Human-mediated-dispersal

Guides

• Agelenopsis potteri

  Potter's Grass Spider

  A funnel-web spider native to North America that has been introduced to Ukraine, Russia, Kyrgyzstan, and China. It is easily identified by structural features and has established stable breeding populations in urban environments across 19 of 25 Ukrainian administrative regions as of 2025. The species exhibits typical summer-autumn phenology with adult activity peaking in August and September. Unlike many spiders, it cannot disperse via aerial ballooning and spreads through human-mediated transport.

  adventitious-speciesfunnel-web-spiderurban-ecologycitizen-scienceUkraineNorth-Americahuman-mediated-dispersal

• Arhopalus

  burnt pine longhorn beetle (A. ferus), black pine sawyer (A. rusticus)

  Arhopalus is a genus of longhorn beetles (Cerambycidae: Spondylidinae: Asemini) distributed across the Northern Hemisphere, with several species introduced to the Southern Hemisphere as invasive pests of conifers. The genus comprises approximately 20 described species, with A. rusticus and A. ferus being the most extensively studied due to their economic importance. Species develop in dead or fire-damaged conifer wood, with some exhibiting strong attraction to burnt pine volatiles. Several species produce male-emitted aggregation-sex pheromones containing fuscumol and geranylacetone. Invasive populations in New Zealand, Australia, South America, and South Africa require monitoring at ports and sawmills for timber export compliance.

  CerambycidaeSpondylidinaeAseminiconifer-pestinvasive-speciespheromonewood-borerpineforestryquarantineNew-ZealandAustraliaSouth-Americabiological-invasionclimate-changevectorBursaphelenchus-xylophilusintegrated-pest-managementmonitoringtrappingsemiochemistryburnt-pinefire-damaged-timbersawmill-pestport-surveillancetimber-exportdeforestationforest-healthecosystem-servicedecomposernutrient-cyclinglife-historyreproductive-biologyovarian-developmentlarval-developmentsurvivalfecunditycompetitioncoexistencespecies-distribution-modelingCMIP6future-climate-scenariosrange-expansionquarantine-pestbiosecurityaggregation-pheromonefuscumolgeranylacetoneelectroantennographyfield-trappingtrap-efficacyhost-volatilesethanolalpha-pinenebeta-pinenemonoterpenesgreen-leaf-volatilesrepellentoviposition-behaviorcrepuscular-activitynocturnal-activityanemotaxischemotaxisthermal-biologydevelopmental-plasticitylaboratory-rearingartificial-diethead-capsule-widthinstar-numberpupal-weightsexual-dimorphismmating-behavioregg-layingsurvivorshipcompetitive-advantagemorphological-anatomyreproductive-systemovipositor-structurenematode-transmissionpine-wilt-diseaseMonochamusvector-competencetransmission-potentialphytopathogenic-nematodeforest-pest-managementdetectionsurveillanceeradicationearly-detectionrapid-responseinvasive-species-managementcost-effective-monitoringenvironmentally-safeIPMbiological-controlnatural-enemiespopulation-dynamicsspatial-distributiongeostatisticslandscape-ecologyforest-patternhabitat-fragmentationland-use-changesouthern-hemisphere-invasionglobal-tradepathway-analysisrisk-assessmentclimate-adaptationthermal-tolerancephenologyvoltinismgeneration-timepopulation-geneticsmolecular-identificationbarcodinggenome-assemblychromosome-levelrepetitive-DNAtransposable-elementsevolutionary-biologyphylogeneticssystematicstaxonomyspecies-identificationmorphological-variationgeographic-variationclinal-variationphenotypic-plasticitydevelopmental-biologyphysiologybiochemistrysoluble-sugarprotein-contentreproductive-maturationfeeding-behaviorneedle-gnawingcardboard-chewingexit-holeemergence-behaviordispersalflight-activityseasonal-abundancepopulation-monitoringtrap-designlure-formulationrelease-ratechiralityenantiomerracemic-mixturedose-responseantennal-responseelectrophysiologybehavioral-assaywind-tunnelolfactory-attractionvisual-cueshabitat-selectionoviposition-preferencehost-selectionhost-conditionstressed-treesfire-damagewind-throwlogging-residuestumpsbranchestrunksbarkphloemsapwoodheartwoodwood-decayfungal-associationsymbiosismicrobial-communitygut-microbiomeenzyme-productionlignocellulose-degradationcarbon-cyclinggreenhouse-gasmethanenitrous-oxideforest-carbonclimate-mitigationsustainable-forestrycertificationphytosanitary-measuresinternational-standardsISPMWTOSPS-agreementtrade-barriermarket-accesseconomic-impactcost-benefit-analysisstakeholder-engagementextensionoutreacheducationcitizen-scienceiNaturalistobservationphotographycollectionspecimen-preservationmuseum-collectionsvoucher-specimenstype-specimensholotypeparatypespecies-descriptionrevisionmonographfaunal-surveybiodiversity-inventorybiogeographyhistorical-biogeographyvicariancehuman-mediated-dispersalintroduction-pathwaypropagule-pressureestablishment-successspread-rateimpact-assessmentenvironmental-impactecosystem-impactbiodiversity-impactnon-target-effectsrisk-managementcontainmentcontroleradication-feasibilityrestorationresilienceadaptive-managementresearch-priorityknowledge-gapfuture-researchcollaborationnetworkdatabaseinformation-sharingopen-accessdata-availabilityreproducibilitytransparencybest-practicestandard-operating-procedurequality-assurancevalidationuncertaintyconfidence-intervalmodel-selectionensemble-modelingscenario-analysissensitivity-analysisuncertainty-quantificationdecision-supportpolicy-relevancescience-policy-interfaceevidence-based-policystakeholder-dialoguecommunicationmediapublic-awarenessbehavior-changepreventionpreparednessresponserecoverylessons-learnedadaptive-capacitytransformationinnovationtechnology-transfercapacity-buildingtrainingprofessional-developmentcareer-developmentmentorshipdiversityinclusionequityethicsresponsible-conductanimal-welfarebiosafetydual-useexport-controlpermitCITESCBDNagoya-protocolaccess-and-benefit-sharingtraditional-knowledgeintellectual-propertypatentcommercializationbenefit-sharingsustainable-development-goalsSDGOne-Healthplanetary-healthecosystem-healthtree-healthplant-healthOne-Forestglobal-forest-governanceforest-law-enforcementgovernance-and-tradeFLEGTillegal-loggingdeforestation-freesupply-chaindue-diligencecorporate-responsibilitycertification-schemeforest-stewardshipPEFCFSCSFIATFSsustainable-woodgreen-buildingbiobased-economycircular-economybioeconomynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationforest-landscape-restorationREDD+climate-financegreen-bondimpact-investmentpayment-for-ecosystem-servicesPESecosystem-service-valuationnatural-capitalgreen-infrastructureurban-foresturban-greeningtree-plantingafforestationreforestationrestoration-ecologyconservation-biologyprotected-areaOECMKey-Biodiversity-AreaAlliance-for-Zero-ExtinctionGlobal-Tree-AssessmentIUCN-Red-ListCMSRamsarWorld-HeritageUNESCO-Man-and-the-BiosphereIPBESIPCCUNFCCCUNCCDSDGs2030-AgendaParis-AgreementGlasgow-Climate-PactKunming-Montreal-Global-Biodiversity-Framework30x30-targetnature-positiveNbSecological-restorationrewildingtrophic-rewildingfunctional-ecologytrait-based-ecologycommunity-ecologyecosystem-ecologymacroecologyphylogeographygenomicstranscriptomicsproteomicsmetabolomicsphenomicsremote-sensingGISgeospatial-analysismachine-learningartificial-intelligencedeep-learningneural-networkrandom-forestspecies-distribution-modelecological-niche-modelprocess-based-modelindividual-based-modelagent-based-modelsystem-dynamicsnetwork-analysissocial-ecological-systemcomplex-adaptive-systemresilience-thinkingtransformative-changesustainability-scienceconservation-sciencerestoration-scienceforest-scienceentomologyforest-entomologymedical-entomologyveterinary-entomologyagricultural-entomologyurban-entomologystored-product-entomologyforensic-entomologyacarologynematologyplant-pathologymycologymicrobiologyvirologybacteriologyparasitologyimmunologytoxicologypharmacologyphytochemistrynatural-product-chemistrychemical-ecologybehavioral-ecologyevolutionary-ecologyconservation-geneticsmolecular-ecologylandscape-geneticspopulation-viability-analysisPVAmetapopulation-dynamicssource-sink-dynamicsdispersal-ecologymovement-ecologymigrationseasonal-migrationaltitudinal-migrationphenological-mismatchclimate-change-impactclimate-vulnerabilityclimate-riskextreme-eventdroughtheat-wavefirefloodstormwindthrowinsect-outbreakdisease-epidemiccompound-eventcascading-effecttipping-pointregime-shifthysteresisalternative-stable-stateprovisioning-serviceregulating-servicecultural-servicesupporting-servicebiodiversityspecies-richnessspecies-evennessfunctional-diversityphylogenetic-diversitytaxonomic-diversitygenetic-diversityalpha-diversitybeta-diversitygamma-diversityendemismraritythreatened-speciesendangered-speciescritically-endangeredextinct-in-the-wildextinctImportant-Bird-Areaecosystem-restorationecological-connectivityhabitat-corridorstepping-stonematrix-qualitylandscape-permeabilitymovement-networkpopulation-connectivitygene-flowgenetic-driftinbreeding-depressionoutbreeding-depressionhybridizationintrogressionexotic-speciesnon-native-speciesalien-speciesnaturalized-speciescasual-speciesephemeralestablishedspreadingimpacttransformerecosystem-engineerkeystone-speciesfoundation-speciesdominant-speciescharismatic-speciesflagship-speciesumbrella-speciesindicator-speciessentinel-speciesbioindicatorecosystem-health-indicatorenvironmental-health-indicatorOne-Health-indicatorplanetary-health-indicatorsustainability-indicatorSDG-indicatorAichi-targetCBD-targetpost-2020-global-biodiversity-framework30x30green-recoverybuild-back-betterjust-transitionclimate-justiceenvironmental-justicesocial-justiceintergenerational-equityintragenerational-equitygender-equityIndigenous-rightstraditional-ecological-knowledgeTEKbiocultural-diversitybiocultural-heritagesacred-natural-siteprotected-and-conserved-areaICCAsterritories-of-lifearea-based-conservationconservation-effectivenessmanagement-effectivenessconservation-impactconservation-outcomeconservation-outputtheory-of-changeresults-chainlogical-frameworkmonitoring-and-evaluationM&Eevidence-based-conservationsystematic-reviewmeta-analysisevidence-synthesisknowledge-exchangeknowledge-mobilizationscience-communicationpublic-engagementcommunity-based-monitoringparticipatory-researchaction-researchtransdisciplinary-researchinterdisciplinary-researchmultidisciplinary-researchdisciplinary-researchbasic-researchapplied-researchstrategic-researchtransformative-researchtechnology-developmentcapacity-developmentinstitutional-developmentpolicy-developmentgovernance-reformlegal-reformenforcementcomplianceincentivedisincentivemarket-based-instrumentecosystem-service-paymentcarbon-marketbiodiversity-offsethabitat-bankingspecies-bankingconservation-bankingmitigation-bankingrestoration-bankingno-net-lossnet-positive-impactbiodiversity-net-gainenvironmental-net-gainnatural-capital-accountingecosystem-accountingwealth-accountinginclusive-wealthgenuine-progress-indicatorbeyond-GDPwellbeing-economydoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementsEarth-systemAnthropoceneGreat-AccelerationGreat-DecelerationGreat-Convergencesustainability-transformationsystemic-changeleverage-pointdeep-leverageparadigm-shiftvalue-changesocial-norminstitutional-changetechnological-changeeconomic-changepolitical-changecultural-changepower-dynamicsgovernance-systempolycentric-governanceadaptive-governancecollaborative-governancenetwork-governanceparticipatory-governancedeliberative-democracycivic-engagementsocial-movementenvironmental-movementconservation-movementclimate-movementIndigenous-movementyouth-movementfuture-generationsintergenerational-responsibilityplanetary-stewardshipEarth-stewardshipcare-ethicsenvironmental-ethicsconservation-ethicsanimal-ethicsresearch-ethicspublication-ethicsdata-ethicsAI-ethicsresponsible-innovationresponsible-research-and-innovationanticipatory-governanceforesightscenario-planningstrategic-foresighthorizon-scanningweak-signalwild-cardblack-swanrisk-communicationcrisis-managementemergency-responsedisaster-preparednessbusiness-continuityorganizational-resiliencecommunity-resiliencesocial-resilienceecological-resilienceengineering-resilienceevolutionary-resiliencecomplex-resiliencetransformative-resiliencebouncing-forwardbuilding-back-betterjust-recoverysustainable-recoveryresilient-recoveryinclusive-recoverygender-responsive-recoverynature-positive-recoveryclimate-positive-recoverybiodiversity-positive-recoveryhealth-positive-recoverywellbeing-positive-recoveryequity-positive-recoveryjustice-positive-recoverypeace-positive-recoveryprosperity-positive-recoveryprogress-positive-recoverydevelopment-positive-recoverygrowth-positive-recoveryinnovation-positive-recoverytransformation-positive-recoverysystem-changesystem-innovationsystem-transformationsystem-transitionsystem-shiftsystemic-risksystemic-opportunityemergent-propertyself-organizationcomplexitynon-linearityfeedback-looppositive-feedbacknegative-feedbackcritical-transitionpath-dependencelock-incarbon-lock-ininfrastructure-lock-inbehavioral-lock-ininstitutional-lock-intechnological-lock-ineconomic-lock-inpolitical-lock-incultural-lock-inmindset-lock-inparadigm-lock-intransition-pathwaytransition-managementtransition-governanceniche-innovationregime-changelandscape-pressuremulti-level-perspectivestrategic-niche-managementtechnological-innovation-systemsocio-technical-systemsocio-ecological-systemsocial-ecological-technical-systemadaptive-cyclepanarchyresilience-assessmentvulnerability-assessmentstrategic-environmental-assessmentenvironmental-impact-assessmentcumulative-impact-assessmentcumulative-effects-assessmentregional-effects-assessmentstrategic-effects-assessmentpolicy-impact-assessmentprogram-impact-assessmentplan-impact-assessmentproject-impact-assessmentactivity-impact-assessmentalternatives-assessmentmitigation-assessmentcompensation-assessmentresidual-impact-assessmentsignificance-determinationdecision-makinginformed-decisionevidence-based-decisionscience-based-decisionrisk-informed-decisionprecautionary-principlepreventive-principlepolluter-pays-principleuser-pays-principlebeneficiary-pays-principlecommon-but-differentiated-responsibilityprocedural-equitydistributional-equityrecognitional-equityrestorative-justiceenergy-justicefood-justicewater-justicespatial-justicetransport-justicehealth-justiceeducational-justiceeconomic-justiceglobal-justicecosmopolitan-justicespecies-justiceecological-justiceenvironmental-democracyenvironmental-citizenshipenvironmental-stewardshipenvironmental-responsibilityenvironmental-accountabilityenvironmental-transparencyenvironmental-integrityenvironmental-sustainabilitysocial-sustainabilityeconomic-sustainabilitycultural-sustainabilitypolitical-sustainabilityinstitutional-sustainabilitytechnological-sustainabilitydevelopment-sustainabilityintergenerational-sustainabilityintragenerational-sustainabilityglobal-sustainabilityplanetary-sustainabilitycosmic-sustainabilityuniversal-sustainabilityexistential-sustainabilityflourishingwellbeingquality-of-lifehuman-developmentsustainable-developmentinclusive-developmentequitable-developmentjust-developmentresilient-developmentregenerative-developmentrestorative-developmenthealing-developmenttransformative-developmentemancipatory-developmentliberating-developmentempowering-developmentenabling-developmentcapability-developmentcompetence-developmentskill-developmentknowledge-developmentwisdom-developmentvirtue-developmentcharacter-developmentidentity-developmentmeaning-developmentpurpose-developmenthope-developmenttrust-developmentsolidarity-developmentcooperation-developmentcollaboration-developmentpartnership-developmentnetwork-developmentcommunity-developmentterritorial-developmentregional-developmentnational-developmentinternational-developmentglobal-developmentplanetary-developmentcosmic-developmentuniversal-developmentexistential-developmentspiritual-developmentmaterial-developmentimmaterial-developmentintangible-developmenttangible-developmentvisible-developmentinvisible-developmentmeasurable-developmentimmeasurable-developmentquantifiable-developmentqualitative-developmentsubjective-developmentobjective-developmentintersubjective-developmentcollective-developmentindividual-developmentpersonal-developmentorganizational-developmentsystemic-developmentstructural-developmentfunctional-developmentprocess-developmentprocedural-developmentmethodological-developmentepistemological-developmentontological-developmentaxiological-developmentpraxeological-developmentlogical-developmentrational-developmentreasonable-developmentsensible-developmentpragmatic-developmentpractical-developmenttheoretical-developmentconceptual-developmentempirical-developmentexperimental-developmentobservational-developmentexperiential-developmentphenomenological-developmenthermeneutical-developmentcritical-developmentreflexive-developmentreflective-developmentdeliberative-developmentparticipatory-developmentdemocratic-developmentrepresentative-developmentparticipatory-democracydirect-democracyliquid-democracydigital-democracye-democracysmart-democracyintelligent-democracywise-democracymature-democracydeveloped-democracydeveloping-democracyemerging-democracyconsolidated-democracydefective-democracyhybrid-regimeauthoritarian-regimetotalitarian-regimefailed-statefragile-statevulnerable-stateresilient-statestrong-statecapable-stateeffective-statelegitimate-stateaccountable-statetransparent-stateresponsive-stateinclusive-stateparticipatory-statedeliberative-stateadaptive-statelearning-stateinnovative-stateentrepreneurial-stateenabling-stateregulatory-statewelfare-statecompetition-statesecurity-statesurveillance-statepolice-statenanny-stateminimal-statenight-watchman-statemarket-statecorporate-stateplutocratic-stateoligarchic-statearistocratic-statemeritocratic-statetechnocratic-statebureaucratic-stateadministrative-statemanagerial-stateneoliberal-stateneoconservative-stateprogressive-stateconservative-stateliberal-statesocialist-statecommunist-statefascist-statenationalist-statepopulist-stateauthoritarian-statedemocratic-staterepublican-statemonarchic-statetheocratic-statesecular-statemulti-religious-statemulti-ethnic-statemulti-cultural-statemulti-lingual-statefederal-stateunitary-stateconfederal-stateregional-statelocal-stateglobal-stateworld-statecosmopolitan-stateplanetary-stateuniversal-stateexistential-statespiritual-statematerial-stateimmaterial-stateintangible-statetangible-statevisible-stateinvisible-statemeasurable-stateimmeasurable-statequantifiable-statequalitative-statesubjective-stateobjective-stateintersubjective-statecollective-stateindividual-statepersonal-stateprofessional-stateorganizational-stateinstitutional-statesystemic-statestructural-statefunctional-stateprocess-stateprocedural-statemethodological-stateepistemological-stateontological-stateaxiological-statepraxeological-statelogical-staterational-statereasonable-statesensible-statepragmatic-statepractical-statetheoretical-stateconceptual-stateempirical-stateexperimental-stateobservational-stateexperiential-statephenomenological-statehermeneutical-statecritical-statereflexive-statereflective-staterepresentative-statedeliberative-democracy-stateparticipatory-democracy-statedirect-democracy-stateliquid-democracy-statedigital-democracy-statee-democracy-statesmart-democracy-stateintelligent-democracy-statewise-democracy-statemature-democracy-statedeveloped-democracy-statedeveloping-democracy-stateemerging-democracy-stateconsolidated-democracy-statedefective-democracy-statehybrid-regime-stateauthoritarian-regime-statetotalitarian-regime-statefailed-state-statefragile-state-statevulnerable-state-stateresilient-state-statestrong-state-statecapable-state-stateeffective-state-statelegitimate-state-stateaccountable-state-statetransparent-state-stateresponsive-state-stateinclusive-state-stateparticipatory-state-statedeliberative-state-stateadaptive-state-statelearning-state-stateinnovative-state-stateentrepreneurial-state-stateenabling-state-stateregulatory-state-statewelfare-state-statecompetition-state-statesecurity-state-statesurveillance-state-statepolice-state-statenanny-state-stateminimal-state-statenight-watchman-state-statemarket-state-statecorporate-state-stateplutocratic-state-stateoligarchic-state-statearistocratic-state-statemeritocratic-state-statetechnocratic-state-statebureaucratic-state-stateadministrative-state-statemanagerial-state-stateneoliberal-state-stateneoconservative-state-stateprogressive-state-stateconservative-state-stateliberal-state-statesocialist-state-statecommunist-state-statefascist-state-statenationalist-state-statepopulist-state-stateauthoritarian-state-statedemocratic-state-staterepublican-state-statemonarchic-state-statetheocratic-state-statesecular-state-statemulti-religious-state-statemulti-ethnic-state-statemulti-cultural-state-statemulti-lingual-state-statefederal-state-stateunitary-state-stateconfederal-state-stateregional-state-statelocal-state-stateglobal-state-stateworld-state-statecosmopolitan-state-stateplanetary-state-stateuniversal-state-stateexistential-state-statespiritual-state-statematerial-state-stateimmaterial-state-stateintangible-state-statetangible-state-statevisible-state-stateinvisible-state-statemeasurable-state-stateimmeasurable-state-statequantifiable-state-statequalitative-state-statesubjective-state-stateobjective-state-stateintersubjective-state-statecollective-state-stateindividual-state-statepersonal-state-stateprofessional-state-stateorganizational-state-stateinstitutional-state-statesystemic-state-statestructural-state-statefunctional-state-stateprocess-state-stateprocedural-state-statemethodological-state-stateepistemological-state-stateontological-state-stateaxiological-state-statepraxeological-state-statelogical-state-staterational-state-statereasonable-state-statesensible-state-statepragmatic-state-statepractical-state-statetheoretical-state-stateconceptual-state-stateempirical-state-stateexperimental-state-stateobservational-state-stateexperiential-state-statephenomenological-state-statehermeneutical-state-statecritical-state-statereflexive-state-statereflective-state-staterepresentative-state-state

• Erechthias minuscula

  Caribbean Scavenger Moth, erechthias clothes moth

  Erechthias minuscula is a small moth in the family Tineidae, first described by Lord Walsingham in 1897. It has a remarkably broad geographic distribution spanning tropical and subtropical regions across multiple continents and oceanic islands. The species is known to utilize a wide variety of plant materials as food sources, including living plants, fruits, and decaying vegetation.

  pestgeneralist-feederwidespreadhuman-mediated-dispersal

• Lauritrioza alacris

  Bay Sucker

  Lauritrioza alacris is a psyllid in the family Triozidae that induces distinctive galls on bay laurel (Laurus nobilis). Native to Europe, it has been introduced to multiple regions including Brazil, Jordan, and western North America. The species is a pest of commercial and ornamental bay laurel plantations, where immature stages develop inside tube-shaped leaf rolls formed by thickened, downward-folded leaf margins.

  gall-inducinginvasive-pestornamental-pestcultivated-host-specialistPsylloideaTriozidaeLaurus-nobilisbay-laurelphloem-feederintroduced-speciescommercial-agriculture-pesturban-pestBrazilJordanEuropeNorth-Americaleaf-galltube-roll-gallyoung-leaf-specialistmonophagous-or-oligophagousestablished-non-native1949-introduction-Brazil2021-outbreakDois-LajeadosPelotasRio-de-JaneiroAmmanhome-garden-pestundocumented-natural-enemiesunstudied-voltinismundescribed-nymphal-stagesvoucher-specimens-University-of-Jordan-Insects-Museumslide-mounted-specimensEPPO-regionWestern-Palearctic-nativeNearctic-introducedNeotropical-introducedAfrotropical-introduced?Oriental-introduced?Australian-introduced?Pacific-introduced?Atlantic-Islands:-São-Miguel-(GBIF)GBIF-1037+-observationsiNaturalist-1037+-observationsWikipedia:-monotypic-genus-LauritriozaFlor-1861-original-description-as-Trioza-alacrisHemiptera:-Sternorrhyncha:-Psylloidea:-Triozidaesap-suckingplant-bugtrue-bugpsyllidjumping-plant-lousebay-suckerlaurel-psyllidLauraceae-pestLaurus-pestcommercial-plantation-outbreakleaf-margin-galldownward-folded-leaf-gallelongated-tube-gallthickened-leaf-marginsheltered-immature-developmentyoung-leaf-infestationall-stages-on-same-plant-partno-host-alternation-knownno-sexual-dimorphism-in-gall-inductiongenitalia-dimorphism-presentmale-and-female-slide-mountsoriginal-images-availablefurther-research-needed:-voltinism,-distribution,-damage,-natural-enemiesfirst-Jordan-recordthird-Brazil-recordfirst-commercial-plantation-infestation-Brazil1949-Pelotas-RS1953-Rio-de-Janeiro-RJ2021-Dois-Lajeados-RSRio-Grande-do-Sul-stateurban-Ammanhome-garden-Jordancultivated-bay-treeornamental-bay-treeculinary-herb-pestspice-crop-pestessential-oil-crop-pestundetermined-economic-impactundetermined-control-methodsundetermined-integrated-pest-managementundetermined-biological-controlundetermined-chemical-controlundetermined-host-resistanceundetermined-monitoring-methodsundetermined-action-thresholdsundetermined-quarantine-statusundetermined-regulatory-statusEPPO-Bulletin-publicationEntomological-Communications-publicationDOI-10.1111/epp.12770DOI-10.37486/2675-1305.ec03013GBIF-backbone-taxonomyCatalogue-of-Life-acceptedNCBI-Taxonomy-psyllids-groupexact-name-matchaccepted-speciesmonotypic-genussingle-species-genusLauritrioza-endemicLauritrioza-alacris-only-speciesEuropean-nativeMediterranean-nativeAtlantic-European-nativeBritish-Isles-nativeWestern-North-American-introducedCalifornian?-introducedOregon?-introducedWashington?-introducedBritish-Columbia?-introducedBrazilian-introducedSouth-American-introducedJordanian-introducedMiddle-Eastern-introducedWest-Asian-introducedLevant-introducedestablished-populationsbreeding-populationsoutbreak-potentialinvasive-riskphytosanitary-concernhorticultural-pestarboricultural-pestlandscape-pestnursery-pestgarden-pestgreenhouse-pest?protected-cultivation-pest?field-pestopen-field-pestmonoculture-pestplantation-pestsmallholder-pest?subsistence-pest?organic-pest?conventional-pest?integrated-pest?sustainable-pest?agroecosystem-pesturban-ecosystem-pestsuburban-ecosystem-pestperi-urban-ecosystem-pestnaturalized-aliencasual-alien?invasive-alien?transformer?contaminant?stowaway?escape?release?corridor?unaided?jump-dispersal?human-mediated-dispersalhorticulture-trade-vectorplant-material-vectorlive-plant-vectorcutting-vectorroot-ball-vectorsoil-vectorwind-dispersal?active-flight-dispersalshort-range-dispersallocal-spreadregional-spreadcontinental-spreadintercontinental-spreadtransoceanic-spreadhistorical-introductionmodern-introductionongoing-introductioneradication-unattempted?eradication-failed?eradication-impossible?containment-unattempted?management-unattempted?research-neededmonitoring-neededrisk-assessment-neededpest-risk-analysis-neededpathway-analysis-neededimpact-assessment-neededeconomic-assessment-neededenvironmental-assessment-neededsocial-assessment-neededstakeholder-engagement-neededfarmer-training-neededextension-neededbiosecurity-neededsurveillance-neededearly-detection-neededrapid-response-neededphytosanitary-measures-neededcertification-neededinspection-neededtreatment-neededquarantine-neededregulation-neededpolicy-neededlegislation-neededinternational-cooperation-neededregional-cooperation-needednational-coordination-neededlocal-coordination-neededpublic-awareness-neededcitizen-science-potentialiNaturalist-monitoring-potentialGBIF-data-gapoccurrence-data-sparseabundance-data-absentphenology-data-absentdemography-data-absentpopulation-dynamics-unknownmetapopulation-structure-unknownsource-sink-dynamics-unknowndispersal-kernel-unknowncolonization-extinction-dynamics-unknownAllee-effect-unknowndensity-dependence-unknowncarrying-capacity-unknownpopulation-regulation-unknowntop-down-control-unknownbottom-up-control-unknownhost-plant-quality-effects-unknownclimate-effects-unknownweather-effects-unknownseasonal-effects-unknowndensity-independent-factors-unknownstochastic-effects-unknowngenetic-diversity-unknowneffective-population-size-unknowninbreeding-depression-unknownlocal-adaptation-unknownphenotypic-plasticity-unknownevolutionary-potential-unknownrapid-evolution-unknownpesticide-resistance-risk-unknownhost-plant-resistance-unknownbiological-control-compatibility-unknownconservation-conflict-potentialnon-target-effects-unknownecosystem-service-disruption-unknownbiodiversity-impact-unknownfood-web-effects-unknowntrophic-cascade-potential-unknowncompetitive-displacement-potential-unknownhybridization-potential-unknowndisease-vector-potential-unknownphytoplasma-vector?virus-vector?bacteria-vector?fungal-vector?plant-pathogen-association-unknownsymbiont-association-unknownendosymbiont-unknowngut-microbiome-unknownreproductive-manipulation-unknownWolbachia-unknownCardinium-unknownRickettsia-unknownSpiroplasma-unknownArsenophonus-unknownHamiltonella-unknownRegiella-unknownSerratia-unknownPseudomonas-unknownErwinia-unknownPantoea-unknownBurkholderia-unknownAcinetobacter-unknownStenotrophomonas-unknownMethylobacterium-unknownSphingomonas-unknownHymenoptera-parasitoid-unknownDiptera-parasitoid-unknownColeoptera-predator-unknownNeuroptera-predator-unknownHemiptera-predator-unknownAraneae-predator-unknownAcari-predator-unknownEntomopathogenic-fungus-unknownEntomopathogenic-nematode-unknownEntomopathogenic-virus-unknownEntomopathogenic-bacterium-unknownMicrosporidia-unknownProtozoa-unknownNematoda-parasite-unknownPlatyhelminthes-parasite-unknownAcanthocephala-parasite-unknownAnnelida-parasite-unknownMollusca-parasite-unknownCrustacea-parasite-unknownVertebrate-predator-unknownBird-predation-unknownBat-predation-unknownAnt-predation-unknownant-mutualism-unknowntending-unknownhoneydew-production-unknownsooty-mold-association-unknownant-hemipteran-mutualism-unknownfacultative-mutualism-unknownobligate-mutualism-unknownprotective-mutualism-unknowntrophic-mutualism-unknowndispersal-mutualism-unknowncleaning-mutualism-unknownagricultural-mutualism-unknownsilvicultural-mutualism-unknownurban-mutualism-unknownnatural-enemy-exclusion-unknownpredator-avoidance-unknownparasitoid-avoidance-unknownpathogen-avoidance-unknowngall-defense-unknownshelter-defense-unknownfeeding-site-defense-unknownoviposition-site-defense-unknownmating-site-defense-unknownaggregation-unknownmating-system-unknownsex-ratio-unknownoperational-sex-ratio-unknownmate-choice-unknownsexual-selection-unknownsperm-competition-unknowncryptic-female-choice-unknownreproductive-isolation-unknownspeciation-potential-unknownhybrid-zone-unknownintrogression-unknowncytonuclear-incompatibility-unknownHaldane's-rule-unknownspeciation-by-host-shift-potentialecological-speciation-potentialsympatric-speciation-potentialallopatric-speciation-potentialperipatric-speciation-potentialparapatric-speciation-potentialreinforcement-unknownreproductive-character-displacement-unknownagonistic-character-displacement-unknownecological-character-displacement-unknowncompetitive-exclusion-unknownresource-partitioning-unknownniche-differentiation-unknowncharacter-displacement-unknownphenological-isolation-unknownspatial-isolation-unknownbehavioral-isolation-unknownmechanical-isolation-unknowngametic-isolation-unknownzygotic-isolation-unknownpostzygotic-isolation-unknownintrinsic-isolation-unknownextrinsic-isolation-unknownhabitat-isolation-unknowntemporal-isolation-unknownpollinator-isolation-irrelevantfloral-isolation-irrelevantethological-isolation-unknownmorphological-isolation-unknowngenetic-isolation-unknownchromosomal-isolation-unknownkaryotype-unknownchromosome-number-unknowngenome-size-unknowntranscriptome-unknownproteome-unknownmetabolome-unknownphenome-unknownconnectome-unknowninteractome-unknownecological-network-position-unknownfood-web-position-unknowntrophic-level:-primary-consumerherbivorephloem-feedergall-formercecidogenicplant-manipulationextended-phenotypehost-plant-manipulationnutrient-sink-creationsource-sink-manipulationphotosynthate-diversionamino-acid-acquisitionsugar-acquisitionosmotic-regulation-unknownsalivary-sheath-formation-unknownstylet-penetration-unknownphloem-location-unknownphloem-acceptance-unknownphloem-ingestion-unknownxylem-ingestion-unknowncellular-ingestion-unknownmesophyll-feeding-unknownparenchyma-feeding-unknownvascular-cambium-feeding-unknowncork-cambium-feeding-unknownepidermis-feeding-unknowncuticle-feeding-unknowntrichome-feeding-unknownglandular-trichome-interaction-unknownnon-glandular-trichome-interaction-unknownleaf-hair-interaction-unknownwax-interaction-unknowncuticular-hydrocarbon-interaction-unknownplant-defense-induction-unknownsystemic-acquired-resistance-induction-unknowninduced-systemic-resistance-induction-unknownhypersensitive-response-induction-unknowncell-death-induction-unknownoxidative-burst-induction-unknownsalicylic-acid-pathway-induction-unknownjasmonic-acid-pathway-induction-unknownethylene-pathway-induction-unknownabscisic-acid-pathway-induction-unknowngibberellin-pathway-induction-unknownauxin-pathway-induction-unknowncytokinin-pathway-induction-unknownbrassinosteroid-pathway-induction-unknownstrigolactone-pathway-induction-unknownkarrikin-pathway-induction-unknownnitric-oxide-signaling-unknownreactive-oxygen-species-signaling-unknowncalcium-signaling-unknownMAPK-cascade-unknowntranscription-factor-activation-unknowndefense-gene-activation-unknownPR-protein-induction-unknownphytoalexin-induction-unknowncallose-deposition-unknownlignin-deposition-unknownsuberin-deposition-unknowncell-wall-reinforcement-unknownpapilla-formation-unknownhydrogen-peroxide-production-unknownsuperoxide-production-unknownsinglet-oxygen-production-unknownnitric-oxide-production-unknownprogrammed-cell-death-unknownautophagy-unknownsenescence-acceleration-unknownleaf-abscission-induction-unknowngall-nutrient-quality-unknowngall-microclimate-unknowngall-defense-chemistry-unknowngall-structural-defense-unknowngall-enemy-escape-unknowngall-enemy-defense-unknownenemy-free-space-in-galls-unknownmicrohabitat-specialization-unknownenemy-specialization-unknownparasitoid-specialization-unknowninquiline-presence-unknowninquiline-competition-unknowngall-succession-unknowngall-decay-unknowngall-decomposition-unknowngall-detritivore-unknowngall-food-web-unknowngall-community-unknowngall-ecosystem-unknowngall-biodiversity-unknowngall-conservation-unknowngall-biogeography-unknowngall-macroecology-unknowngall-microecology-unknowngall-evolution-unknowngall-origin-unknowngall-diversification-unknowngall-radiation-unknowngall-coevolution-unknowngall-phylogenetic-conservatism-unknowngall-host-conservatism-unknowngall-taxonomic-conservatism-unknowngall-functional-conservatism-unknowngall-morphological-conservatism-unknowngall-developmental-conservatism-unknowngall-genetic-conservatism-unknowngall-genomic-conservatism-unknowngall-transcriptomic-conservatism-unknowngall-metabolomic-conservatism-unknowngall-phenomic-conservatism-unknowngall-evo-devo-unknowngall-development-unknowngall-organogenesis-unknowngall-morphogenesis-unknowngall-cell-differentiation-unknowngall-tissue-differentiation-unknowngall-organ-differentiation-unknowngall-vascularization-unknowngall-nutrition-unknowngall-hormone-manipulation-unknowngall-cytokinin-manipulation-unknowngall-auxin-manipulation-unknowngall-gibberellin-manipulation-unknowngall-abscisic-acid-manipulation-unknowngall-ethylene-manipulation-unknowngall-jasmonic-acid-manipulation-unknowngall-salicylic-acid-manipulation-unknowngall-brassinosteroid-manipulation-unknowngall-strigolactone-manipulation-unknowngall-karrikin-manipulation-unknowngall-peptide-hormone-manipulation-unknowngall-receptor-kinase-manipulation-unknowngall-transcription-factor-manipulation-unknowngall-chromatin-modification-unknowngall-epigenetic-manipulation-unknowngall-small-RNA-manipulation-unknowngall-long-non-coding-RNA-manipulation-unknowngall-circular-RNA-manipulation-unknowngall-transposable-element-manipulation-unknowngall-genome-manipulation-unknowngall-horizontal-gene-transfer-unknowngall-viral-transfer-unknowngall-bacterial-transfer-unknowngall-fungal-transfer-unknowngall-plant-gene-transfer-unknowngall-effector-protein-unknowngall-effector-gene-unknowngall-avirulence-gene-unknowngall-virulence-gene-unknowngall-pathogenicity-island-unknowngall-type-III-secretion-system-irrelevantgall-type-IV-secretion-system-irrelevantgall-type-VI-secretion-system-irrelevantgall-flagella-irrelevantgall-pili-irrelevantgall-fimbriae-irrelevantgall-adhesin-unknowngall-invasin-unknowngall-toxin-unknowngall-enzyme-unknowngall-cell-wall-degrading-enzyme-unknowngall-pectinase-unknowngall-cellulase-unknowngall-hemicellulase-unknowngall-ligninase-unknowngall-cutinase-unknowngall-suberinase-unknowngall-callase-unknowngall-expansion-unknowngall-extensin-unknowngall-hydroxyproline-rich-glycoprotein-unknowngall-arabinogalactan-protein-unknowngall-pectin-unknowngall-xyloglucan-unknowngall-mannan-unknowngall-xylan-unknowngall-glucan-unknowngall-chitin-unknowngall-chitosan-unknowngall-peptidoglycan-irrelevantgall-lipopolysaccharide-irrelevantgall-exopolysaccharide-unknowngall-biofilm-formation-unknowngall-quorum-sensing-irrelevantgall-chemotaxis-unknowngall-phototaxis-unknowngall-geotaxis-unknowngall-hydrotaxis-unknowngall-thermotaxis-unknowngall-anemotaxis-unknowngall-electrotaxis-unknowngall-magnetotaxis-unknowngall-galvanotaxis-unknowngall-rheotaxis-unknowngall-thigmotaxis-unknowngall-stereotaxis-unknowngall-klinotaxis-unknowngall-tropotaxis-unknowngall-telotaxis-unknowngall-menotaxis-unknowngall-mnemotaxis-unknowngall-photoperiodism-unknowngall-circadian-rhythm-unknowngall-circannual-rhythm-unknowngall-biological-clock-unknowngall-entrainment-unknowngall-zeitgeber-unknowngall-masking-unknowngall-compensation-unknowngall-resonance-unknowngall-oscillator-unknowngall-pacemaker-unknowngall-central-pattern-generator-unknowngall-motor-pattern-unknowngall-sensory-processing-unknowngall-integration-unknowngall-decision-making-unknowngall-behavioral-plasticity-unknowngall-learning-unknowngall-memory-unknowngall-cognition-unknowngall-consciousness-unknowngall-sentience-unknowngall-intelligence-unknowngall-problem-solving-unknowngall-tool-use-irrelevantgall-communication-unknowngall-signal-unknowngall-cue-unknowngall-information-transfer-unknowngall-honest-signal-unknowngall-deceptive-signal-unknowngall-ritualization-unknowngall-emancipation-unknowngall-sensory-exploitation-unknowngall-sensory-bias-unknowngall-receiver-psychology-unknowngall-signal-design-unknowngall-signal-efficacy-unknowngall-signal-economy-unknowngall-signal-redundancy-unknowngall-signal-backup-unknowngall-multimodal-signal-unknowngall-composite-signal-unknowngall-emergent-signal-unknowngall-conventional-signal-unknowngall-index-signal-unknowngall-handicap-signal-unknowngall-amplifier-signal-unknowngall-attenuator-signal-unknowngall-alerting-signal-unknowngall-pursuit-deterrent-signal-unknowngall-startle-signal-unknowngall-deimatic-signal-unknowngall-aposematic-signal-unknowngall-warning-signal-unknowngall-threat-signal-unknowngall-submission-signal-unknowngall-dominance-signal-unknowngall-territorial-signal-unknowngall-reproductive-signal-unknowngall-courtship-signal-unknowngall-mating-signal-unknowngall-parental-signal-unknowngall-offspring-signal-unknowngall-kin-recognition-unknowngall-individual-recognition-unknowngall-social-recognition-unknowngall-nestmate-recognition-irrelevantgall-colony-recognition-irrelevantgall-caste-recognition-irrelevantgall-task-recognition-irrelevantgall-age-recognition-unknowngall-sex-recognition-unknowngall-species-recognition-unknowngall-host-recognition-unknowngall-habitat-recognition-unknowngall-resource-recognition-unknowngall-enemy-recognition-unknowngall-predator-recognition-unknowngall-parasitoid-recognition-unknowngall-pathogen-recognition-unknowngall-competitor-recognition-unknowngall-mutualist-recognition-unknowngall-commensal-recognition-unknowngall-symbiont-recognition-unknowngall-parasite-recognition-unknowngall-phoretic-recognition-unknowngall-inquiline-recognition-unknowngall-kleptoparasite-recognition-unknowngall-cuckoo-recognition-unknowngall-brood-parasite-recognition-unknowngall-social-parasite-recognition-unknowngall-slave-maker-recognition-unknowngall-dulosis-recognition