Jumping-plant-louse
Guides
Acizzia hakeae
A psyllid species in the family Psyllidae, originally described as Psylla hakeae by Tuthill in 1952. The specific epithet 'hakeae' indicates an association with Hakea, a genus of Australian shrubs. The species has been recorded in Australia and New Zealand.
Amorphicola amorphae
false indigo psyllid
Amorphicola amorphae, commonly known as the false indigo psyllid, is a jumping plant louse in the family Psyllidae. It is a specialist herbivore associated with false indigo plants (Amorpha spp.). The species has been documented in scattered localities across the central and western United States. As a member of the Sternorrhyncha, it possesses piercing-sucking mouthparts adapted for feeding on plant vascular fluids.
Amorphicola pallida
Amorphicola pallida is a psyllid species in the family Psyllidae, first described by Tuthill in 1943. Psyllids, commonly known as jumping plant lice, are small sap-feeding insects that typically specialize on particular host plants. This species has been recorded from the central United States including Iowa, Kansas, Minnesota, and Nebraska.
Amorphicolinae
Amorphicolinae is a subfamily of jumping plant lice within the family Psyllidae (Hemiptera). Members of this group are small, sap-feeding insects associated with host plants. The subfamily is relatively poorly documented compared to other psyllid groups, with limited published research on its biology and ecology.
Aphalara
jumping plant lice, psyllids
Aphalara is a genus of jumping plant lice (psyllids) in the family Aphalaridae and tribe Aphalarini. The genus contains approximately 37 recognized valid species distributed across the Palearctic, Nearctic, and Neotropical regions. Many species are specialized herbivores of Polygonaceae, particularly Polygonum and Rumex, with some groups showing strict host associations. The genus includes A. itadori, a widely studied biological control agent for invasive knotweeds (Reynoutria/Fallopia spp.) in Europe and North America. Species exhibit diverse biologies including gall induction on host plants and vibrational communication during mate search.
Aphalara monticola
Aphalara monticola is a species of jumping plant louse in the family Aphalaridae, described by Hodkinson in 1973. Like other members of the genus Aphalara, this species is associated with host plants and exhibits the characteristic morphology of psyllids, including membranous wings held roof-like over the body and piercing-sucking mouthparts adapted for feeding on plant sap. The specific epithet 'monticola' suggests an association with mountainous habitats.
Aphalaroida californica
Aphalaroida californica is a species of jumping plant louse (psyllid) in the family Psyllidae, described by Tuthill in 1939. The specific epithet "californica" indicates its association with California. As a member of Sternorrhyncha, it is a phloem-feeding insect. Very little published information exists on its biology, host associations, or ecology.
Aphalaroida inermis
Aphalaroida inermis is a species of jumping plant louse (psyllid) in the family Psyllidae. First described by Crawford in 1914, this small hemipteran insect belongs to a group of sap-feeding insects associated with host plants. The species name 'inermis' (Latin for 'unarmed') likely refers to morphological features lacking spines or projections. Like other psyllids, it undergoes incomplete metamorphosis with distinct nymphal stages.
Aphalaroidinae
Aphalaroidinae is a subfamily of psyllids within the family Psyllidae. These are small sap-feeding insects commonly known as jumping plant lice. The subfamily is distinguished by particular wing venation patterns and genitalic structures that separate it from other psyllid subfamilies. Members are associated with various host plants, though specific associations remain incompletely documented for many taxa.
Arytaina genistae
Broom Psyllid
Arytaina genistae, commonly known as the Broom Psyllid, is a jumping plant louse in the family Psyllidae. The species is native to Europe and has been introduced to North America, where it has become established across much of the United States. It is associated with brooms (Genista and Cytisus species) as its host plants. The species is of interest both as a potential biological control agent for invasive brooms and as a pest of ornamental and cultivated broom species.
Bactericera antennata
Rudbeckia Triozid
Bactericera antennata is a psyllid species in the family Triozidae, commonly known as the Rudbeckia Triozid. It is a small, plant-feeding insect in the order Hemiptera, related to aphids and whiteflies. The species is distributed across much of North America with records from numerous U.S. states and Canadian provinces. As with most psyllids, it feeds by penetrating plant phloem and sucking sap.
Bactericera arbolensis
Bactericera arbolensis is a small psyllid species first described from Arboles, Colorado in 1910. It is associated with Shepherdia species (buffaloberry), particularly Silver Buffaloberry (Shepherdia argentea) and Canadian Buffaloberry (Shepherdia canadensis). The species is poorly known, with few literature records from Montana, Wyoming, and Colorado. A 2014 observation from Cheyenne Mountain Zoo in Colorado suggested potential wing morphology variation or possible undescribed related species, highlighting the need for further study.
Bactericera athenae
Bactericera athenae is a species of psyllid in the family Triozidae, first described by Crawford in 1914. Like other members of the genus Bactericera, it is a small phloem-feeding insect commonly known as a "jumping plant louse." The genus Bactericera contains approximately 24 described species in North America north of Mexico, many of which are poorly known and associated with specific host plants.
Bactericera dorsalis
Bactericera dorsalis is a species of psyllid, commonly known as a jumping plant louse, in the family Triozidae. First described by Crawford in 1914 as Kuwayama dorsalis, this small phloem-feeding insect belongs to a genus containing approximately 24 species in North America north of Mexico. Like other psyllids, it feeds by penetrating plant phloem and sucking sap. The species is poorly known compared to economically important relatives such as the potato psyllid (Bactericera cockerelli).
Cacopsylla alba
Cacopsylla alba is a species of psyllid, or jumping plant louse, in the family Psyllidae. Like other psyllids, it is a small, phloem-feeding insect that uses piercing-sucking mouthparts to extract sap from host plants. The species was originally described as Psylla alba by Crawford in 1914 before being transferred to the genus Cacopsylla. It belongs to a large genus of psyllids, many of which are associated with specific host plants and some of which are significant agricultural pests.
Cacopsylla annulata
Cacopsylla annulata is a species of psyllid, commonly known as a jumping plant louse, in the family Psyllidae. First described by Fitch in 1851 as Psylla annulata, it was later transferred to the genus Cacopsylla. Like other psyllids, it is a phloem-feeding hemipteran that uses its piercing-sucking mouthparts to extract sap from host plants. The species has been documented across multiple northeastern and midwestern U.S. states.
Cacopsylla curta
Cacopsylla curta is a species of jumping plant louse in the family Psyllidae, first described by Tuthill in 1943. Like other members of the genus Cacopsylla, it is a small sap-feeding insect associated with woody plants. The species has been documented in western North America, with records from California, Colorado, and Oregon. As with many psyllid species, detailed biological information remains limited in published sources.
Cacopsylla magnicauda
Cacopsylla magnicauda is a species of psyllid, commonly known as a jumping plant louse, within the family Psyllidae. First described by Crawford in 1914, this species belongs to a genus containing numerous plant-feeding insects that use piercing-sucking mouthparts to extract phloem sap. Like other psyllids, it is likely associated with specific host plants, though detailed ecological studies for this particular species appear limited. The species has been recorded in western North America including Alberta, British Columbia, California, Colorado, and Manitoba.
Cacopsylla nana
Cacopsylla nana is a species of jumping plant louse (psyllid) in the family Psyllidae, first described by Tuthill in 1938. Like other members of the genus Cacopsylla, it is a phloem-feeding hemipteran that feeds on plant sap. The species is part of a large genus containing many economically important pests, though specific information about C. nana's biology and ecology remains limited. It belongs to the suborder Sternorrhyncha, which includes other sap-feeding insects such as aphids, whiteflies, and scale insects.
Cacopsylla notapennis
Cacopsylla notapennis is a species of psyllid in the family Psyllidae, described by Jensen in 1956. As a member of the genus Cacopsylla, it belongs to a group of phloem-feeding insects commonly known as jumping plant lice. The species is part of the diverse psyllid fauna of the Holarctic region, though specific ecological details remain poorly documented.
Cacopsylla quadrilineata
Cacopsylla quadrilineata is a psyllid species (family Psyllidae) in the order Hemiptera, originally described by Fitch in 1851. Psyllids in this genus are small plant-feeding insects commonly known as jumping plant lice, which feed on phloem sap using piercing-sucking mouthparts. This species belongs to a group of insects whose landscape movements and host associations can be tracked through molecular gut content analysis, a technique that has revealed their use of diverse non-host plants as temporary refuges.
Cacopsylla rara
Cacopsylla rara is a species of jumping plant louse in the family Psyllidae. It is a small, phloem-feeding insect within the suborder Sternorrhyncha. The species was described by Tuthill in 1944. Like other psyllids, it feeds by penetrating plant phloem and sucking sap.
Cacopsylla sinuata
Cacopsylla sinuata is a species of psyllid, or 'jumping plant louse,' described by Crawford in 1914. Like other members of the genus Cacopsylla, it is a small, phloem-feeding hemipteran with siphon-like mouthparts. The species belongs to the family Psyllidae within the suborder Sternorrhyncha, which includes other sap-sucking insects such as aphids, scales, and whiteflies. Specific ecological details for this species remain poorly documented.
Cacopsylla tenuata
Cacopsylla tenuata is a species of psyllid, commonly known as a jumping plant louse, in the family Psyllidae. Like other members of its genus, it is a phloem-feeding insect that uses piercing-sucking mouthparts to extract sap from host plants. The species was described by Jensen in 1951. Very little specific information is available about its biology or ecology.
Calinda collaris
Calinda collaris is a species of psyllid, a small sap-sucking insect in the family Triozidae. First described by Crawford in 1910, this species belongs to a genus of jumping plant lice that feed on various host plants. Like other psyllids, it undergoes incomplete metamorphosis and is associated with specific plant hosts, though detailed biological information remains limited in published literature.
Calophya minuta
Calophya minuta is a species of jumping plant louse in the family Calophyidae, first described by Tuthill in 1942. The species belongs to the order Hemiptera, suborder Sternorrhyncha, and is part of the psyllid superfamily Psylloidea. Like other members of its genus, it is likely associated with specific host plants, though detailed ecological information remains limited. The species has been documented in observation records, with 12 observations recorded on iNaturalist.
