Residue-management

Guides

• Leptoglossus

  leaf-footed bugs

  Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.

  Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteran