids of crickets (Orthoptera: Grylloidea), attaching to the lateral side of the host between the metafemur and abdomen. The family exhibits remarkable morphological diversity, with winged species typically nocturnal and brachypterous species mainly diurnal. The family has a worldwide tropical and subtropical distribution, absent from Europe and Antarctica.
Rhynchophorini
Rhynchophorini is the largest tribe within the weevil subfamily Dryophthorinae. Members are characterized by a pygidium (the seventh abdominal tergite) that remains exposed and is not covered by the elytra. The tribe includes some of the largest weevils in the subfamily, notably significant agricultural pests such as grain weevils (Sitophilus) and palm weevils (Rhynchophorus). Historically, this group was treated as a distinct subfamily, Rhynchophorinae, within the family Dryophthoridae.
Russellaspis pustulans
oleander pit scale, fig pit scale, Akee Fringed Scale
Russellaspis pustulans, commonly known as the oleander pit scale or fig pit scale, is a parthenogenetic scale insect in the family Asterolecaniidae. It is highly polyphagous, feeding on plants across 69 families with documented preference for fig (Ficus carica) and oleander (Nerium oleander). The species is widely distributed in tropical and subtropical regions worldwide, completing 2-3 generations annually depending on environmental conditions. It is recognized as a pest of economic importance on fruit trees and ornamental plants, with feeding activity inducing characteristic pitting and galling on host tissues.
Saica elkinsi
Saica elkinsi is a species of assassin bug in the family Reduviidae, first described by Blinn in 1994. It is native to North America and belongs to the subfamily Saicinae, a group characterized by raptorial forelegs adapted for capturing prey. Members of the genus Saica are slender, long-legged predators found in tropical and subtropical habitats.
Salina
Salina is a genus of elongate-bodied springtails in the family Paronellidae, first described by MacGillivray in 1894. The genus contains approximately five described species. These springtails are distributed across tropical and subtropical regions including the Amazon, Andean regions, the Caribbean, and continental Southeast Asia. They are characterized by their slender, elongated body form typical of the Paronellidae family.
Scolioidea
Scoliid Wasp Superfamily
Scolioidea is a superfamily of Hymenoptera containing the family Scoliidae, a group of medium-sized wasps with approximately 560 species worldwide. The family is predominantly distributed in tropical and subtropical regions, with 64 species recorded in the New World. Scoliidae are ectoparasitoids of Scarabaeoidea larvae, particularly Melolonthinae (scarab beetles), which they immobilize and parasitize in terrestrial larval galleries. The superfamily has been taxonomically understudied in the Americas, with limited keys and ambiguous historical descriptions.
Scolopendra
Giant Centipedes
Scolopendra is a genus of large tropical centipedes in the family Scolopendridae, containing some of the largest living centipedes. The genus was established by Carl Linnaeus in 1758 and remains one of the most species-rich genera in the order Scolopendromorpha. Members are characterized by their substantial size, with the largest species exceeding 30 cm in length, and their potent venom delivered through modified forcipules. The genus exhibits considerable variation in coloration and size across its constituent species.
Scytodes longipes
Long-legged Spitting Spider
Scytodes longipes is a tropical spitting spider distinguished by its long legs and specialized prey-capture behavior. Unlike short-legged Scytodes species that are ground-dwelling hunters, this species constructs tangled, sheet-like webs similar to cellar spiders (Pholcidae). It has been introduced well beyond its native range, establishing populations on Pacific Islands, in Africa, Southeast Asia, and Australia. The species is notable for its communal tendencies and unique spitting mechanism that immobilizes prey with adhesive venom.
Selenophorus fabricii
Selenophorus fabricii is a species of ground beetle in the family Carabidae, described in 2017. The species is known from the Caribbean region, including the Cayman Islands, Hispaniola, and the Lesser Antilles. As a member of the genus Selenophorus, it belongs to a diverse group of small to medium-sized ground beetles commonly found in tropical and subtropical regions. Very little is known about the specific biology or ecology of this recently described species.
Selenothrips
red-banded thrips (for S. rubrocinctus)
Selenothrips is a genus of thrips in the family Thripidae, established by Heinrich Hugo Karny in 1911. The genus contains at least two described species: S. rubrocinctus (Giard, 1901), commonly known as the red-banded thrips or cacao thrips, and S. glabratus Priesner, 1927. S. rubrocinctus is a polyphagous pest with broad tropical and subtropical distribution, known to attack cacao, cashew, mango, avocado, and other crops. Research on this species has focused on its feeding behavior in relation to plant water-stress and amino acid availability.
Sericothripinae
Sericothripinae is a largely tropical subfamily of thrips (Thysanoptera: Thripidae) comprising approximately 140 species. Members are often strikingly bicoloured with complex surface sculpture. Currently only three genera are recognised: Sericothrips (introduced to Australia, with one European species used as weed biological control agent), Hydatothrips (43 species worldwide, including species associated with native vines), and Neohydatothrips (96 species worldwide). The biology of this group is poorly known.
Sikaianini
Sikaianini is a tribe of small, delicate planthoppers in the family Derbidae, comprising 6 genera and 34 species as of 2025. Members are among the smallest derbids, with body lengths of 1.5–2.5 mm and forewings 4–6 mm. The tribe is characterized by eyes that extend forward to reach or nearly reach the clypeus, unusual forewing venation with fused subcosta and radius veins, and short hind wings less than half the length of the forewings. Adults have been observed feeding on palm trees, though nymphal biology remains unknown.
Siproeta epaphus
Rusty-tipped Page, Brown Siproeta
Siproeta epaphus, commonly known as the rusty-tipped page or brown siproeta, is a New World butterfly species in the family Nymphalidae. It is a tropical butterfly with large wings averaging 7.0–7.5 cm in wingspan, characterized by striking black, brown, white, and rusty orange coloration. The species is resident year-round in tropical habitats and ranges from southern North America through Central America to central South America. Three subspecies are recognized, with the nominate subspecies S. epaphus epaphus being the most widespread and displaying the characteristic rusty orange wing tips.
Smeringopus pallidus
Pale Daddy-Long-Leg, Pale Cellar Spider
Smeringopus pallidus is a cosmopolitan cellar spider (family Pholcidae) known for its distinctive pale coloration and extremely long, slender legs. The species builds irregular, three-dimensional cobwebs in sheltered locations and exhibits specialized anti-predator defenses including rapid leg waving, leg autotomy with continued movement of detached legs as visual distraction, and thanatosis (death feigning). Originally described from Africa, it has been introduced to tropical and subtropical regions worldwide including South America, the Caribbean, Sri Lanka, Southeast Asia, Australia, and Pacific islands. The species reaches body lengths up to 7 mm with females larger than males, and is characterized by purple spots along the dorsal abdomen and a dark ventral sternal stripe.
Soa flaviterminata
Soa flaviterminata is a species of booklouse in the family Lepidopsocidae, described by Enderlein in 1906. It belongs to the order Psocodea, a group of small, often overlooked insects that includes both parasitic lice and free-living barklice and booklice. The species is placed in the suborder Trogiomorpha, a lineage characterized by reduced wing venation and other derived features. Like other members of its family, it likely inhabits sheltered microhabitats in tropical or subtropical environments.