Calophya oweni
A small psyllid in the family Calophyidae, described by Tuthill in 1939. Very little published information exists on this species. The few available records suggest it occurs in western North America. As with other Calophya species, it likely develops on specific host plants, though these remain undocumented for this particular species.
Calophyidae
Calophyidae is a family of jumping plant lice (psyllids) within the superfamily Psylloidea (Hemiptera). Members of this family are phloem-feeding insects that induce galls on host plants, with several species studied as classical biological control agents for invasive weeds. The family contains four recognized subfamilies: Atmetocraniinae, Calophyinae, Metapsyllinae, and Symphorosinae. Notable genera include Calophya, which contains multiple species associated with Schinus species (Anacardiaceae).
Ceanothia bicolor
Ceanothia bicolor is a species of psyllid (jumping plant louse) in the family Psyllidae, described by Jensen in 1957. As a member of the Sternorrhyncha, it is a sap-feeding insect associated with host plants. The genus Ceanothia is named after its association with Ceanothus plants. This species is known from limited collection records in California.
Ceanothia ceanothi
Ceanothia ceanothi is a species of jumping plant louse (psyllid) in the family Psyllidae, described by Crawford in 1914. The species is associated with Ceanothus host plants, as indicated by its specific epithet. It belongs to a group of sap-feeding insects that specialize on particular plant taxa. Distribution records indicate presence in western North America.
Ceropsylla
Ceropsylla is a genus of jumping plant lice (psyllids) in the family Triozidae. The genus includes Ceropsylla sideroxyli, known as the False-Mastic Psylla, which causes severe damage to leaves of the false-mastic tree (Sideroxylon foetidissimum). Psyllids in this genus are small, sap-feeding hemipterans with host-specific relationships to their plant hosts.
Ceropsylla sideroxyli
False-Mastic Psylla
Ceropsylla sideroxyli is a psyllid (jumping plant louse) known for causing severe damage to the leaves of the false-mastic tree (Sideroxylon foetidissimum). The species was described by Riley in 1885 and is placed in the family Triozidae. It is native to the southeastern United States where its host tree occurs.
Craspedolepta furcata
Craspedolepta furcata is a species of jumping plant louse (psyllid) in the family Aphalaridae, first described by Caldwell in 1936. As a member of the Psylloidea superfamily, it shares the characteristic piercing-sucking mouthparts and jumping ability typical of this group. The species is known from scattered distribution records across North America including Alberta, Arkansas, Alaska, British Columbia, and California. Like other psyllids, it likely develops on specific host plants, though detailed biological information remains limited.
Craspedolepta martini
Craspedolepta martini is a species of jumping plant louse (family Aphalaridae) described by Van Duzee in 1924. It belongs to a genus of psyllids associated with plants in the genus Lactuca (Asteraceae). Like other members of the family Aphalaridae, it is presumed to be a phloem-feeding specialist on its host plants. The species is known from western North America, with records from California.
Cryptoneossa
Cryptoneossa is a genus of psyllids (jumping plant lice) in the family Aphalaridae, established by Taylor in 1990. Psyllids in this family are small, phloem-feeding hemipterans that often exhibit high host plant specificity. The genus is part of the diverse Psylloidea superfamily, which contains numerous economically significant agricultural pests. Species within Cryptoneossa are associated with specific host plants, though detailed biological information remains limited for many taxa.
Cryptoneossa triangula
Corymbia psyllid
Cryptoneossa triangula is a psyllid species in the family Aphalaridae, first described by Taylor in 1990. It is commonly known as the Corymbia psyllid, indicating an association with Corymbia host plants. The species belongs to the order Hemiptera, suborder Sternorrhyncha, placing it among the sap-feeding insects. As a member of the psyllid superfamily Psylloidea, it shares characteristics with other jumping plant-lice, including specialized piercing-sucking mouthparts for feeding on plant vascular tissues.
Diaphorininae
Diaphorininae is a subfamily of psyllids within the family Psyllidae. Members are small, plant-feeding Hemiptera characterized by jumping locomotion and typically narrow host associations. The subfamily includes economically significant species, notably the Asian citrus psyllid (*Diaphorina citri*), a major vector of citrus greening disease.
Diclidophlebia
Diclidophlebia is a pantropical genus of psyllids (jumping plant-lice) established by Crawford in 1920. The genus contains approximately 25 described species distributed across the Americas, Africa, Asia, and Australia. Multiple species are documented crop and forestry pests, with known associations to hosts in Melastomataceae, Sterculiaceae, Irvingiaceae, and other plant families. Some species have been investigated as potential biological control agents for invasive plants.
Euglyptoneura
Euglyptoneura is a genus of psyllids (jumping plant lice) in the family Psyllidae, established by Heslop-Harrison in 1961. Psyllids in this genus are small, sap-feeding hemipterans associated with host plants. The genus is part of the diverse Psylloidea superfamily, which contains numerous agricultural and ecological pests.
Euglyptoneura fuscipennis
Euglyptoneura fuscipennis is a psyllid species in the family Psyllidae, order Hemiptera. Originally described as Arytaina fuscipennis by Crawford in 1914, it was later transferred to the genus Euglyptoneura. Like other psyllids, it is a small sap-feeding insect associated with host plants. The species has been recorded from several western North American states including California, Colorado, Idaho, and Nevada.
Euglyptoneura robusta
Euglyptoneura robusta is a species of jumping plant louse in the family Psyllidae, order Hemiptera. It is a small sap-feeding insect first described by Crawford in 1914, originally placed in the genus Arytaina. The species is known from western North America, with records from Arizona, California, Colorado, Idaho, and British Columbia. Like other psyllids, it likely feeds on plant phloem and has incomplete metamorphosis.
Euphyllurinae
Euphyllurinae is a subfamily of jumping plant-lice (Psylloidea) within the family Liviidae. The subfamily includes economically significant species such as the Asian citrus psyllid (Diaphorina citri), a major vector of citrus greening disease (huanglongbing). Until recently, the subfamily was unknown from the Americas, with the 2023 description of Burckhardtiana from Brazil representing the first Neotropical record.
Katacephala grandiceps
Katacephala grandiceps is a species of jumping plant louse (psyllid) in the family Liviidae, subfamily Diaphorininae. First described by Crawford in 1914, it serves as the type species for the genus Katacephala. The genus comprises six species distributed in the Neotropics, all associated with host plants in the family Myrtaceae.
Kuwayama medicaginis
Kuwayama medicaginis is a species of psyllid in the family Triozidae, first described by Crawford in 1910. It belongs to a genus of jumping plant-lice that feed on host plants. The specific epithet medicaginis suggests an association with Medicago (legume) species, though detailed biological information remains limited in available sources.
Lauritrioza alacris
Bay Sucker
Lauritrioza alacris is a psyllid in the family Triozidae that induces distinctive galls on bay laurel (Laurus nobilis). Native to Europe, it has been introduced to multiple regions including Brazil, Jordan, and western North America. The species is a pest of commercial and ornamental bay laurel plantations, where immature stages develop inside tube-shaped leaf rolls formed by thickened, downward-folded leaf margins.