Sparasionidae
Sparasionidae is a family of parasitic wasps in the superfamily Platygastroidea. The family contains five extant genera—Sparasion, Mexon, Listron, Sceliomorpha, and Archaeoteleia—plus one extinct genus (Electroteleia) known from Eocene Baltic amber. The genus Sparasion is the most diverse with 141 valid species. All known species are egg parasitoids of orthopterans, specifically katydids (Tettigoniidae). The family exhibits a disjunct distribution, occurring in the Nearctic, Palearctic, Afrotropical, and Oriental regions but absent from the Neotropics and Australasia.
Sphenarches anisodactylus
geranium plume moth, fire-flag plume moth
Sphenarches anisodactylus is a small plume moth in the family Pterophoridae with a wingspan of approximately 10 mm. It has a remarkably broad distribution spanning tropical and subtropical regions across multiple continents. The species is known to feed on flower buds and flowers of diverse plant families, with larvae recorded from over a dozen host plants including ornamental, agricultural, and wild species. Its common names reflect association with geraniums (Pelargonium) and fire-flag (Thalia geniculata).
Spilomelini
Spilomelini is a tribe of moths in the family Crambidae, subfamily Spilomelinae, erected by Achille Guenée in 1854. The tribe currently comprises 17 genera containing approximately 135 described species. Members are distributed across tropical and subtropical regions worldwide. The tribe includes several economically significant agricultural pests, particularly in the genus Cnaphalocrocis.
Spirostreptida
Spirostreptida is an order of large, cylindrical millipedes containing approximately 1000 described species, making it the third largest order of millipedes. Members are characterized by their elongated bodies with 30 to 90 body rings and generally large size, including the longest known millipedes such as the giant African millipedes of genus Archispirostreptus, which may exceed 30 cm. The order is divided into two suborders, Cambalidea and Spirostreptidea, with most species occurring in tropical and subtropical regions. Spirostreptida are primarily soil-dwelling detritivores, though some species inhabit caves.
Spirostreptidae
Flatplate Millipedes
Spirostreptidae is a family of large millipedes in the order Spirostreptida, commonly known as flatplate millipedes. The family comprises approximately 100 genera distributed across tropical and subtropical regions of the Americas, Africa, Madagascar, Seychelles, and the eastern Mediterranean. Members are characterized by their elongated cylindrical bodies and are primarily soil-dwelling detritivores, though some species exhibit arboreal habits. The family includes both synanthropic species that can become urban pests and species with specialized thermoregulatory and social behaviors.
Stenodontes chevrolati
Chevrolat's tropical long-horned beetle
Stenodontes chevrolati is a species of long-horned beetle in the family Cerambycidae, subfamily Prioninae. It is one of the largest cerambycid species in North America, with males reaching substantial size. The species occurs in the Caribbean and southern North America, where adults are attracted to lights and have been documented in oak woodland habitats. Larval development occurs in living oak trees, with adults emerging after several years of subterranean feeding on roots.
Stenopodainae
Stenopodainae is a subfamily of assassin bugs (Reduviidae) containing approximately 113 genera and ~770 species worldwide. Members are predominantly tropical, with many species associated with soil or sand substrates. The subfamily is characterized by distinctive morphological features including prominent mandibular plates and a modified antennal structure. Many species exhibit wing reduction (aptery) and cryptic coloration. Some species have been observed to use plant-derived resin on their forelegs to aid in prey capture.
Stimulopalpus
tropical barklice
Stimulopalpus is a genus of tropical barklice in the family Amphientomidae, containing at least 30 described species. Members of this genus are small, wingless or weakly winged insects that inhabit tropical environments. They belong to the order Psocodea, which includes barklice, booklice, and parasitic lice. The genus was established by Enderlein in 1906 and represents one of the more species-rich genera within its family.
Striglininae
Striglininae is a subfamily of moths within the family Thyrididae, a group commonly known as picture-winged or window-winged moths. These moths are characterized by distinctive wing patterns that often feature transparent or semi-transparent areas. The subfamily contains multiple genera distributed primarily in tropical and subtropical regions. Striglininae moths are part of the superfamily Thyridoidea, a relatively small but morphologically diverse lineage of Lepidoptera.
Strigoptera bimaculata
Strigoptera bimaculata is a tropical jewel beetle (Buprestidae) and the type species of its genus. It belongs to the tribe Polycestini. The species has been documented across Southeast Asia extending to Northern Australia, with a westernmost record from Madurai, Tamil Nadu, India. Available information is limited primarily to taxonomic and distributional data.
Strumigenys pilinasis
Hairy-snouted Mustache Ant
Strumigenys pilinasis is a species of trap-jaw ant in the family Formicidae, first described by Auguste Forel in 1901. The species is characterized by its distinctive pilose (hairy) snout, which gives rise to its common name. Like other members of the genus Strumigenys, it possesses elongated mandibles capable of rapid closure to capture prey. The species has been historically classified under the genus Pyramica, which is now treated as a synonym of Strumigenys. It belongs to a diverse genus containing over 850 described species, many of which remain poorly known.
Symphytognathidae
dwarf orbweavers, micro orb-weavers
Symphytognathidae is a family of extremely small spiders (body size typically 1 mm or less, with Patu digua at 0.37 mm among the smallest known spiders). The family contains approximately 105 species in ten genera, including Crassignatha, Patu, Anapistula, and Micropholcomma. Members construct minute orb webs, often suspended between dead leaves in leaf litter or between vegetation. The family was historically placed in various superfamilies but molecular phylogenetics supports placement within Araneoidea, with affinities to Theridiosomatidae and Anapidae.
Syscia augustae
Syscia augustae is a species of doryline ant originally described by Wheeler in 1902 as Cerapachys augustae. The species was transferred to the genus Syscia following taxonomic revision of the doryline ants. It belongs to the subfamily Dorylinae, a group known for army ant-like behaviors including group foraging and nomadic colony cycles. Very few observations of this species have been documented, with most records originating from Brazil.
Tanaostigmatidae
Tanaostigmatidae is a small family of chalcidoid wasps comprising approximately 90 species in 9 genera. Unlike most chalcidoids, they are almost exclusively phytophagous rather than parasitoid, inducing galls in plant stems, leaves, or seeds. The family is primarily distributed in tropical and subtropical regions. Members are typically short, squat wasps with distinctive morphological features including a protruding prepectus and a strongly arched mesonotum that renders the pronotum nearly vertical.
Tapinoma melanocephalum
Ghost ant
Tapinoma melanocephalum, commonly known as the ghost ant, is a minute ant species recognized by its distinctive bicolored appearance: dark brown head and thorax contrasting with pale, translucent legs, antennae, and gaster. Native to tropical regions of Africa and Asia, it has become a globally distributed "tramp" species through human commerce, establishing populations in greenhouses, heated buildings, and tropical urban environments worldwide. The species is considered a significant household pest, particularly in Florida and Hawaii, where it nests indoors and forages for sweet foods. Recent taxonomic revision has revealed that what was long considered T. melanocephalum actually comprises two cryptic species, with T. pithecorum described as new in 2020.
Terastia
Terastia is a genus of snout moths (Crambidae) comprising eight species distributed across tropical regions worldwide. First described by Achille Guenée in 1854 with Terastia meticulosalis as the type species, the genus is currently classified within the tribe Margaroniini. Species occur in the Neotropical, Afrotropical, and Oriental realms as well as Australasia. Caterpillars are known to feed exclusively on Erythrina species (Fabaceae), a trait shared with related genera Agathodes and Liopasia.
Tetragnatha
Stretch Spiders, Long-jawed Orb Weavers
Tetragnatha is a large genus of long-jawed orb-weaving spiders with hundreds of species distributed worldwide, though most occur in tropical and subtropical regions. These spiders are characterized by their elongated bodies, extremely long legs, and notably elongated chelicerae (jaws) with well-developed teeth. They construct horizontal orb webs, often near water, and many species can run across water surfaces. The genus exhibits remarkable variation in dispersal ability, with some species being excellent dispersers capable of colonizing islands, while others appear to have secondarily lost this capacity. Hawaiian Tetragnatha species have undergone adaptive radiation, with some lineages evolving cursorial (running) behavior and abandoning web-building entirely.
spiderorb-weaverlong-jawedaquaticstretch-spideradaptive-radiationHawaiicursorial-evolutionhorizontal-webwater-walkingcamouflagemultivoltinesocial-spiderTetragnathidaeAraneaeArachnidapredatorinsectivoreriparianwetlandmeadowtropicalsubtropicalcosmopolitandispersalisland-colonizationphylogeographychemical-species-recognitioncommunal-webbingkleptoparasitism-targetTetramorium lanuginosum
Downy Pennant Ant
Tetramorium lanuginosum is a species of ant in the family Formicidae, first described by Mayr in 1870. The species is distributed across the Caribbean region and the Galápagos Islands, with confirmed presence in Antigua and Barbuda, Barbados, Cuba, and Spain (likely referring to the Canary Islands). It belongs to the genus Tetramorium, a diverse group of myrmicine ants commonly known as pavement ants or pennant ants. The common name "Downy Pennant Ant" refers to the species' characteristic appearance.
Thelyphonidae
whipscorpions, vinegaroons, whip-scorpions
Thelyphonidae is the sole family of the arachnid order Uropygi (Thelyphonida), containing approximately 140 described species in 25 genera (16 extant, 9 fossil). Members are commonly known as whipscorpions or vinegaroons due to their whip-like flagellum and defensive secretion of acetic acid. The family is divided into four subfamilies: Hypoctoninae, Mastigoproctinae, Thelyphoninae, and Typopeltinae. Despite their conspicuous appearance and wide tropical distribution, systematic knowledge of the group has advanced slowly.
Tholymis
Tholymis is a genus of medium-sized dragonflies in the family Libellulidae. Species are tropical in distribution and exhibit crepuscular activity patterns, being most active at dawn and dusk. The genus was established by Hagen in 1867.
Tortopus
Tortopus is a genus of burrowing mayflies in the family Polymitarcyidae, restricted to six species based on cladistic revision: T. igaranus, T. circumfluus, T. harrisi, T. zottai, T. bellus, and T. arenales. The genus is characterized by distinctive morphological synapomorphies including female parastyli receptors with long anterior furrows, entirely flattened penes, and nymphs bearing two subapical tubercles on mandibular tusks. Nymphs construct U-shaped tunnels in clay banks, a behavior that renders them difficult to sample with standard aquatic survey methods.
EphemeropteraPolymitarcyidaeburrowing-mayfliesNeotropicalclay-bank-habitatU-shaped-tunnelsmandibular-tusksTortopsisCampsurinaePanamerican-distributioncladistic-revisionsynapomorphyparastyli-receptorsflattened-penesfurcasternal-protuberancessubapical-tubercleslimnological-sampling-biasnymph-morphologyadult-morphologytype-species-T.-igaranusnew-species-T.-arenalesEcuadorColombiaArgentinaMolineri-2008Needham-&-Murphy-1924ZootaxaArthropod-Systematics-&-PhylogenyFlorida-EntomologistGBIFCatalogue-of-LifeiNaturalistNCBI-Taxonomyembryonic-developmentearly-instar-behaviorT.-harrisiT.-bellusT.-circumfluusT.-zottaiT.-igaranusT.-incertusT.-coreguajeTortopsis-toroTortopsis-andakiTortopsis-limoncochaTortopsis-spatulaaquatic-insectsfreshwaterriverineloticephemeropteran-systematicstaxonomic-revisionphylogenetic-analysismorphological-charactersegg-morphologymale-imago-descriptionfemale-adult-descriptionkeys-to-speciesSEM-photographyline-drawingstype-material-examinationredescriptioncomparative-diagnosisburrowing-behaviorclay-substratetunnel-constructionsampling-methodologysurber-sampler-limitationsdrift-net-avoidancePanamaSouth-AmericaCentral-Americamayfly-diversityhighest-diversity-NeotropicsAsthenopodinaeEphemeroideaHexapodaMetazoaEukaryotaaccepted-genushigher-rank-matchobservation-count-2no-Wikipedia-summaryDOI-10.11646/zootaxa.2481.1.1DOI-10.11646/zootaxa.2436.1.4DOI-10.3897/asp.79.e62735DOI-10.2307/3493493Scott-et-al.-1959NavásUlmerTraverLugo-Ortiz-&-McCaffertyDomínguezBanksMcDunnoughPictetNeedham-&-Murphyfreshwater-ecologyaquatic-entomologyinsect-developmentnymphal-stagesimago-descriptionalate-adultswing-venationR-sectorgonopore-structureparastyli-lengthpedestal-morphologylateral-view-curvaturemandibular-morphologytusk-tuberclesmesosternal-structureabdominal-sternum-notchfurcasternumprotuberance-configurationreceptor-socket-orientationIR-veinR2-veinclaw-like-structuregonopore-associationpenis-base-separationfemale-fore-wingadditional-veinscomparative-morphologytype-specimenholotypeallotypeparatypeneotropical-speciesnew-species-descriptionspecies-keyidentification-keymale-adult-keyfemale-adult-keynymph-keygeneric-keyPolymitarcyidae-generasystematicsphylogenycladisticsmonophylysister-groupcharacter-statetransformation-seriesparsimony-analysismorphological-data-setexternal-morphologyegg-chorionmicropyleegg-bursterhatchingemergencebehavioral-studyearly-instarembryologyovipositionsubstrate-preferencehabitat-specificityendemicregional-diversityconservationbiomonitoringwater-quality-indicatormacroinvertebratebenthicinfaunalinterstitialhyporheicriver-bankstream-bankerosionsedimentparticle-sizeclay-contentbank-stabilityroot-matvegetation-associationflow-regimecurrent-velocitydepthwidthstream-ordercatchmentbasinecoregionbiogeographydispersalcolonizationvicariancespeciationadaptive-radiationmorphological-divergenceconvergent-evolutionhomoplasycharacter-conflictbootstrap-supportBremer-supportconsensus-treestrict-consensusmajority-ruletaxonomic-stabilitynomenclatural-actoriginal-descriptionsubsequent-designationtype-localitytype-depositorymuseum-collectionspecimen-preservationalcohol-preservationslide-mountingSEM-preparationimaging-techniquesscientific-illustrationphotographymeasurementmorphometricsratiosproportionsallometrysexual-dimorphismgeographic-variationintraspecific-variationinterspecific-variationdiagnostic-charactersidentification-confidencetaxonomic-expertiseliterature-reviewbibliographic-searchdatabase-queryonline-repositoryopen-accesspaywallabstract-onlyfull-text-unavailablecitation-analysisreference-listsource-qualityevidence-strengthknowledge-gapresearch-needfuture-studycollaborationfield-workcollection-tripsampling-effortspecimen-availabilitytype-examinationrevision-scopetaxonomic-conceptcircumscriptioninclusionexclusionspecies-groupspecies-complexcryptic-speciesmorphospeciesphylogenetic-speciesevolutionary-significant-unitoperational-taxonomic-unitDNA-barcodingmolecular-systematicsintegrative-taxonomytraditional-taxonomyalpha-taxonomybeta-taxonomygamma-taxonomyclassification-hierarchyLinnaean-systemrank-based-nomenclaturephylogenetic-nomenclatureclade-namecrown-groupstem-grouptotal-evidencecongruenceincongruencedata-partitioncharacter-weightingimplied-weightingequal-weightingordered-charactersunordered-charactersmultistate-charactersbinary-characterscontinuous-charactersmeristic-charactersqualitative-charactersquantitative-charactersmorphological-matrixdata-matrixcharacter-matrixtaxon-samplingcharacter-samplingmissing-datainapplicable-datapolymorphismintraspecific-polymorphismfixed-differencediagnostic-differenceunique-derived-characterautapomorphyshared-derived-charactersymplesiomorphyconvergent-characterparallel-evolutionreversalcharacter-optimizationACCTRANDELTRANunambiguous-optimizationambiguous-optimizationmost-parsimonious-treetree-lengthconsistency-indexretention-indexrescaled-consistency-indexhomoplasy-indexcharacter-fitcharacter-congruencecharacter-supportbranch-supportnode-supportclade-stabilitytaxonomic-stability-indexphylogenetic-signalnoisesaturationsubstitution-modelrate-heterogeneityamong-site-rate-variationgamma-distributioninvariant-sitesmodel-selectionAkaike-information-criterionBayesian-information-criterionlikelihood-ratio-testBayesian-inferenceMarkov-chain-Monte-Carloposterior-probabilityprior-probabilityhyperpriorconvergenceeffective-sample-sizeburn-instationaritytrace-plotparameter-estimatecredible-intervalhighest-posterior-densitytree-topologytree-shapelineage-through-timediversification-rateextinction-ratespeciation-ratenet-diversificationbirth-death-modelYule-modelcoalescent-modelpopulation-sizeeffective-population-sizegene-flowmigration-rateisolation-by-distancephylogeographyhistorical-biogeographyancestral-area-reconstructiondispersal-vicariance-analysisdecisive-weightingevent-based-methodtaxon-area-cladogramarea-cladogrambiogeographic-homologytrack-analysispanbiogeographyphylogenetic-biogeographyecological-biogeographydispersal-biogeographyvicariance-biogeographycenter-of-originarea-of-endemismrefugiumPleistoceneglaciationclimate-changehabitat-fragmentationhabitat-lossanthropogenic-impactpollutioneutrophicationsedimentationdam-constructionwater-abstractionflow-modificationthermal-pollutiontoxic-substancesheavy-metalspesticidesurbanizationagriculturedeforestationland-use-changeriparian-degradationchannelizationdredgingmininginvasive-speciesbiological-invasioncompetitionpredationparasitismmutualismcommensalismamensalismfacilitationecosystem-engineerkeystone-speciesflagship-speciesumbrella-speciesindicator-speciessentinel-speciesbioindicatorecological-indicatorenvironmental-indicatorwater-quality-indexbiotic-indexmultimetric-indexrapid-bioassessmentprotocolstandardizationquality-assurancequality-controlreference-conditionleast-disturbedminimally-disturbedbest-availabletype-specificregion-specificstream-typeriver-typefunctional-feeding-groupcollector-gatherercollector-filtererscrapershredderpredatorparasiteengulferpiercerburrowersprawlerclingerswimmerskaterdiversurface-dwellerbenthic-dwellerinterstitial-dwellerhyporheic-dwellerphreatic-dwellertroglobitestygobitecave-inhabitantspring-inhabitantheadwatermid-orderhigh-orderlowlandmontanealpinesubtropicaltropicaltemperateborealarcticantarcticpalearcticnearcticafrotropicalorientalaustralianoceaniccosmopolitanwidespreadrestrictedrelictdisjunct-distributionrange-extensionnew-recordfirst-recordcountry-recordstate-recordprovince-recordlocality-recordelevation-recordaltitudinal-rangelatitudinal-rangelongitudinal-rangedistribution-patternrange-sizerange-fillextent-of-occurrencearea-of-occupancyIUCN-categorythreat-statusdata-deficientnot-evaluatedleast-concernnear-threatenedvulnerableendangeredcritically-endangeredextinct-in-wildextinctpopulation-trendpopulation-densitypopulation-structureage-structuresize-structuresex-ratioreproductive-outputfecundityfertilitymortalitysurvivorshiplife-tablecohort-analysisgeneration-timedoubling-timeintrinsic-rate-of-increasefinite-rate-of-increasenet-reproductive-ratestable-age-distributionstationary-populationexpanding-populationdeclining-populationsource-sink-dynamicsmetapopulationpopulation-viability-analysisminimum-viable-populationgenetic-diversityheterozygosityallelic-richnessprivate-allelefounder-effectbottleneckgenetic-driftinbreedinginbreeding-depressionoutbreedingoutbreeding-depressionhybridizationintrogressiongene-flow-barrierreproductive-isolationprezygotic-isolationpostzygotic-isolationmechanical-isolationtemporal-isolationhabitat-isolationbehavioral-isolationgametic-isolationzygotic-mortalityhybrid-inviabilityhybrid-sterilityhybrid-breakdownreinforcementcharacter-displacementecological-speciationallopatric-speciationsympatric-speciationparapatric-speciationperipatric-speciationcentrifugal-speciationdivergence-with-gene-flowspeciation-continuumanagenesiscladogenesisbudding-speciationbranching-speciationphyletic-gradualismpunctuated-equilibriumstasistrendprogressionorthogenesisaristogenesismosaic-evolutionco-evolutionarms-raceRed-Queen-hypothesisevolutionary-stable-strategyfrequency-dependent-selectiondensity-dependent-selectionr-selectionK-selectionbet-hedgingiteroparitysemelparityploidy-levelchromosome-numberkaryotypegenome-sizetransposable-elementgene-duplicationneofunctionalizationsubfunctionalizationpseudogeneregulatory-evolutioncis-regulatorytrans-regulatoryenhancerpromotersilencerinsulatortranscription-factorsignaling-pathwaydevelopmental-pathwaygene-networkepigenetic-modificationDNA-methylationhistone-modificationchromatin-remodelinggenomic-imprintingparental-effectmaternal-effectpaternal-effectcytoplasmic-inheritancemitochondrial-DNAchloroplast-DNAendosymbiontWolbachiaRickettsiaSpiroplasmaCardiniumArsenophonusHamiltonellaRegiellaSerratiaBuchneraCarsonellaPortieraprimary-endosymbiontsecondary-endosymbiontfacultative-symbiontobligate-symbiontmutualistic-symbiontparasitic-symbiontcommensal-symbiontpathogenvectordisease-transmissionzoonosisemerging-infectious-diseasebiosecurityquarantineeradicationcontrolmanagementconservation-biologyrestoration-ecologyhabitat-restorationriver-restorationstream-restorationfloodplain-restorationriparian-restorationwetland-restorationecosystem-restorationpassive-restorationactive-restorationassisted-recoverymanaged-relocationassisted-colonizationex-situ-conservationin-situ-conservationprotected-areanational-parknature-reservewildlife-refugebiosphere-reserveworld-heritage-siteramsar-siteimportant-bird-areakey-biodiversity-areaAlliance-for-Zero-ExtinctionEDGE-speciesevolutionarily-distinctglobally-endangeredconservation-prioritizationsystematic-conservation-planningMarxanZonationconservation-opportunityconservation-costconservation-benefittrade-offsocioeconomic-factorstakeholder-engagementcommunity-based-conservationadaptive-managementmonitoring-programlong-term-studycitizen-sciencepublic-participationenvironmental-educationoutreachscience-communicationknowledge-transfercapacity-buildinginstitutional-strengtheningpolicy-developmentlegislationregulationenforcementcomplianceincentivepayment-for-ecosystem-servicescarbon-creditbiodiversity-offsetmitigation-bankingconservation-easementland-trustprivate-land-conservationconservation-covenantstewardshipsustainable-usesustainable-managementecosystem-based-managementintegrated-water-resources-managementbasin-managementcatchment-managementlandscape-managementseascape-managementconnectivity-conservationcorridorstepping-stonebuffer-zonematrix-managementcountryside-biogeographyreconciliation-ecologynovel-ecosystemdesigner-ecosystemecosystem-serviceprovisioning-serviceregulating-servicesupporting-servicecultural-servicefood-productionwater-supplyraw-materialsgenetic-resourcesmedicinal-resourcesornamental-resourcesair-quality-regulationclimate-regulationwater-regulationerosion-regulationwater-purificationwaste-treatmentdisease-regulationpest-regulationpollinationseed-dispersalhabitat-provisionnutrient-cyclingsoil-formationprimary-productionrecreationtourismaesthetic-valuespiritual-valueeducational-valuescientific-valueinspirationsense-of-placecultural-heritagetraditional-knowledgeindigenous-knowledgelocal-knowledgeecosystem-service-valuationeconomic-valuationcontingent-valuationchoice-experimentbenefit-transfertotal-economic-valueuse-valuenon-use-valuedirect-useindirect-useoption-valuebequest-valueexistence-valuewillingness-to-paywillingness-to-acceptcost-benefit-analysiscost-effectiveness-analysismulti-criteria-analysisdecision-supportuncertaintyrisk-assessmentscenario-analysissensitivity-analysisrobustness-analysisadaptive-capacityresiliencevulnerabilityexposuresensitivitycoping-capacitytransformationsocial-ecological-systemcomplex-adaptive-systemtipping-pointregime-shiftalternative-stable-statehysteresispath-dependencelegacy-effectslow-variablefast-variablepanarchyadaptive-cycleexploitationreleasereorganizationforesightanticipatory-governancetransformative-changesustainability-sciencefuture-earthinterdisciplinarytransdisciplinaryproblem-orientedsolution-orientedaction-orientedknowledge-co-productionboundary-workboundary-objectboundary-organizationscience-policy-interfacescience-society-interfaceknowledge-brokerageknowledge-exchangeknowledge-integrationmode-1-sciencemode-2-sciencetriple-helixquadruple-helixresponsible-innovationreflexive-governanceadaptive-governancecollaborative-governancepolycentric-governancenetwork-governanceself-organizationcollective-actioncommon-pool-resourcetragedy-of-the-commonssocial-dilemmainstitutional-analysisinstitutional-designOstrom-design-principlesmonitoringsanctioningconflict-resolutionnested-enterprisesproportionalitycollective-choiceconstitutional-choiceoperational-choicecollective-action-theorygame-theoryprisoner's-dilemmachicken-gameassurance-gamecoordination-gameevolutionary-game-theoryreplicator-dynamicsESSNash-equilibriumPareto-optimalitysocial-optimummarket-failuregovernment-failurevoluntary-failurenon-market-valuepublic-goodcommon-goodclub-goodprivate-goodrivalryexcludabilityfree-riderhold-up-problemmoral-hazardadverse-selectioninformation-asymmetrytransaction-costproperty-rightcommon-propertystate-propertyprivate-propertyhybrid-propertybundle-of-rightsusufructaccesswithdrawalalienationtenure-securityland-tenurewater-tenureresource-tenurecustomary-tenurestatutory-tenurelegal-pluralismde-factode-jureformalinformallegalitylegitimacyrecognitiondeviancecorruptionelite-capturesocial-capitalbonding-capitalbridging-capitallinking-capitaltrustreciprocityreputationsocial-networksocial-embeddednessstructural-holebrokerageclosurecohesiondensitycentralitybetweennessdegreeeigenvectorPageRanksmall-worldscale-freerandom-networkregular-networkhierarchical-networkmodularitycommunity-structureclusteringassortativityhomophilyheterophilypreferential-attachmentfitness-modelnetwork-evolutionnetwork-dynamicstemporal-networkmultilayer-networkmultiplex-networkbipartite-networkaffiliation-networkone-mode-networktwo-mode-networkadjacency-matrixedge-listgraph-theoryvertexedgenodelinktieconnectionpathcycletreeforestcomponentgiant-componentpercolationphase-transitioncriticalityself-organized-criticalitypower-lawheavy-tailPareto-distributionlognormal-distributionexponential-distributionPoisson-distributionbinomial-distributionnormal-distributionGaussian-distributionstatistical-distributionprobability-distributioncumulative-distributionprobability-density-functioncumulative-distribution-functionsurvival-functionhazard-functionmomentmeanmedianmodevariancestandard-deviationcoefficient-of-variationskewnesskurtosisquantilepercentiledecilequartileinterquartile-rangerangeminimummaximumoutlierrobust-statisticparametric-testnon-parametric-testhypothesis-testingnull-hypothesisalternative-hypothesissignificance-levelp-valueconfidence-intervaltype-I-errortype-II-errorstatistical-powereffect-sizesample-sizesampling-designexperimental-designobservational-studyquasi-experimentnatural-experimentrandomized-controlled-trialbefore-after-control-impactBACIimpact-assessmentenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmentlife-cycle-assessmentcarbon-footprintwater-footprintecological-footprintmaterial-flow-analysissubstance-flow-analysisenergy-analysisexergy-analysisemergy-analysisinput-output-analysisenvironmentally-extended-input-outputsocial-accounting-matrixcomputable-general-equilibriumagent-based-modelsystem-dynamics-modelBayesian-networkstructural-equation-modelpath-analysisfactor-analysisprincipal-component-analysiscluster-analysisdiscriminant-analysiscanonical-correspondence-analysisredundancy-analysisnon-metric-multidimensional-scalingordinationclassificationregression-analysislinear-regressionnonlinear-regressiongeneralized-linear-modelgeneralized-additive-modelmixed-effects-modelmultilevel-modelhierarchical-modelBayesian-hierarchical-modelstate-space-modelhidden-Markov-modeltime-series-analysisspatial-analysisgeostatisticskrigingvariogramspatial-autocorrelationMoran's-IGeary's-cGetis-Ord-Gilocal-indicator-of-spatial-associationLISAhot-spotcold-spotspatial-clusterspatial-outlieredge-effectboundary-effectmodifiable-areal-unit-problemMAUPecological-fallacyatomistic-fallacycross-scale-inferenceupscalingdownscalingscaling-lawallometric-scalingfractalfractal-dimensionself-similaritymulti-fractallacunarityroughnesstexturepatternprocesspattern-process-relationshipneutral-modelnull-modelrandomization-testpermutation-testbootstrapjackknifecross-validationmodel-averagingmodel-comparisoninformation-criterionBayesian-model-averagingensemble-modelingconsensus-modelpredictionforecastprojectionscenarionarrative-scenarioquantitative-scenariostorylineshared-socioeconomic-pathwayrepresentative-concentration-pathwayemission-scenarioclimate-scenarioimpact-scenarioadaptation-scenariomitigation-scenariotransformation-scenariobackcastingforecastingtrend-extrapolationexpert-judgmentDelphi-methodparticipatory-modelingstakeholder-analysisinfluence-diagramconceptual-modelmental-modelsystem-archetypeleverage-pointintervention-pointpolicy-instrumenteconomic-instrumentregulatory-instrumentvoluntary-instrumentinformation-instrumentmarket-based-instrumentcommand-and-control-instrumentsubsidytaxchargefeelevydeposit-refundtradable-permitemission-tradingcarbon-taxbiodiversity-bankingconditional-cash-transfercommunity-based-natural-resource-managementjoint-forest-managementco-managementadaptive-co-managementtransboundary-managementinternational-regimeglobal-governancemultilateral-environmental-agreementconventiontreatycartagena-protocolnagoya-protocolAichi-targetsustainable-development-goalSDGpost-2020-global-biodiversity-frameworkKunming-Montreal-global-biodiversity-framework30-by-30-targetnature-based-solutionNbSecosystem-based-adaptationecosystem-based-mitigationgreen-infrastructureblue-infrastructurenatural-infrastructurehybrid-infrastructureclimate-smart-agricultureclimate-smart-landscapeclimate-smart-developmentlow-carbon-developmentgreen-economycircular-economybioeconomyblue-economysustainable-consumptionsustainable-productionlife-cycle-thinkingcradle-to-cradleindustrial-ecologyindustrial-symbiosisurban-metabolismsocio-ecological-metabolismmaterial-intensityenergy-intensitycarbon-intensitydecouplingabsolute-decouplingrelative-decouplingresource-efficiencyeco-efficiencyeco-innovationgreen-technologyclean-technologyenvironmental-technologyappropriate-technologyparticipatory-technologytechnology-transfertechnology-diffusioninnovation-systemnational-innovation-systemsectoral-innovation-systemtechnological-innovation-systemsocio-technical-systemsocio-technical-transitionmulti-level-perspectiveniche-innovationregimelandscapetransition-managementstrategic-niche-managementtransition-experimentliving-labreal-world-laboratoryurban-living-labrural-living-labsustainability-transitionfundamental-changesystem-innovationdirectionalityreflexivityresponsivenessanticipationlearning-by-doingdoing-by-learningsocial-learningorganizational-learningpolicy-learningtransformative-capacitycapacity-developmentinstitutional-learningevolutionary-governanceinstitutional-changepath-dependencylock-incarbon-lock-intechnological-lock-ininstitutional-lock-inbehavioral-lock-incultural-lock-inunlockingdestabilizationphase-outdivestmentstranded-assetjust-transitiontransition-pathwaytransition-scenariodeep-decarbonizationnet-zerocarbon-neutralclimate-neutralnature-positivebiodiversity-positiverestoration-positiveregenerativecirculardoughnut-economicsplanetary-boundarysafe-operating-spaceenvironmental-ceilingsocial-foundationintergenerational-equityintragenerational-equitydistributive-justiceprocedural-justicerecognition-justiceenvironmental-justiceclimate-justiceenergy-justicewater-justicefood-justicespatial-justiceterritorial-justiceecological-justicespecies-justiceintersectionalityadaptationmitigationsustainabilitysustainable-developmentwell-beinghuman-developmentcapability-approachhuman-securityenvironmental-securityclimate-securitywater-securityfood-securityenergy-securitylivelihood-securitydisaster-risk-reductionclimate-change-adaptationclimate-change-mitigationloss-and-damageclimate-financegreen-climate-fundadaptation-fundglobal-environment-facilitybiodiversity-financenature-financeblended-financeimpact-investmentESGenvironmental-social-governancesustainable-financegreen-bondsocial-bondsustainability-bondblue-bondnature-bondbiodiversity-creditoffsetinsetnature-based-creditecosystem-service-creditpayment-for-resultsresults-based-paymentconditional-paymentperformance-based-paymentoutcome-based-paymentenvironmental-service-paymentPSAPESREDDREDD+AFOLULULUCFNAMANAMCNDCNAPNBSAPnational-adaptation-plannational-biodiversity-strategy-and-action-plannationally-determined-contributionnationally-appropriate-mitigation-actionintended-nationally-determined-contributionlong-term-low-emission-development-strategynet-zero-targetcarbon-budgetremaining-carbon-budgetemission-gapadaptation-gapfinance-gapimplementation-gapambition-loopratchet-mechanismglobal-stocktaketransparency-frameworkenhanced-transparency-frameworkcommon-but-differentiated-responsibilitiesrespective-capabilitiesclimate-equityclimate-litigationclimate-governanceclimate-diplomacyclimate-negotiationUNFCCCCOPCMPCMASBSTASBIIPCCIPBESUNCCDCBDCITESRamsarWorld-HeritageMan-and-the-BiosphereMABUNESCOFAOWHOILOUNDPUNEPUN-HabitatWorld-BankIMFWTOOECDGEFGCFAFmultilateral-development-bankregional-development-banknational-development-bankdevelopment-finance-institutionexport-credit-agencysovereign-wealth-fundpension-fundinsurance-companyasset-managerasset-ownercorporate-investorretail-investorimpact-investorphilanthropic-investordevelopment-partnerbilateral-donormultilateral-donorprivate-donorfoundationNGOCSOcivil-society-organizationnon-governmental-organizationcommunity-based-organizationindigenous-peoples-organizationwomen's-organizationyouth-organizationfaith-based-organizationresearch-organizationthink-tankuniversityacademic-institutionknowledge-institutioncapacity-building-institutiontraining-institutionextension-serviceadvisory-serviceconsulting-firmengineering-firmtechnology-providerequipment-supplierservice-providercontractoroperatormaintainerutilitymunicipalitylocal-governmentprovincial-governmentnational-governmentfederal-governmentministrydepartmentagencyauthoritycommissionboardcouncilcommitteeparliamentcongresslegislatureexecutivejudiciarymediajournalistreportereditorpublisherbroadcasterplatformsocial-mediainfluencercelebrityactivistadvocatecampaignermobilizerorganizernetworkerconnectorbridge-builderboundary-spannerknowledge-brokerscience-communicatorextension-agentdevelopment-practitionerpolicy-makerdecision-makerplannermanageradministratorleaderchampionentrepreneurinnovatorintrapreneursocial-entrepreneursystems-entrepreneurinstitutional-entrepreneurpolicy-entrepreneurpolitical-entrepreneurbusiness-modelbusiness-model-innovationsocial-businessinclusive-businessbase-of-pyramidfortune-at-bottom-of-pyramidshared-valuecreating-shared-valuestakeholder-capitalismpurpose-driven-businessB-Corpbenefit-corporationsocial-enterprisecooperativemutualassociationcollectivecommonscommoningpeer-productionopen-sourcecreative-commonsknowledge-commonsdigital-commonsdata-commonsgenetic-commonsseed-commonswater-commonsfisheries-commonsforest-commonspasture-commonsland-commonsurban-commonsatmospheric-commonsglobal-commonscommon-heritage-of-mankindcommon-concern-of-humankindrestorative-justicemultispecies-justicemore-than-humananthropocenecapitaloceneplantationocenechthulucenesymbiocenegood-anthropocenegreat-accelerationgreat-transformationgreat-decouplinggreat-convergencegreat-divergencegreat-fragmentationgreat-integrationgreat-transitiongreat-worklong-nowdeep-timefutures-thinkingfuture-studiesstrategic-foresightscenario-planningtrend-analysisweak-signalwild-cardblack-swangrey-rhinoblue-skygreen-swansystemic-changestructural-changecultural-changebehavioral-changeindividual-changecollective-changesocial-changeorganizational-changetechnological-changeeconomic-changepolitical-changeecological-changeplanetary-changeearth-system-changebiodiversity-changeocean-changecryosphere-changeatmospheric-changebiogeochemical-changenitrogen-cycle-changephosphorus-cycle-changecarbon-cycle-changewater-cycle-changehydrological-changesoil-changevegetation-changeecosystem-changelandscape-changeseascape-changebiosphere-changenoosphere-changetechnosphere-changeanthroposphere-changesociosphere-changeeconosphere-changepolitosphere-changeculturosphere-changesemiosphere-changeinfosphere-changedigisphere-changecybersphere-changeurban-sphere-changeagricultural-sphere-changeindustrial-sphere-changeextractive-sphere-changemanufacturing-sphere-changeservice-sphere-changefinancial-sphere-changeknowledge-sphere-changeinnovation-sphere-changecreativity-sphere-changeculture-sphere-changeidentity-sphere-changemeaning-sphere-changevalue-sphere-changepurpose-sphere-changevision-sphere-changemission-sphere-changestrategy-sphere-changetactic-sphere-changeoperation-sphere-changeaction-sphere-changepractice-sphere-changehabit-sphere-changeroutine-sphere-changeritual-sphere-changetradition-sphere-changecustom-sphere-changeconvention-sphere-changenorm-sphere-changerule-sphere-changelaw-sphere-changeregulation-sphere-changestandard-sphere-changeprotocol-sphere-changeprocedure-sphere-changeprocess-sphere-changesystem-sphere-changestructure-sphere-changefunction-sphere-changepattern-sphere-changedynamic-sphere-changestate-sphere-changephase-sphere-changeregime-sphere-changeequilibrium-sphere-changestability-sphere-changeinstability-sphere-changechaos-sphere-changeorder-sphere-changecomplexity-sphere-changesimplicity-sphere-changediversity-sphere-changeuniformity-sphere-changeheterogeneity-sphere-changehomogeneity-sphere-changevariation-sphere-changeinvariance-sphere-changechange-sphere-changecontinuity-sphere-changediscontinuity-sphere-changeemergence-sphere-changesubmergence-sphere-changeevolution-sphere-changedevolution-sphere-changerevolution-sphere-changeinvolution-sphere-changeconvolution-sphere-changeresolution-sphere-changedissolution-sphere-changeabsolution-sphere-changesolution-sphere-changeToxonotus penicellatus
Tufted Tropical Fungus Weevil
Toxonotus penicellatus is a fungus weevil in the family Anthribidae, commonly known as the Tufted Tropical Fungus Weevil. The species was described by Schaeffer in 1904 and has been placed in the genus Neanthribus in some taxonomic treatments. It belongs to a group of weevils associated with fungal feeding habits.
Toxorhina
Toxorhina is a genus of crane flies in the family Limoniidae comprising over 150 extant species across three subgenera: Ceratocheilus, Eutoxorhina, and Toxorhina. The genus is distinguished by an elongate rostrum and reduced wing venation compared to other crane flies. Members have been recorded from tropical and subtropical regions worldwide, with fossil evidence extending the stratigraphic range to the Eocene. The genus shows its highest diversity in tropical zones, particularly in the Oriental and Afrotropical regions.
Tracheloschizus
Tracheloschizus is a genus of straight-snouted weevils in the family Brentidae, established by Damoiseau in 1966. The genus belongs to the weevil superfamily Curculionoidea and is characterized by members of this primarily tropical family. Brentidae weevils are distinguished from the more familiar Curculionidae by their elongated, straight rostrums rather than the curved snouts typical of true weevils. The genus is relatively poorly documented in public sources, with limited species-level information available.
Tramea
Saddlebags, Saddlebags Gliders, Saddlebag Gliders
Tramea is a genus of dragonflies in the family Libellulidae, commonly called saddlebags or saddlebags gliders. Species are distributed across tropical and subtropical regions worldwide. They are characterized by colored bases on otherwise translucent hindwings that create the visual impression of carrying bags near the abdomen base. Members are medium to relatively large dragonflies known for sustained gliding flight and infrequent perching.
Trigoniulidae
round-backed millipedes
Trigoniulidae is a family of round-backed millipedes in the order Spirobolida, comprising approximately 171 species across 25 genera. The family was established by Attems in 1909. Members are found in tropical and subtropical regions where they inhabit leaf litter and soil environments. Population studies of at least one species, Trigoniulus lumbricinus, indicate seasonal fluctuations correlated with rainfall patterns.
Uramyini
Uramyini is a tribe of tachinid flies (Diptera: Tachinidae) within the subfamily Dexiinae, distributed in the New World. Members are characterized by a distinctive combination of morphological traits including bare prosternum, bare arista, haired eyes, and a cylindrical body plan. The tribe has been documented to contain parasitoid species that attack caterpillars, particularly those in the family Megalopygidae. Taxonomic placement of Uramyini remains under discussion, with some evidence suggesting it may represent a nested sub-clade within Voriini.
Uraniidae
Swallowtail Moths, Sunset Moths
Uraniidae is a family of moths in the order Lepidoptera, comprising approximately 700 species across 90 genera and four subfamilies. The family exhibits striking diversity in appearance and behavior: diurnal species are often brightly colored with iridescent scales and tail-like hindwing extensions, while nocturnal species are typically small and pale. Uraniidae are distributed throughout tropical regions of the Americas, Africa, and Indo-Australia. The family is closely related to Geometridae but distinguished by unique wing venation patterns. Some species, notably in the genus Chrysiridia, are known as 'sunset moths' and are apparently toxic, with aposematic coloration serving as predator warnings.
Uraniinae
uraniine moths
Uraniinae is a subfamily of moths in the family Uraniidae, containing seven genera distributed in tropical regions worldwide. The group exhibits striking ecological and morphological dichotomy: three genera (Alcides, Chrysiridia, Urania) are diurnal, brightly colored with iridescent markings, and chemically defended, while the remaining four genera (Cyphura, Lyssa, Urapteritra, Urapteroides) are primarily nocturnal or crepuscular with subdued coloration. Lyssa species are notable for their large size, with wingspans reaching 10–16 cm. The subfamily includes approximately 80 described species, with the Madagascan sunset moth (Chrysiridia rhipheus) being among the most celebrated lepidopterans for its coloration.
Uropygi
whip scorpions, vinegaroons, uropygids
Uropygi is an order of arachnids commonly known as whip scorpions or vinegaroons, characterized by a whip-like flagellum on the posterior end and large scorpion-like pedipalps. They lack venom glands but possess defensive glands capable of spraying acetic and caprylic acid, producing a vinegar-like odor. These nocturnal predators use only six legs for walking, with the first two pairs modified as sensory appendages. The order comprises approximately 100 species across 18 extant genera, all placed in the single family Thelyphonidae.
Xenylla
springtails
Xenylla is a genus of springtails (Collembola) in the family Hypogastruridae, containing at least 120 described species. Members are small, soil-dwelling hexapods found across diverse biomes including tropical, desert, Antarctic, and Amazonian regions. The genus includes species used as biomarkers for soil pollution assessment, notably Xenylla welchi, which exhibits sensitive physiological responses to heavy metal contamination.
Xyleborus affinis
sugarcane shot-hole borer
Xyleborus affinis is a highly widespread ambrosia beetle native to the American tropics, now found in tropical and subtropical regions worldwide. It cultivates symbiotic fungi in galleries bored into decaying wood, feeding exclusively on these fungal gardens. The species exhibits facultative eusociality with delayed dispersal of adult offspring, who assist with nest maintenance and brood care. Females are the dispersing sex and are strongly attracted to ethanol and specific host plant volatiles. Despite frequent association with declining trees, it primarily colonizes wood already in early decay rather than causing primary mortality.
Xyleborus volvulus
Xyleborus volvulus is a bark beetle in the family Curculionidae. It is native to tropical and subtropical regions and has been documented in North America, the Caribbean, Middle America, and Africa. The species is an ambrosia beetle that cultivates symbiotic fungi in tunnels bored into wood. It has been observed to carry Raffaelea lauricola, the pathogen causing laurel wilt disease, which has altered its status from a wood degrader to a potential pest of avocado and other lauraceous trees.
Zaprionus
Fig Flies
Zaprionus is a genus of fruit flies in the family Drosophilidae, distinguished by conspicuous white longitudinal stripes across the head and thorax. The genus is divided into two subgenera based on stripe number: Zaprionus (even number of stripes) and Anaprionus (odd number of stripes). Species occur primarily in Africa and southern Asia, with several species showing invasive expansion. The genus is taxonomically nested within the paraphyletic genus Drosophila.
Drosophilidaefruit-fliesinvasive-specieszebra-stripesAfrotropicalOrientalagricultural-pestfermenting-fruitparasitoid-hostkleptoparasitismoviscapt-structureegg-filamentsfig-pestgrape-pestberry-pesttropicalsubgenus-Zaprionussubgenus-Anaprionuscompetitive-displacementsecondary-pestmonitoringvinegar-traprange-expansionMediterranean-invasionNew-World-invasionHawaiian-IslandsSoutheast-AsiaWest-Africapolyphagousdecomposernutrient-cyclingPachycrepoideus-vindemiaeSpalangia-endiusLeptopilina-boulardiinterspecific-competitiondevelopmental-plasticitytemperature-effectsfungal-interactionsPichia-kudriavzeviiCoquillett-1901taxonomic-revisionmolecular-phylogeneticsforeleg-spinestrichome-structureslight-polarizationcuticular-pigmentationspecies-groups-armatus-inermis-vittiger-neglectusspecies-subgroups-armatus-tuberculatus-vrydaghi-montanus-spinosus-inermis-tuberculatus-sepsoides-davidi-indianus-ornatus-proximus-sexvittatus-vittigerspecies-complexes-armatus-hoplophorus-vrydaghi-sepsoides-tuberculatus-davidi-indianus-ornatus-proximus-sexvittatus-vittigerZ.-africanusZ.-armatusZ.-bogoriensisZ.-burlaiZ.-camerounensisZ.-campestrisZ.-capensisZ.-cercociliarisZ.-cercusZ.-davidiZ.-enoplomerusZ.-flavofasciatusZ.-fumipennisZ.-gabonicusZ.-ghesquiereiZ.-grandisZ.-hoplophorusZ.-inermisZ.-indianusZ.-kolodkinaeZ.-koroleuZ.-lachaiseiZ.-lineosusZ.-litosZ.-mascariensisZ.-momorticusZ.-montanusZ.-multistriatusZ.-multivittigerZ.-neglectusZ.-niabuZ.-obscuricornisZ.-ornatusZ.-proximusZ.-pyinoolwinensisZ.-santomensisZ.-sepsoidesZ.-seguyiZ.-serratusZ.-sexstriatusZ.-sexvittatusZ.-silvistriatusZ.-spinilineosusZ.-spinipesZ.-spinoarmatusZ.-spineusZ.-spinosusZ.-taronusZ.-tsacasiZ.-tuberarmatusZ.-tuberculatusZ.-verrucaZ.-vittigerZ.-vrydaghiZ.-aungsaniZ.-arduusZ.-badyiZ.-orissaensis