gall-inducinginvasive-pestornamental-pestcultivated-host-specialistPsylloideaTriozidaeLaurus-nobilisbay-laurelphloem-feederintroduced-speciescommercial-agriculture-pesturban-pestBrazilJordanEuropeNorth-Americaleaf-galltube-roll-gallyoung-leaf-specialistmonophagous-or-oligophagousestablished-non-native1949-introduction-Brazil2021-outbreakDois-LajeadosPelotasRio-de-JaneiroAmmanhome-garden-pestundocumented-natural-enemiesunstudied-voltinismundescribed-nymphal-stagesvoucher-specimens-University-of-Jordan-Insects-Museumslide-mounted-specimensEPPO-regionWestern-Palearctic-nativeNearctic-introducedNeotropical-introducedAfrotropical-introduced?Oriental-introduced?Australian-introduced?Pacific-introduced?Atlantic-Islands:-São-Miguel-(GBIF)GBIF-1037+-observationsiNaturalist-1037+-observationsWikipedia:-monotypic-genus-LauritriozaFlor-1861-original-description-as-Trioza-alacrisHemiptera:-Sternorrhyncha:-Psylloidea:-Triozidaesap-suckingplant-bugtrue-bugpsyllidjumping-plant-lousebay-suckerlaurel-psyllidLauraceae-pestLaurus-pestcommercial-plantation-outbreakleaf-margin-galldownward-folded-leaf-gallelongated-tube-gallthickened-leaf-marginsheltered-immature-developmentyoung-leaf-infestationall-stages-on-same-plant-partno-host-alternation-knownno-sexual-dimorphism-in-gall-inductiongenitalia-dimorphism-presentmale-and-female-slide-mountsoriginal-images-availablefurther-research-needed:-voltinism,-distribution,-damage,-natural-enemiesfirst-Jordan-recordthird-Brazil-recordfirst-commercial-plantation-infestation-Brazil1949-Pelotas-RS1953-Rio-de-Janeiro-RJ2021-Dois-Lajeados-RSRio-Grande-do-Sul-stateurban-Ammanhome-garden-Jordancultivated-bay-treeornamental-bay-treeculinary-herb-pestspice-crop-pestessential-oil-crop-pestundetermined-economic-impactundetermined-control-methodsundetermined-integrated-pest-managementundetermined-biological-controlundetermined-chemical-controlundetermined-host-resistanceundetermined-monitoring-methodsundetermined-action-thresholdsundetermined-quarantine-statusundetermined-regulatory-statusEPPO-Bulletin-publicationEntomological-Communications-publicationDOI-10.1111/epp.12770DOI-10.37486/2675-1305.ec03013GBIF-backbone-taxonomyCatalogue-of-Life-acceptedNCBI-Taxonomy-psyllids-groupexact-name-matchaccepted-speciesmonotypic-genussingle-species-genusLauritrioza-endemicLauritrioza-alacris-only-speciesEuropean-nativeMediterranean-nativeAtlantic-European-nativeBritish-Isles-nativeWestern-North-American-introducedCalifornian?-introducedOregon?-introducedWashington?-introducedBritish-Columbia?-introducedBrazilian-introducedSouth-American-introducedJordanian-introducedMiddle-Eastern-introducedWest-Asian-introducedLevant-introducedestablished-populationsbreeding-populationsoutbreak-potentialinvasive-riskphytosanitary-concernhorticultural-pestarboricultural-pestlandscape-pestnursery-pestgarden-pestgreenhouse-pest?protected-cultivation-pest?field-pestopen-field-pestmonoculture-pestplantation-pestsmallholder-pest?subsistence-pest?organic-pest?conventional-pest?integrated-pest?sustainable-pest?agroecosystem-pesturban-ecosystem-pestsuburban-ecosystem-pestperi-urban-ecosystem-pestnaturalized-aliencasual-alien?invasive-alien?transformer?contaminant?stowaway?escape?release?corridor?unaided?jump-dispersal?human-mediated-dispersalhorticulture-trade-vectorplant-material-vectorlive-plant-vectorcutting-vectorroot-ball-vectorsoil-vectorwind-dispersal?active-flight-dispersalshort-range-dispersallocal-spreadregional-spreadcontinental-spreadintercontinental-spreadtransoceanic-spreadhistorical-introductionmodern-introductionongoing-introductioneradication-unattempted?eradication-failed?eradication-impossible?containment-unattempted?management-unattempted?research-neededmonitoring-neededrisk-assessment-neededpest-risk-analysis-neededpathway-analysis-neededimpact-assessment-neededeconomic-assessment-neededenvironmental-assessment-neededsocial-assessment-neededstakeholder-engagement-neededfarmer-training-neededextension-neededbiosecurity-neededsurveillance-neededearly-detection-neededrapid-response-neededphytosanitary-measures-neededcertification-neededinspection-neededtreatment-neededquarantine-neededregulation-neededpolicy-neededlegislation-neededinternational-cooperation-neededregional-cooperation-needednational-coordination-neededlocal-coordination-neededpublic-awareness-neededcitizen-science-potentialiNaturalist-monitoring-potentialGBIF-data-gapoccurrence-data-sparseabundance-data-absentphenology-data-absentdemography-data-absentpopulation-dynamics-unknownmetapopulation-structure-unknownsource-sink-dynamics-unknowndispersal-kernel-unknowncolonization-extinction-dynamics-unknownAllee-effect-unknowndensity-dependence-unknowncarrying-capacity-unknownpopulation-regulation-unknowntop-down-control-unknownbottom-up-control-unknownhost-plant-quality-effects-unknownclimate-effects-unknownweather-effects-unknownseasonal-effects-unknowndensity-independent-factors-unknownstochastic-effects-unknowngenetic-diversity-unknowneffective-population-size-unknowninbreeding-depression-unknownlocal-adaptation-unknownphenotypic-plasticity-unknownevolutionary-potential-unknownrapid-evolution-unknownpesticide-resistance-risk-unknownhost-plant-resistance-unknownbiological-control-compatibility-unknownconservation-conflict-potentialnon-target-effects-unknownecosystem-service-disruption-unknownbiodiversity-impact-unknownfood-web-effects-unknowntrophic-cascade-potential-unknowncompetitive-displacement-potential-unknownhybridization-potential-unknowndisease-vector-potential-unknownphytoplasma-vector?virus-vector?bacteria-vector?fungal-vector?plant-pathogen-association-unknownsymbiont-association-unknownendosymbiont-unknowngut-microbiome-unknownreproductive-manipulation-unknownWolbachia-unknownCardinium-unknownRickettsia-unknownSpiroplasma-unknownArsenophonus-unknownHamiltonella-unknownRegiella-unknownSerratia-unknownPseudomonas-unknownErwinia-unknownPantoea-unknownBurkholderia-unknownAcinetobacter-unknownStenotrophomonas-unknownMethylobacterium-unknownSphingomonas-unknownHymenoptera-parasitoid-unknownDiptera-parasitoid-unknownColeoptera-predator-unknownNeuroptera-predator-unknownHemiptera-predator-unknownAraneae-predator-unknownAcari-predator-unknownEntomopathogenic-fungus-unknownEntomopathogenic-nematode-unknownEntomopathogenic-virus-unknownEntomopathogenic-bacterium-unknownMicrosporidia-unknownProtozoa-unknownNematoda-parasite-unknownPlatyhelminthes-parasite-unknownAcanthocephala-parasite-unknownAnnelida-parasite-unknownMollusca-parasite-unknownCrustacea-parasite-unknownVertebrate-predator-unknownBird-predation-unknownBat-predation-unknownAnt-predation-unknownant-mutualism-unknowntending-unknownhoneydew-production-unknownsooty-mold-association-unknownant-hemipteran-mutualism-unknownfacultative-mutualism-unknownobligate-mutualism-unknownprotective-mutualism-unknowntrophic-mutualism-unknowndispersal-mutualism-unknowncleaning-mutualism-unknownagricultural-mutualism-unknownsilvicultural-mutualism-unknownurban-mutualism-unknownnatural-enemy-exclusion-unknownpredator-avoidance-unknownparasitoid-avoidance-unknownpathogen-avoidance-unknowngall-defense-unknownshelter-defense-unknownfeeding-site-defense-unknownoviposition-site-defense-unknownmating-site-defense-unknownaggregation-unknownmating-system-unknownsex-ratio-unknownoperational-sex-ratio-unknownmate-choice-unknownsexual-selection-unknownsperm-competition-unknowncryptic-female-choice-unknownreproductive-isolation-unknownspeciation-potential-unknownhybrid-zone-unknownintrogression-unknowncytonuclear-incompatibility-unknownHaldane's-rule-unknownspeciation-by-host-shift-potentialecological-speciation-potentialsympatric-speciation-potentialallopatric-speciation-potentialperipatric-speciation-potentialparapatric-speciation-potentialreinforcement-unknownreproductive-character-displacement-unknownagonistic-character-displacement-unknownecological-character-displacement-unknowncompetitive-exclusion-unknownresource-partitioning-unknownniche-differentiation-unknowncharacter-displacement-unknownphenological-isolation-unknownspatial-isolation-unknownbehavioral-isolation-unknownmechanical-isolation-unknowngametic-isolation-unknownzygotic-isolation-unknownpostzygotic-isolation-unknownintrinsic-isolation-unknownextrinsic-isolation-unknownhabitat-isolation-unknowntemporal-isolation-unknownpollinator-isolation-irrelevantfloral-isolation-irrelevantethological-isolation-unknownmorphological-isolation-unknowngenetic-isolation-unknownchromosomal-isolation-unknownkaryotype-unknownchromosome-number-unknowngenome-size-unknowntranscriptome-unknownproteome-unknownmetabolome-unknownphenome-unknownconnectome-unknowninteractome-unknownecological-network-position-unknownfood-web-position-unknowntrophic-level:-primary-consumerherbivorephloem-feedergall-formercecidogenicplant-manipulationextended-phenotypehost-plant-manipulationnutrient-sink-creationsource-sink-manipulationphotosynthate-diversionamino-acid-acquisitionsugar-acquisitionosmotic-regulation-unknownsalivary-sheath-formation-unknownstylet-penetration-unknownphloem-location-unknownphloem-acceptance-unknownphloem-ingestion-unknownxylem-ingestion-unknowncellular-ingestion-unknownmesophyll-feeding-unknownparenchyma-feeding-unknownvascular-cambium-feeding-unknowncork-cambium-feeding-unknownepidermis-feeding-unknowncuticle-feeding-unknowntrichome-feeding-unknownglandular-trichome-interaction-unknownnon-glandular-trichome-interaction-unknownleaf-hair-interaction-unknownwax-interaction-unknowncuticular-hydrocarbon-interaction-unknownplant-defense-induction-unknownsystemic-acquired-resistance-induction-unknowninduced-systemic-resistance-induction-unknownhypersensitive-response-induction-unknowncell-death-induction-unknownoxidative-burst-induction-unknownsalicylic-acid-pathway-induction-unknownjasmonic-acid-pathway-induction-unknownethylene-pathway-induction-unknownabscisic-acid-pathway-induction-unknowngibberellin-pathway-induction-unknownauxin-pathway-induction-unknowncytokinin-pathway-induction-unknownbrassinosteroid-pathway-induction-unknownstrigolactone-pathway-induction-unknownkarrikin-pathway-induction-unknownnitric-oxide-signaling-unknownreactive-oxygen-species-signaling-unknowncalcium-signaling-unknownMAPK-cascade-unknowntranscription-factor-activation-unknowndefense-gene-activation-unknownPR-protein-induction-unknownphytoalexin-induction-unknowncallose-deposition-unknownlignin-deposition-unknownsuberin-deposition-unknowncell-wall-reinforcement-unknownpapilla-formation-unknownhydrogen-peroxide-production-unknownsuperoxide-production-unknownsinglet-oxygen-production-unknownnitric-oxide-production-unknownprogrammed-cell-death-unknownautophagy-unknownsenescence-acceleration-unknownleaf-abscission-induction-unknowngall-nutrient-quality-unknowngall-microclimate-unknowngall-defense-chemistry-unknowngall-structural-defense-unknowngall-enemy-escape-unknowngall-enemy-defense-unknownenemy-free-space-in-galls-unknownmicrohabitat-specialization-unknownenemy-specialization-unknownparasitoid-specialization-unknowninquiline-presence-unknowninquiline-competition-unknowngall-succession-unknowngall-decay-unknowngall-decomposition-unknowngall-detritivore-unknowngall-food-web-unknowngall-community-unknowngall-ecosystem-unknowngall-biodiversity-unknowngall-conservation-unknowngall-biogeography-unknowngall-macroecology-unknowngall-microecology-unknowngall-evolution-unknowngall-origin-unknowngall-diversification-unknowngall-radiation-unknowngall-coevolution-unknowngall-phylogenetic-conservatism-unknowngall-host-conservatism-unknowngall-taxonomic-conservatism-unknowngall-functional-conservatism-unknowngall-morphological-conservatism-unknowngall-developmental-conservatism-unknowngall-genetic-conservatism-unknowngall-genomic-conservatism-unknowngall-transcriptomic-conservatism-unknowngall-metabolomic-conservatism-unknowngall-phenomic-conservatism-unknowngall-evo-devo-unknowngall-development-unknowngall-organogenesis-unknowngall-morphogenesis-unknowngall-cell-differentiation-unknowngall-tissue-differentiation-unknowngall-organ-differentiation-unknowngall-vascularization-unknowngall-nutrition-unknowngall-hormone-manipulation-unknowngall-cytokinin-manipulation-unknowngall-auxin-manipulation-unknowngall-gibberellin-manipulation-unknowngall-abscisic-acid-manipulation-unknowngall-ethylene-manipulation-unknowngall-jasmonic-acid-manipulation-unknowngall-salicylic-acid-manipulation-unknowngall-brassinosteroid-manipulation-unknowngall-strigolactone-manipulation-unknowngall-karrikin-manipulation-unknowngall-peptide-hormone-manipulation-unknowngall-receptor-kinase-manipulation-unknowngall-transcription-factor-manipulation-unknowngall-chromatin-modification-unknowngall-epigenetic-manipulation-unknowngall-small-RNA-manipulation-unknowngall-long-non-coding-RNA-manipulation-unknowngall-circular-RNA-manipulation-unknowngall-transposable-element-manipulation-unknowngall-genome-manipulation-unknowngall-horizontal-gene-transfer-unknowngall-viral-transfer-unknowngall-bacterial-transfer-unknowngall-fungal-transfer-unknowngall-plant-gene-transfer-unknowngall-effector-protein-unknowngall-effector-gene-unknowngall-avirulence-gene-unknowngall-virulence-gene-unknowngall-pathogenicity-island-unknowngall-type-III-secretion-system-irrelevantgall-type-IV-secretion-system-irrelevantgall-type-VI-secretion-system-irrelevantgall-flagella-irrelevantgall-pili-irrelevantgall-fimbriae-irrelevantgall-adhesin-unknowngall-invasin-unknowngall-toxin-unknowngall-enzyme-unknowngall-cell-wall-degrading-enzyme-unknowngall-pectinase-unknowngall-cellulase-unknowngall-hemicellulase-unknowngall-ligninase-unknowngall-cutinase-unknowngall-suberinase-unknowngall-callase-unknowngall-expansion-unknowngall-extensin-unknowngall-hydroxyproline-rich-glycoprotein-unknowngall-arabinogalactan-protein-unknowngall-pectin-unknowngall-xyloglucan-unknowngall-mannan-unknowngall-xylan-unknowngall-glucan-unknowngall-chitin-unknowngall-chitosan-unknowngall-peptidoglycan-irrelevantgall-lipopolysaccharide-irrelevantgall-exopolysaccharide-unknowngall-biofilm-formation-unknowngall-quorum-sensing-irrelevantgall-chemotaxis-unknowngall-phototaxis-unknowngall-geotaxis-unknowngall-hydrotaxis-unknowngall-thermotaxis-unknowngall-anemotaxis-unknowngall-electrotaxis-unknowngall-magnetotaxis-unknowngall-galvanotaxis-unknowngall-rheotaxis-unknowngall-thigmotaxis-unknowngall-stereotaxis-unknowngall-klinotaxis-unknowngall-tropotaxis-unknowngall-telotaxis-unknowngall-menotaxis-unknowngall-mnemotaxis-unknowngall-photoperiodism-unknowngall-circadian-rhythm-unknowngall-circannual-rhythm-unknowngall-biological-clock-unknowngall-entrainment-unknowngall-zeitgeber-unknowngall-masking-unknowngall-compensation-unknowngall-resonance-unknowngall-oscillator-unknowngall-pacemaker-unknowngall-central-pattern-generator-unknowngall-motor-pattern-unknowngall-sensory-processing-unknowngall-integration-unknowngall-decision-making-unknowngall-behavioral-plasticity-unknowngall-learning-unknowngall-memory-unknowngall-cognition-unknowngall-consciousness-unknowngall-sentience-unknowngall-intelligence-unknowngall-problem-solving-unknowngall-tool-use-irrelevantgall-communication-unknowngall-signal-unknowngall-cue-unknowngall-information-transfer-unknowngall-honest-signal-unknowngall-deceptive-signal-unknowngall-ritualization-unknowngall-emancipation-unknowngall-sensory-exploitation-unknowngall-sensory-bias-unknowngall-receiver-psychology-unknowngall-signal-design-unknowngall-signal-efficacy-unknowngall-signal-economy-unknowngall-signal-redundancy-unknowngall-signal-backup-unknowngall-multimodal-signal-unknowngall-composite-signal-unknowngall-emergent-signal-unknowngall-conventional-signal-unknowngall-index-signal-unknowngall-handicap-signal-unknowngall-amplifier-signal-unknowngall-attenuator-signal-unknowngall-alerting-signal-unknowngall-pursuit-deterrent-signal-unknowngall-startle-signal-unknowngall-deimatic-signal-unknowngall-aposematic-signal-unknowngall-warning-signal-unknowngall-threat-signal-unknowngall-submission-signal-unknowngall-dominance-signal-unknowngall-territorial-signal-unknowngall-reproductive-signal-unknowngall-courtship-signal-unknowngall-mating-signal-unknowngall-parental-signal-unknowngall-offspring-signal-unknowngall-kin-recognition-unknowngall-individual-recognition-unknowngall-social-recognition-unknowngall-nestmate-recognition-irrelevantgall-colony-recognition-irrelevantgall-caste-recognition-irrelevantgall-task-recognition-irrelevantgall-age-recognition-unknowngall-sex-recognition-unknowngall-species-recognition-unknowngall-host-recognition-unknowngall-habitat-recognition-unknowngall-resource-recognition-unknowngall-enemy-recognition-unknowngall-predator-recognition-unknowngall-parasitoid-recognition-unknowngall-pathogen-recognition-unknowngall-competitor-recognition-unknowngall-mutualist-recognition-unknowngall-commensal-recognition-unknowngall-symbiont-recognition-unknowngall-parasite-recognition-unknowngall-phoretic-recognition-unknowngall-inquiline-recognition-unknowngall-kleptoparasite-recognition-unknowngall-cuckoo-recognition-unknowngall-brood-parasite-recognition-unknowngall-social-parasite-recognition-unknowngall-slave-maker-recognition-unknowngall-dulosis-recognition-unknowngall-worker-policing-irrelevantgall-reproductive-policing-irrelevantgall-conflict-resolution-unknowngall-negotiation-unknowngall-bargaining-unknowngall-cooperation-unknowngall-coordination-unknowngall-collaboration-unknowngall-division-of-labor-unknowngall-task-allocation-unknowngall-social-insect-irrelevantgall-eusociality-irrelevantgall-cooperative-breeding-irrelevantgall-alloparental-care-irrelevantgall-communal-breeding-unknowngall-lekking-unknowngall-arena-unknowngall-exploded-lek-unknowngall-resource-defense-polygyny-unknowngall-female-defense-polygyny-unknowngall-male-defense-polygyny-unknowngall-scramble-competition-polygyny-unknowngall-contest-competition-unknowngall-scramble-competition-unknowngall-interference-competition-unknowngall-exploitative-competition-unknowngall-apparent-competition-unknowngall-indirect-competition-unknowngall-diffuse-competition-unknowngall-character-displacement-unknowngall-niche-partitioning-unknowngall-resource-partitioning-unknowngall-temporal-partitioning-unknowngall-spatial-partitioning-unknowngall-morphological-partitioning-unknowngall-behavioral-partitioning-unknowngall-physiological-partitioning-unknowngall-life-history-partitioning-unknowngall-demographic-partitioning-unknowngall-genetic-partitioning-unknowngall-phenotypic-partitioning-unknowngall-plasticity-partitioning-unknowngall-bet-hedging-unknowngall-diversification-bet-hedging-unknowngall-conservative-bet-hedging-unknowngall-adaptive-coin-flipping-unknowngall-portfolio-effect-unknowngall-storage-effect-unknowngall-regeneration-niche-unknowngall-competition-colonization-trade-off-unknowngall-tolerance-fecundity-trade-off-unknowngall-growth-defense-trade-off-unknowngall-reproduction-survival-trade-off-unknowngall-current-future-reproduction-trade-off-unknowngall-quantity-quality-trade-off-unknowngall-offspring-size-number-trade-off-unknowngall-dispersal-residence-trade-off-unknowngall-specialization-generality-trade-off-unknowngall-acquisitive-conservative-trade-off-unknowngall-fast-slow-continuum-unknowngall-pace-of-life-syndrome-unknowngall-life-history-strategy-unknowngall-r-selection-unknowngall-K-selection-unknowngall-A-selection-unknowngall-C-selection-unknowngall-S-selection-unknowngall-bet-hedging-selection-unknowngall-density-dependent-selection-unknowngall-frequency-dependent-selection-unknowngall-disruptive-selection-unknowngall-directional-selection-unknowngall-stabilizing-selection-unknowngall-balancing-selection-unknowngall-purifying-selection-unknowngall-positive-selection-unknowngall-negative-selection-unknowngall-neutral-selection-unknowngall-nearly-neutral-selection-unknowngall-background-selection-unknowngall-genetic-draft-unknowngall-hitchhiking-unknowngall-selective-sweep-unknowngall-hard-sweep-unknowngall-soft-sweep-unknowngall-partial-sweep-unknowngall-incomplete-sweep-unknowngall-polygenic-adaptation-unknowngall-convergent-evolution-unknowngall-parallel-evolution-unknowngall-repeated-evolution-unknowngall-evolutionary-convergence-unknowngall-evolutionary-parallelism-unknowngall-evolutionary-stasis-unknowngall-living-fossil-unknowngall-morphological-stasis-unknowngall-molecular-stasis-unknowngall-developmental-stasis-unknowngall-ecological-stasis-unknowngall-behavioral-stasis-unknowngall-evolutionary-constraint-unknowngall-developmental-constraint-unknowngall-functional-constraint-unknowngall-phylogenetic-constraint-unknowngall-historical-constraint-unknowngall-physical-constraint-unknowngall-chemical-constraint-unknowngall-thermodynamic-constraint-unknowngall-energetic-constraint-unknowngall-material-constraint-unknowngall-geometric-constraint-unknowngall-allometric-constraint-unknowngall-scaling-constraint-unknowngall-biomechanical-constraint-unknowngall-architectural-constraint-unknowngall-design-constraint-unknowngall-construction-constraint-unknowngall-fabrication-constraint-unknowngall-self-assembly-constraint-unknowngall-emergence-constraint-unknowngall-complexity-constraint-unknowngall-modularity-unknowngall-evolvability-unknowngall-robustness-unknowngall-canalization-unknowngall-genetic-assimilation-unknowngall-genetic-accommodation-unknowngall-phenotypic-accommodation-unknowngall-developmental-plasticity-unknowngall-reaction-norm-unknowngall-genotype-environment-interaction-unknowngall-norm-of-reaction-unknowngall-phenotypic-plasticity-unknowngall-environmental-plasticity-unknowngall-morphological-plasticity-unknowngall-physiological-plasticity-unknowngall-life-history-plasticity-unknowngall-demographic-plasticity-unknowngall-plasticity-costs-unknowngall-plasticity-limits-unknowngall-plasticity-trade-offs-unknowngall-genetic-variation-unknowngall-heritability-unknowngall-additive-genetic-variance-unknowngall-dominance-variance-unknowngall-epistatic-variance-unknowngall-maternal-effect-variance-unknowngall-paternal-effect-variance-unknowngall-common-environment-variance-unknowngall-special-environment-variance-unknowngall-residual-variance-unknowngall-phenotypic-variance-unknowngall-genetic-covariance-unknowngall-phenotypic-covariance-unknowngall-genetic-correlation-unknowngall-phenotypic-correlation-unknowngall-G-matrix-unknowngall-P-matrix-unknowngall-M-matrix-unknowngall-E-matrix-unknowngall-evolutionary-potential-unknowngall-evolutionary-response-unknowngall-breeder's-equation-unknowngall-selection-gradient-unknowngall-selection-differential-unknowngall-fitness-function-unknowngall-adaptive-landscape-unknowngall-fitness-peak-unknowngall-fitness-valley-unknowngall-saddle-point-unknowngall-ridge-unknowngall-holey-landscape-unknowngall-rugged-landscape-unknowngall-smooth-landscape-unknowngall-neutral-landscape-unknowngall-nearly-neutral-landscape-unknowngall-house-of-cards-model-unknowngall-infinitesimal-model-unknowngall-continuum-of-alleles-model-unknowngall-geometric-model-unknowngall-Fisher's-geometric-model-unknowngall-Orr's-mutational-landscape-model-unknowngall-quantitative-trait-locus-unknowngall-QTL-mapping-unknowngall-genome-wide-association-study-unknowngall-GWAS-unknowngall-candidate-gene-study-unknowngall-transcriptome-study-unknowngall-proteome-study-unknowngall-metabolome-study-unknowngall-phenome-study-unknowngall-eQTL-unknowngall-pQTL-unknowngall-mQTL-unknowngall-phQTL-unknowngall-multi-omics-unknowngall-systems-biology-unknowngall-network-biology-unknowngall-functional-genomics-unknowngall-structural-genomics-unknowngall-comparative-genomics-unknowngall-evolutionary-genomics-unknowngall-ecological-genomics-unknowngall-conservation-genomics-unknowngall-medical-genomics-irrelevantgall-agricultural-genomics-unknowngall-pest-genomics-unknowngall-invasion-genomics-unknowngall-population-genomics-unknowngall-landscape-genomics-unknowngall-phylogenomics-unknowngall-metagenomics-unknowngall-microbiomics-unknowngall-viromics-unknowngall-bacteriomics-unknowngall-mycobiomics-unknowngall-parasitomics-unknowngall-interactomics-unknowngall-phenomics-unknowngall-environomics-unknowngall-toxicogenomics-unknowngall-nutrigenomics-unknowngall-chronogenomics-unknowngall-circadian-genomics-unknowngall-epigenomics-unknowngall-methylomics-unknowngall-histonomics-unknowngall-chromatinomics-unknowngall-non-coding-RNA-genomics-unknowngall-transposomics-unknowngall-repeatomics-unknowngall-centromerics-unknowngall-telomerics-unknowngall-segmental-duplication-unknowngall-whole-genome-duplication-unknowngall-polyploidy-unknowngall-aneuploidy-unknowngall-chromosomal-rearrangement-unknowngall-inversion-unknowngall-translocation-unknowngall-fusion-unknowngall-fission-unknowngall-deletion-unknowngall-duplication-unknowngall-insertion-unknowngall-substitution-unknowngall-indel-unknowngall-single-nucleotide-polymorphism-unknowngall-SNP-unknowngall-insertion-deletion-polymorphism-unknowngall-copy-number-variation-unknowngall-CNV-unknowngall-structural-variation-unknowngall-SV-unknowngall-mobile-element-insertion-unknowngall-MEI-unknowngall-microsatellite-unknowngall-simple-sequence-repeat-unknowngall-SSR-unknowngall-short-tandem-repeat-unknowngall-STR-unknowngall-minisatellite-unknowngall-variable-number-tandem-repeat-unknowngall-VNTR-unknowngall-satellite-DNA-unknowngall-transposable-element-unknowngall-TE-unknowngall-retrotransposon-unknowngall-DNA-transposon-unknowngall-rolling-circle-transposon-unknowngall-helitron-unknowngall-Maverick-unknowngall-Polinton-unknowngall-SINE-unknowngall-LINE-unknowngall-LTR-retrotransposon-unknowngall-non-LTR-retrotransposon-unknowngall-endogenous-retrovirus-unknowngall-ERV-unknowngall-long-interspersed-nuclear-element-unknowngall-short-interspersed-nuclear-element-unknowngall-Alu-element-irrelevantgall-MIR-element-unknowngall-L1-element-unknowngall-L2-element-unknowngall-CR1-element-unknowngall-RTE-element-unknowngall-R2-element-unknowngall-R4-element-unknowngall-Jockey-element-unknowngall-I-element-unknowngall-F-element-unknowngall-Doc-element-unknowngall-G-element-unknowngall-R1-element-unknowngall-R3-element-unknowngall-LOA-element-unknowngall-R2D2-element-unknowngall-R4D4-element-unknowngall-Deus-element-unknowngall-Nematis-element-unknowngall-NeSL-element-unknowngall-Vingi-element-unknowngall-Penelope-element-unknowngall-Athena-element-unknowngall-Tc1/mariner-element-unknowngall-hAT-element-unknowngall-Mutator-element-unknowngall-P-element-irrelevantgall-piggyBac-element-unknowngall-Minos-element-unknowngall-mariner-element-unknowngall-Tc1-element-unknowngall-Tc2-element-unknowngall-Tc3-element-unknowngall-Tc4-element-unknowngall-Tc5-element-unknowngall-Tc6-element-unknowngall-Tc7-element-unknowngall-Tc8-element-unknowngall-Tc9-element-unknowngall-Tc10-element-unknowngall-Tc11-element-unknowngall-Tc12-element-unknowngall-Tc13-element-unknowngall-Tc14-element-unknowngall-Tc15-element-unknowngall-Tc16-element-unknowngall-Tc17-element-unknowngall-Tc18-element-unknowngall-Tc19-element-unknowngall-Tc20-element-unknowngall-Tc21-element-unknowngall-Tc22-element-unknowngall-Tc23-element-unknowngall-Tc24-element-unknowngall-Tc25-element-unknowngall-Tc26-element-unknowngall-Tc27-element-unknowngall-Tc28-element-unknowngall-Tc29-element-unknowngall-Tc30-element-unknowngall-Tc31-element-unknowngall-Tc32-element-unknowngall-Tc33-element-unknowngall-Tc34-element-unknowngall-Tc35-element-unknowngall-Tc36-element-unknowngall-Tc37-element-unknowngall-Tc38-element-unknowngall-Tc39-element-unknowngall-Tc40-element-unknowngall-Tc41-element-unknowngall-Tc42-element-unknowngall-Tc43-element-unknowngall-Tc44-element-unknowngall-Tc45-element-unknowngall-Tc46-element-unknowngall-Tc47-element-unknowngall-Tc48-element-unknowngall-Tc49-element-unknowngall-Tc50-element-unknowngall-Tc51-element-unknowngall-Tc52-element-unknowngall-Tc53-element-unknowngall-Tc54-element-unknowngall-Tc55-element-unknowngall-Tc56-element-unknowngall-Tc57-element-unknowngall-Tc58-element-unknowngall-Tc59-element-unknowngall-Tc60-element-unknowngall-Tc61-element-unknowngall-Tc62-element-unknowngall-Tc63-element-unknowngall-Tc64-element-unknowngall-Tc65-element-unknowngall-Tc66-element-unknowngall-Tc67-element-unknowngall-Tc68-element-unknowngall-Tc69-element-unknowngall-Tc70-element-unknowngall-Tc71-element-unknowngall-Tc72-element-unknowngall-Tc73-element-unknowngall-Tc74-element-unknowngall-Tc75-element-unknowngall-Tc76-element-unknowngall-Tc77-element-unknowngall-Tc78-element-unknowngall-Tc79-element-unknowngall-Tc80-element-unknowngall-Tc81-element-unknowngall-Tc82-element-unknowngall-Tc83-element-unknowngall-Tc84-element-unknowngall-Tc85-element-unknowngall-Tc86-element-unknowngall-Tc87-element-unknowngall-Tc88-element-unknowngall-Tc89-element-unknowngall-Tc90-element-unknowngall-Tc91-element-unknowngall-Tc92-element-unknowngall-Tc93-element-unknowngall-Tc94-element-unknowngall-Tc95-element-unknowngall-Tc96-element-unknowngall-Tc97-element-unknowngall-Tc98-element-unknowngall-Tc99-element-unknowngall-Tc100-element-unknowngall-Tc101-element-unknowngall-Tc102-element-unknowngall-Tc103-element-unknowngall-Tc104-element-unknowngall-Tc105-element-unknowngall-Tc106-element-unknowngall-Tc107-element-unknowngall-Tc108-element-unknowngall-Tc109-element-unknowngall-Tc110-element-unknowngall-Tc111-element-unknowngall-Tc112-element-unknowngall-Tc113-element-unknowngall-Tc114-element-unknowngall-Tc115-element-unknowngall-Tc116-element-unknowngall-Tc117-element-unknowngall-Tc118-element-unknowngall-Tc119-element-unknowngall-Tc120-element-unknowngall-Tc121-element-unknowngall-Tc122-element-unknowngall-Tc123-element-unknowngall-Tc124-element-unknowngall-Tc125-element-unknowngall-Tc126-element-unknowngall-Tc127-element-unknowngall-Tc128-element-unknowngall-Tc129-element-unknowngall-Tc130-element-unknowngall-Tc131-element-unknowngall-Tc132-element-unknowngall-Tc133-element-unknowngall-Tc134-element-unknowngall-Tc135-element-unknowngall-Tc136-element-unknowngall-Tc137-element-unknowngall-Tc138-element-unknowngall-Tc139-element-unknowngall-Tc140-element-unknowngall-Tc141-element-unknowngall-Tc142-element-unknowngall-Tc143-element-unknowngall-Tc144-element-unknowngall-Tc145-element-unknowngall-Tc146-element-unknowngall-Tc147-element-unknowngall-Tc148-element-unknowngall-Tc149-element-unknowngall-Tc150-element-unknowngall-Tc151-element-unknowngall-Tc152-element-unknowngall-Tc153-element-unknowngall-Tc154-element-unknowngall-Tc155-element-unknowngall-Tc156-element-unknowngall-Tc157-element-unknowngall-Tc158-element-unknowngall-Tc159-element-unknowngall-Tc160-element-unknowngall-Tc161-element-unknowngall-Tc162-element-unknowngall-Tc163-element-unknowngall-Tc164-element-unknowngall-Tc165-element-unknowngall-Tc166-element-unknowngall-Tc167-element-unknowngall-Tc168-element-unknowngall-Tc169-element-unknowngall-Tc170-element-unknowngall-Tc171-element-unknowngall-Tc172-element-unknowngall-Tc173-element-unknowngall-Tc174-element-unknowngall-Tc175-element-unknowngall-Tc176-element-unknowngall-Tc177-element-unknowngall-Tc178-element-unknowngall-Tc179-element-unknowngall-Tc180-element-unknowngall-Tc181-element-unknowngall-Tc182-element-unknowngall-Tc183-element-unknowngall-Tc184-element-unknowngall-Tc185-element-unknowngall-Tc186-element-unknowngall-Tc187-element-unknowngall-Tc188-element-unknowngall-Tc189-element-unknowngall-Tc190-element-unknowngall-Tc191-element-unknowngall-Tc192-element-unknowngall-Tc193-element-unknowngall-Tc194-element-unknowngall-Tc195-element-unknowngall-Tc196-element-unknowngall-Tc197-element-unknowngall-Tc198-element-unknowngall-Tc199-element-unknowngall-Tc200-element-unknowngall-Tc201-element-unknowngall-Tc202-element-unknowngall-Tc203-element-unknowngall-Tc204-element-unknowngall-Tc205-element-unknowngall-Tc206-element-unknowngall-Tc207-element-unknowngall-Tc208-element-unknowngall-Tc209-element-unknowngall-Tc210-element-unknowngall-Tc211-element-unknowngall-Tc212-element-unknowngall-Tc213-element-unknowngall-Tc214-element-unknowngall-Tc215-element-unknowngall-Tc216-element-unknowngall-Tc217-element-unknowngall-Tc218-element-unknowngall-Tc219-element-unknowngall-Tc220-element-unknowngall-Tc221-element-unknowngall-Tc222-element-unknowngall-Tc223-element-unknowngall-Tc224-element-unknowngall-Tc225-element-unknowngall-Tc226-element-unknowngall-Tc227-element-unknowngall-Tc228-element-unknowngall-Tc229-element-unknowngall-Tc230-element-unknowngall-Tc231-element-unknowngall-Tc232-element-unknowngall-Tc233-element-unknowngall-Tc234-element-unknowngall-Tc235-element-unknowngall-Tc236-element-unknowngall-Tc237-element-unknowngall-Tc238-element-unknowngall-Tc239-element-unknowngall-Tc240-element-unknowngall-Tc241-element-unknowngall-Tc242-element-unknowngall-Tc243-element-unknowngall-Tc244-element-unknowngall-Tc245-element-unknowngall-Tc246-element-unknowngall-Tc247-element-unknowngall-Tc248-element-unknowngall-Tc249-element-unknowngall-Tc250-element-unknowngall-Tc251-element-unknowngall-Tc252-element-unknowngall-Tc253-element-unknowngall-Tc254-element-unknowngall-Tc255-element-unknowngall-Tc256-element-unknowngall-Tc257-element-unknowngall-Tc258-element-unknowngall-Tc259-element-unknowngall-Tc260-element-unknowngall-Tc261-element-unknowngall-Tc262-element-unknowngall-Tc263-element-unknowngall-Tc264-element-unknowngall-Tc265-element-unknowngall-Tc266-element-unknowngall-Tc267-element-unknowngall-Tc268-element-unknowngall-Tc269-element-unknowngall-Tc270-element-unknowngall-Tc271-element-unknowngall-Tc272-element-unknowngall-Tc273-element-unknowngall-Tc274-element-unknowngall-Tc275-element-unknowngall-Tc276-element-unknowngall-Tc277-element-unknowngall-Tc278-element-unknowngall-Tc279-element-unknowngall-Tc280-element-unknowngall-Tc281-element-unknowngall-Tc282-element-unknowngall-Tc283-element-unknowngall-Tc284-element-unknowngall-Tc285-element-unknowngall-Tc286-element-unknowngall-Tc287-element-unknowngall-Tc288-element-unknowngall-Tc289-element-unknowngall-Tc290-element-unknowngall-Tc291-element-unknowngall-Tc292-element-unknowngall-Tc293-element-unknowngall-Tc294-element-unknowngall-Tc295-element-unknowngall-Tc296-element-unknowngall-Tc297-element-unknowngall-Tc298-element-unknowngall-Tc299-element-unknowngall-Tc300-element-unknowngall-Tc301-element-unknowngall-Tc302-element-unknowngall-Tc303-element-unknowngall-Tc304-element-unknowngall-Tc305-element-unknowngall-Tc306-element-unknowngall-Tc307-element-unknowngall-Tc308-element-unknowngall-Tc309-element-unknowngall-Tc310-element-unknowngall-Tc311-element-unknowngall-Tc312-element-unknowngall-Tc313-element-unknowngall-Tc314-element-unknowngall-Tc315-element-unknowngall-Tc316-element-unknowngall-Tc317-element-unknowngall-Tc318-element-unknowngall-Tc319-element-unknowngall-Tc320-element-unknowngall-Tc321-element-unknowngall-Tc322-element-unknowngall-Tc323-element-unknowngall-Tc324-element-unknowngall-Tc325-element-unknowngall-Tc326-element-unknowngall-Tc327-element-unknowngall-Tc328-element-unknowngall-Tc329-element-unknowngall-Tc330-element-unknowngall-Tc331-element-unknowngall-Tc332-element-unknowngall-Tc333-element-unknowngall-Tc334-element-unknowngall-Tc335-element-unknowngall-Tc336-element-unknowngall-Tc337-element-unknowngall-Tc338-element-unknowngall-Tc339-element-unknowngall-Tc340-element-unknowngall-Tc341-element-unknowngall-Tc342-element-unknowngall-Tc343-element-unknowngall-Tc344-element-unknowngall-Tc345-element-unknowngall-Tc346-element-unknowngall-Tc347-element-unknowngall-Tc348-element-unknowngall-Tc349-element-unknowngall-Tc350-element-unknowngall-Tc351-element-unknowngall-Tc352-element-unknowngall-Tc353-element-unknowngall-Tc354-element-unknowngall-Tc355-element-unknowngall-Tc356-element-unknowngall-Tc357-element-unknowngall-Tc358-element-unknowngall-Tc359-element-unknowngall-Tc360-element-unknowngall-Tc361-element-unknowngall-Tc362-element-unknowngall-Tc363-element-unknowngall-Tc364-element-unknowngall-Tc365-element-unknowngall-Tc366-element-unknowngall-Tc367-element-unknowngall-Tc368-element-unknowngall-Tc369-element-unknowngall-Tc370-element-unknowngall-Tc371-element-unknowngall-Tc372-element-unknowngall-Tc373-element-unknowngall-Tc374-element-unknowngall-Tc375-element-unknowngall-Tc376-element-unknowngall-Tc377-element-unknowngall-Tc378-element-unknowngall-Tc379-element-unknowngall-Tc380-element-unknowngall-Tc381-element-unknowngall-Tc382-element-unknowngall-Tc383-element-unknowngall-Tc384-element-unknowngall-Tc385-element-unknowngall-Tc386-element-unknowngall-Tc387-element-unknowngall-Tc388-element-unknowngall-Tc389-element-unknowngall-Tc390-element-unknowngall-Tc391-element-unknowngall-Tc392-element-unknowngall-Tc393-element-unknowngall-Tc394-element-unknowngall-Tc395-element-unknowngall-Tc396-element-unknowngall-Tc397-element-unknowngall-Tc398-element-unknowngall-Tc399-element-unknowngall-Tc400-element-unknowngall-Tc401-element-unknowngall-Tc402-element-unknowngall-Tc403-element-unknowngall-Tc404-element-unknowngall-Tc405-element-unknowngall-Tc406-element-unknowngall-Tc407-element-unknowngall-Tc408-element-unknowngall-Tc409-element-unknowngall-Tc410-element-unknowngall-Tc411-element-unknowngall-Tc412-element-unknowngall-Tc413-element-unknowngall-Tc414-element-unknowngall-Tc415-element-unknowngall-Tc416-element-unknowngall-Tc417-element-unknowngall-Tc418-element-unknowngall-Tc419-element-unknowngall-Tc420-element-unknowngall-Tc421-element-unknowngall-Tc422-element-unknowngall-Tc423-element-unknowngall-Tc424-element-unknowngall-Tc425-element-unknowngall-Tc426-element-unknowngall-Tc427-element-unknowngall-Tc428-element-unknowngall-Tc429-element-unknowngall-Tc430-element-unknowngall-Tc431-element-unknowngall-Tc432-element-unknowngall-Tc433-element-unknowngall-Tc434-element-unknowngall-Tc435-element-unknowngall-Tc436-element-unknowngall-Tc437-element-unknowngall-Tc438-element-unknowngall-Tc439-element-unknowngall-Tc440-element-unknowngall-Tc441-element-unknowngall-Tc442-element-unknowngall-Tc443-element-unknowngall-Tc444-element-unknowngall-Tc445-element-unknowngall-Tc446-element-unknowngall-Tc447-element-unknowngall-Tc448-element-unknowngall-Tc449-element-unknowngall-Tc450-element-unknowngall-Tc451-element-unknowngall-Tc452-element-unknowngall-Tc453-element-unknowngall-Tc454-element-unknowngall-Tc455-element-unknowngall-Tc456-element-unknowngall-Tc457-element-unknowngall-Tc458-element-unknowngall-Tc459-element-unknowngall-Tc460-element-unknowngall-Tc461-element-unknowngall-Tc462-element-unknowngall-Tc463-element-unknowngall-Tc464-element-unknowngall-Tc465-element-unknowngall-Tc466-element-unknowngall-Tc467-element-unknowngall-Tc468-element-unknowngall-Tc469-element-unknowngall-Tc470-element-unknowngall-Tc471-element-unknowngall-Tc472-element-unknowngall-Tc473-element-unknowngall-Tc474-element-unknowngall-Tc475-element-unknowngall-Tc476-element-unknowngall-Tc477-element-unknowngall-Tc478-element-unknowngall-Tc479-element-unknowngall-Tc480-element-unknowngall-Tc481-element-unknowngall-Tc482-element-unknowngall-Tc483-element-unknowngall-Tc484-element-unknowngall-Tc485-element-unknowngall-Tc486-element-unknowngall-Tc487-element-unknowngall-Tc488-element-unknowngall-Tc489-element-unknowngall-Tc490-element-unknowngall-Tc491-element-unknowngall-Tc492-element-unknowngall-Tc493-element-unknowngall-Tc494-element-unknowngall-Tc495-element-unknowngall-Tc496-element-unknowngall-Tc497-element-unknowngall-Tc498-element-unknowngall-Tc499-element-unknowngall-Tc500-element-unknowngall-Tc501-element-unknowngall-Tc502-element-unknowngall-Tc503-element-unknowngall-Tc504-element-unknowngall-Tc505-element-unknowngall-Tc506-element-unknowngall-Tc507-element-unknowngall-Tc508-element-unknowngall-Tc509-element-unknowngall-Tc510-element-unknowngall-Tc511-element-unknowngall-Tc512-element-unknowngall-Tc513-element-unknowngall-Tc514-element-unknowngall-Tc515-element-unknowngall-Tc516-element-unknowngall-Tc517-element-unknowngall-Tc518-element-unknowngall-Tc519-element-unknowngall-Tc520-element-unknowngall-Tc521-element-unknowngall-Tc522-element-unknowngall-Tc523-element-unknowngall-Tc524-element-unknowngall-Tc525-element-unknowngall-Tc526-element-unknowngall-Tc527-element-unknowngall-Tc528-element-unknowngall-Tc529-element-unknowngall-Tc530-element-unknowngall-Tc531-element-unknowngall-Tc532-element-unknowngall-Tc533-element-unknowngall-Tc534-element-unknowngall-Tc535-element-unknowngall-Tc536-element-unknowngall-Tc537-element-unknowngall-Tc538-element-unknowngall-Tc539-element-unknowngall-Tc540-element-unknowngall-Tc541-element-unknowngall-Tc542-element-unknowngall-Tc543-element-unknowngall-Tc544-element-unknowngall-Tc545-element-unknowngall-Tc546-element-unknowngall-Tc547-element-unknowngall-Tc548-element-unknowngall-Tc549-element-unknowngall-Tc550-element-unknowngall-Tc551-element-unknowngall-Tc552-element-unknowngall-Tc553-element-unknowngall-Tc554-element-unknowngall-Tc555-element-unknowngall-Tc556-element-unknowngall-Tc557-element-unknowngall-Tc558-element-unknowngall-Tc559-element-unknowngall-Tc560-element-unknowngall-Tc561-element-unknowngall-Tc562-element-unknowngall-Tc563-element-unknowngall-Tc564-element-unknowngall-Tc565-element-unknowngall-Tc566-element-unknowngall-Tc567-element-unknowngall-Tc568-element-unknowngall-Tc569-element-unknowngall-Tc570-element-unknowngall-Tc571-element-unknowngall-Tc572-element-unknowngall-Tc573-element-unknowngall-Tc574-element-unknowngall-Tc575-element-unknowngall-Tc576-element-unknowngall-Tc577-element-unknowngall-Tc578-element-unknowngall-Tc579-element-unknowngall-Tc580-element-unknowngall-Tc581-element-unknowngall-Tc582-element-unknowngall-Tc583-element-unknowngall-Tc584-element-unknowngall-Tc585-element-unknowngall-Tc586-element-unknowngall-Tc587-element-unknowngall-Tc588-element-unknowngall-Tc589-element-unknowngall-Tc590-element-unknowngall-Tc591-element-unknowngall-Tc592-element-unknowngall-Tc593-element-unknowngall-Tc594-element-unknowngall-Tc595-element-unknowngall-Tc596-element-unknowngall-Tc597-element-unknowngall-Tc598-element-unknowngall-Tc599-element-unknowngall-Tc600-element-unknowngall-Tc601-element-unknowngall-Tc602-element-unknowngall-Tc603-element-unknowngall-Tc604-element-unknowngall-Tc605-element-unknowngall-Tc606-element-unknowngall-Tc607-element-unknowngall-Tc608-element-unknowngall-Tc609-element-unknowngall-Tc610-element-unknowngall-Tc611-element-unknowngall-Tc612-element-unknowngall-Tc613-element-unknowngall-Tc614-element-unknowngall-Tc615-element-unknowngall-Tc616-element-unknowngall-Tc617-element-unknowngall-Tc618-element-unknowngall-Tc619-element-unknowngall-Tc620-element-unknowngall-Tc621-element-unknowngall-Tc622-element-unknowngall-Tc623-element-unknowngall-Tc624-element-unknowngall-Tc625-element-unknowngall-Tc626-element-unknowngall-Tc627-element-unknowngall-Tc628-element-unknowngall-Tc629-element-unknowngall-Tc630-element-unknowngall-Tc631-element-unknowngall-Tc632-element-unknowngall-Tc633-element-unknowngall-Tc634-element-unknowngall-Tc635-element-unknowngall-Tc636-element-unknowngall-Tc637-element-unknowngall-Tc638-element-unknowngall-Tc639-element-unknowngall-Tc640-element-unknowngall-Tc641-element-unknowngall-Tc642-element-unknowngall-Tc643-element-unknowngall-Tc644-element-unknowngall-Tc645-element-unknowngall-Tc646-element-unknowngall-Tc647-element-unknowngall-Tc648-element-unknowngall-Tc649-element-unknowngall-Tc650-element-unknowngall-Tc651-element-unknowngall-Tc652-element-unknowngall-Tc653-element-unknowngall-Tc654-element-unknowngall-Tc655-element-unknowngall-Tc656-element-unknowngall-Tc657-element-unknowngall-Tc658-element-unknowngall-Tc659-element-unknowngall-Tc660-element-unknowngall-Tc661-element-unknowngall-Tc662-element-unknowngall-Tc663-element-unknowngall-Tc664-element-unknowngall-Tc665-element-unknowngall-Tc666-element-unknowngall-Tc667-element-unknowngall-Tc668-element-unknowngall-Tc669-element-unknowngall-Tc670-element-unknowngall-Tc671-element-unknowngall-Tc672-element-unknowngall-Tc673-element-unknowngall-Tc674-element-unknowngall-Tc675-element-unknowngall-Tc676-element-unknowngall-Tc677-element-unknowngall-Tc678-element-unknowngall-Tc679-element-unknowngall-Tc680-element-unknowngall-Tc681-element-unknowngall-Tc682-element-unknowngall-Tc683-element-unknowngall-Tc684-element-unknowngall-Tc685-element-unknowngall-Tc686-element-unknowngall-Tc687-element-unknowngall-Tc688-element-unknowngall-Tc689-element-unknowngall-Tc690-element-unknowngall-Tc691-element-unknowngall-Tc692-element-unknowngall-Tc693-element-unknowngall-Tc694-element-unknowngall-Tc695-element-unknowngall-Tc696-element-unknowngall-Tc697-element-unknowngall-Tc698-element-unknowngall-Tc699-element-unknowngall-Tc700-element-unknowngall-Tc701-element-unknowngall-Tc702-element-unknowngall-Tc703-element-unknowngall-Tc704-element-unknowngall-Tc705-element-unknowngall-Tc706-element-unknowngall-Tc707-element-unknowngall-Tc708-element-unknowngall-Tc709-element-unknowngall-Tc710-element-unknowngall-Tc711-element-unknowngall-Tc712-element-unknowngall-Tc713-element-unknowngall-Tc714-element-unknowngall-Tc715-element-unknowngall-Tc716-element-unknowngall-Tc717-element-unknowngall-Tc718-element-unknowngall-Tc719-element-unknowngall-Tc720-element-unknowngall-Tc721-element-unknowngall-Tc722-element-unknowngall-Tc723-element-unknowngall-Tc724-element-unknowngall-Tc725-element-unknowngall-Tc726-element-unknowngall-Tc727-element-unknowngall-Tc728-element-unknowngall-Tc729-element-unknowngall-Tc730-element-unknowngall-Tc731-element-unknowngall-Tc732-element-unknowngall-Tc733-element-unknowngall-Tc734-element-unknowngall-Tc735-element-unknowngall-Tc736-element-unknowngall-Tc737-element-unknowngall-Tc738-element-unknowngall-Tc739-element-unknowngall-Tc740-element-unknowngall-Tc741-element-unknowngall-Tc742-element-unknowngall-Tc743-element-unknowngall-Tc744-element-unknowngall-Tc745-element-unknowngall-Tc746-element-unknowngall-Tc747-element-unknowngall-Tc748-element-unknowngall-Tc749-element-unknowngall-Tc750-element-unknowngall-Tc751-element-unknowngall-Tc752-element-unknowngall-Tc753-element-unknowngall-Tc754-element-unknowngall-Tc755-element-unknowngall-Tc756-element-unknowngall-Tc757-element-unknowngall-Tc758-element-unknowngall-Tc759-element-unknowngall-Tc760-element-unknowngall-Tc761-element-unknowngall-Tc762-element-unknowngall-Tc763-element-unknowngall-Tc764-element-unknowngall-Tc765-element-unknowngall-Tc766-element-unknowngall-Tc767-element-unknowngall-Tc768-element-unknowngall-Tc769-element-unknowngall-Tc770-element-unknowngall-Tc771-element-unknowngall-Tc772-element-unknowngall-Tc773-element-unknowngall-Tc774-element-unknowngall-Tc775-element-unknowngall-Tc776-element-unknowngall-Tc777-element-unknowngall-Tc778-element-unknowngall-Tc779-element-unknowngall-Tc780-element-unknowngall-Tc781-element-unknowngall-Tc782-element-unknowngall-Tc783-element-unknowngall-Tc784-element-unknowngall-Tc785-element-unknowngall-Tc786-element-unknowngall-Tc787-element-unknowngall-Tc788-element-unknowngall-Tc789-element-unknowngall-Tc790-element-unknowngall-Tc791-element-unknowngall-Tc792-element-unknowngall-Tc793-element-unknowngall-Tc794-element-unknowngall-Tc795-element-unknowngall-Tc796-element-unknowngall-Tc797-element-unknowngall-Tc798-element-unknowngall-Tc799-element-unknowngall-Tc800-element-unknowngall-Tc801-element-unknowngall-Tc802-element-unknowngall-Tc803-element-unknowngall-Tc804-element-unknowngall-Tc805-element-unknowngall-Tc806-element-unknowngall-Tc807-element-unknowngall-Tc808-element-unknowngall-Tc809-element-unknowngall-Tc810-element-unknowngall-Tc811-element-unknowngall-Tc812-element-unknowngall-Tc813-element-unknowngall-Tc814-element-unknowngall-Tc815-element-unknowngall-Tc816-element-unknowngall-Tc817-element-unknowngall-Tc818-element-unknowngall-Tc819-element-unknowngall-Tc820-element-unknowngall-Tc821-element-unknowngall-Tc822-element-unknowngall-Tc823-element-unknowngall-Tc824-element-unknowngall-Tc825-element-unknowngall-Tc826-element-unknowngall-Tc827-element-unknowngall-Tc828-element-unknowngall-Tc829-element-unknowngall-Tc830-element-unknowngall-Tc831-element-unknowngall-Tc832-element-unknowngall-Tc833-element-unknowngall-Tc834-element-unknowngall-Tc835-element-unknowngall-Tc836-element-unknowngall-Tc837-element-unknowngall-Tc838-element-unknowngall-Tc839-element-unknowngall-Tc840-element-unknowngall-Tc841-element-unknowngall-Tc842-element-unknowngall-Tc843-element-unknowngall-Tc844-element-unknowngall-Tc845-element-unknowngall-Tc846-element-unknowngall-Tc847-element-unknowngall-Tc848-element-unknowngall-Tc849-element-unknowngall-Tc850-element-unknowngall-Tc851-element-unknowngall-Tc852-element-unknowngall-Tc853-element-unknowngall-Tc854-element-unknowngall-Tc855-element-unknowngall-Tc856-element-unknowngall-Tc857-element-unknowngall-Tc858-element-unknowngall-Tc859-element-unknowngall-Tc860-element-unknowngall-Tc861-element-unknowngall-Tc862-element-unknowngall-Tc863-element-unknowngall-Tc864-element-unknowngall-Tc865-element-unknowngall-Tc866-element-unknowngall-Tc867-element-unknowngall-Tc868-element-unknowngall-Tc869-element-unknowngall-Tc870-element-unknowngall-Tc871-element-unknowngall-Tc872-element-unknowngall-Tc873-element-unknowngall-Tc874-element-unknowngall-Tc875-element-unknowngall-Tc876-element-unknowngall-Tc877-element-unknowngall-Tc878-element-unknowngall-Tc879-element-unknowngall-Tc880-element-unknowngall-Tc881-element-unknowngall-Tc882-element-unknowngall-Tc883-element-unknowngall-Tc884-element-unknowngall-Tc885-element-unknowngall-Tc886-element-unknowngall-Tc887-element-unknowngall-Tc888-element-unknowngall-Tc889-element-unknowngall-Tc890-element-unknowngall-Tc891-element-unknowngall-Tc892-element-unknowngall-Tc893-element-unknowngall-Tc894-element-unknowngall-Tc895-element-unknowngall-Tc896-element-unknowngall-Tc897-element-unknowngall-Tc898-element-unknowngall-Tc899-element-unknowngall-Tc900-element-unknowngall-Tc901-element-unknowngall-Tc902-element-unknowngall-Tc903-element-unknowngall-Tc904-element-unknowngall-Tc905-element-unknowngall-Tc906-element-unknowngall-Tc907-element-unknowngall-Tc908-element-unknowngall-Tc909-element-unknowngall-Tc910-element-unknowngall-Tc911-element-unknowngall-Tc912-element-unknowngall-Tc913-element-unknowngall-Tc914-element-unknowngall-Tc915-element-unknowngall-Tc916-element-unknowngall-Tc917-element-unknowngall-Tc918-element-unknowngall-Tc919-element-unknowngall-Tc920-element-unknowngall-Tc921-element-unknowngall-Tc922-element-unknowngall-Tc923-element-unknowngall-Tc924-element-unknowngall-Tc925-element-unknowngall-Tc926-element-unknowngall-Tc927-element-unknowngall-Tc928-element-unknowngall-Tc929-element-unknowngall-Tc930-element-unknowngall-Tc931-element-unknowngall-Tc932-element-unknowngall-Tc933-element-unknowngall-Tc934-element-unknowngall-Tc935-element-unknowngall-Tc936-element-unknowngall-Tc937-element-unknowngall-Tc938-element-unknowngall-Tc939-element-unknowngall-Tc940-element-unknowngall-Tc941-element-unknowngall-Tc942-element-unknowngall-Tc943-element-unknowngall-Tc944-element-unknowngall-Tc945-element-unknowngall-Tc946-element-unknowngall-Tc947-element-unknowngall-Tc948-element-unknowngall-Tc949-element-unknowngall-Tc950-element-unknowngall-Tc951-element-unknowngall-Tc952-element-unknowngall-Tc953-element-unknowngall-Tc954-element-unknowngall-Tc955-element-unknowngall-Tc956-element-unknowngall-Tc957-element-unknowngall-Tc958-element-unknowngall-Tc959-element-unknowngall-Tc960-element-unknowngall-Tc961-element-unknowngall-Tc962-element-unknowngall-Tc963-element-unknowngall-Tc964-element-unknowngall-Tc965-element-unknowngall-Tc966-element-unknowngall-Tc967-element-unknowngall-Tc968-element-unknowngall-Tc969-element-unknowngall-Tc970-element-unknowngall-Tc971-element-unknowngall-Tc972-element-unknowngall-Tc973-element-unknowngall-Tc974-element-unknowngall-Tc975-element-unknowngall-Tc976-element-unknowngall-Tc977-element-unknowngall-Tc978-element-unknowngall-Tc979-element-unknowngall-Tc980-element-unknowngall-Tc981-element-unknowngall-Tc982-element-unknowngall-Tc983-element-unknowngall-Tc984-element-unknowngall-Tc985-element-unknowngall-Tc986-element-unknowngall-Tc987-element-unknowngall-Tc988-element-unknowngall-Tc989-element-unknowngall-Tc990-element-unknowngall-Tc991-element-unknowngall-Tc992-element-unknowngall-Tc993-element-unknowngall-Tc994-element-unknowngall-Tc995-element-unknowngall-Tc996-element-unknowngall-Tc997-element-unknowngall-Tc998-element-unknowngall-Tc999-element-unknowngall-Tc1000-element-unknownLeptoglossus
leaf-footed bugs
Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.
Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteranLeuronota maculata
Leuronota maculata is a psyllid species in the family Triozidae, first described by Crawford in 1910. It belongs to the order Hemiptera, the true bugs. As a member of the psyllid superfamily Psylloidea, it shares characteristics with other jumping plant lice, though specific biological details for this species remain limited in published literature.
Leuronota maritima
Leuronota maritima is a psyllid species in the family Triozidae, originally described as Trioza maritima by Tuthill in 1944 and later transferred to the genus Leuronota. It belongs to the Hemiptera order, a group of true bugs characterized by piercing-sucking mouthparts. The species has 28 documented observations on iNaturalist and 79 distribution records in GBIF, though specific ecological details remain limited in the available literature.
Livia vernaliforma
Livia vernaliforma is a species of jumping plant louse (psyllid) in the family Liviidae, described by Caldwell in 1940. It belongs to a genus whose members are associated with hackberry trees (Celtis species). The species has been recorded from several western and north-central U.S. states. Like other psyllids, it is a small, sap-feeding insect with host-specific relationships to its plant hosts.
Liviinae
Liviinae is a subfamily of plant lice within the family Liviidae (order Hemiptera). Members are small, sap-feeding insects that inhabit various host plants. The group is distinguished from the other subfamily in Liviidae, Euphyllurinae, by morphological and ecological characteristics.