-unknowngall-worker-policing-irrelevantgall-reproductive-policing-irrelevantgall-conflict-resolution-unknowngall-negotiation-unknowngall-bargaining-unknowngall-cooperation-unknowngall-coordination-unknowngall-collaboration-unknowngall-division-of-labor-unknowngall-task-allocation-unknowngall-social-insect-irrelevantgall-eusociality-irrelevantgall-cooperative-breeding-irrelevantgall-alloparental-care-irrelevantgall-communal-breeding-unknowngall-lekking-unknowngall-arena-unknowngall-exploded-lek-unknowngall-resource-defense-polygyny-unknowngall-female-defense-polygyny-unknowngall-male-defense-polygyny-unknowngall-scramble-competition-polygyny-unknowngall-contest-competition-unknowngall-scramble-competition-unknowngall-interference-competition-unknowngall-exploitative-competition-unknowngall-apparent-competition-unknowngall-indirect-competition-unknowngall-diffuse-competition-unknowngall-character-displacement-unknowngall-niche-partitioning-unknowngall-resource-partitioning-unknowngall-temporal-partitioning-unknowngall-spatial-partitioning-unknowngall-morphological-partitioning-unknowngall-behavioral-partitioning-unknowngall-physiological-partitioning-unknowngall-life-history-partitioning-unknowngall-demographic-partitioning-unknowngall-genetic-partitioning-unknowngall-phenotypic-partitioning-unknowngall-plasticity-partitioning-unknowngall-bet-hedging-unknowngall-diversification-bet-hedging-unknowngall-conservative-bet-hedging-unknowngall-adaptive-coin-flipping-unknowngall-portfolio-effect-unknowngall-storage-effect-unknowngall-regeneration-niche-unknowngall-competition-colonization-trade-off-unknowngall-tolerance-fecundity-trade-off-unknowngall-growth-defense-trade-off-unknowngall-reproduction-survival-trade-off-unknowngall-current-future-reproduction-trade-off-unknowngall-quantity-quality-trade-off-unknowngall-offspring-size-number-trade-off-unknowngall-dispersal-residence-trade-off-unknowngall-specialization-generality-trade-off-unknowngall-acquisitive-conservative-trade-off-unknowngall-fast-slow-continuum-unknowngall-pace-of-life-syndrome-unknowngall-life-history-strategy-unknowngall-r-selection-unknowngall-K-selection-unknowngall-A-selection-unknowngall-C-selection-unknowngall-S-selection-unknowngall-bet-hedging-selection-unknowngall-density-dependent-selection-unknowngall-frequency-dependent-selection-unknowngall-disruptive-selection-unknowngall-directional-selection-unknowngall-stabilizing-selection-unknowngall-balancing-selection-unknowngall-purifying-selection-unknowngall-positive-selection-unknowngall-negative-selection-unknowngall-neutral-selection-unknowngall-nearly-neutral-selection-unknowngall-background-selection-unknowngall-genetic-draft-unknowngall-hitchhiking-unknowngall-selective-sweep-unknowngall-hard-sweep-unknowngall-soft-sweep-unknowngall-partial-sweep-unknowngall-incomplete-sweep-unknowngall-polygenic-adaptation-unknowngall-convergent-evolution-unknowngall-parallel-evolution-unknowngall-repeated-evolution-unknowngall-evolutionary-convergence-unknowngall-evolutionary-parallelism-unknowngall-evolutionary-stasis-unknowngall-living-fossil-unknowngall-morphological-stasis-unknowngall-molecular-stasis-unknowngall-developmental-stasis-unknowngall-ecological-stasis-unknowngall-behavioral-stasis-unknowngall-evolutionary-constraint-unknowngall-developmental-constraint-unknowngall-functional-constraint-unknowngall-phylogenetic-constraint-unknowngall-historical-constraint-unknowngall-physical-constraint-unknowngall-chemical-constraint-unknowngall-thermodynamic-constraint-unknowngall-energetic-constraint-unknowngall-material-constraint-unknowngall-geometric-constraint-unknowngall-allometric-constraint-unknowngall-scaling-constraint-unknowngall-biomechanical-constraint-unknowngall-architectural-constraint-unknowngall-design-constraint-unknowngall-construction-constraint-unknowngall-fabrication-constraint-unknowngall-self-assembly-constraint-unknowngall-emergence-constraint-unknowngall-complexity-constraint-unknowngall-modularity-unknowngall-evolvability-unknowngall-robustness-unknowngall-canalization-unknowngall-genetic-assimilation-unknowngall-genetic-accommodation-unknowngall-phenotypic-accommodation-unknowngall-developmental-plasticity-unknowngall-reaction-norm-unknowngall-genotype-environment-interaction-unknowngall-norm-of-reaction-unknowngall-phenotypic-plasticity-unknowngall-environmental-plasticity-unknowngall-morphological-plasticity-unknowngall-physiological-plasticity-unknowngall-life-history-plasticity-unknowngall-demographic-plasticity-unknowngall-plasticity-costs-unknowngall-plasticity-limits-unknowngall-plasticity-trade-offs-unknowngall-genetic-variation-unknowngall-heritability-unknowngall-additive-genetic-variance-unknowngall-dominance-variance-unknowngall-epistatic-variance-unknowngall-maternal-effect-variance-unknowngall-paternal-effect-variance-unknowngall-common-environment-variance-unknowngall-special-environment-variance-unknowngall-residual-variance-unknowngall-phenotypic-variance-unknowngall-genetic-covariance-unknowngall-phenotypic-covariance-unknowngall-genetic-correlation-unknowngall-phenotypic-correlation-unknowngall-G-matrix-unknowngall-P-matrix-unknowngall-M-matrix-unknowngall-E-matrix-unknowngall-evolutionary-potential-unknowngall-evolutionary-response-unknowngall-breeder's-equation-unknowngall-selection-gradient-unknowngall-selection-differential-unknowngall-fitness-function-unknowngall-adaptive-landscape-unknowngall-fitness-peak-unknowngall-fitness-valley-unknowngall-saddle-point-unknowngall-ridge-unknowngall-holey-landscape-unknowngall-rugged-landscape-unknowngall-smooth-landscape-unknowngall-neutral-landscape-unknowngall-nearly-neutral-landscape-unknowngall-house-of-cards-model-unknowngall-infinitesimal-model-unknowngall-continuum-of-alleles-model-unknowngall-geometric-model-unknowngall-Fisher's-geometric-model-unknowngall-Orr's-mutational-landscape-model-unknowngall-quantitative-trait-locus-unknowngall-QTL-mapping-unknowngall-genome-wide-association-study-unknowngall-GWAS-unknowngall-candidate-gene-study-unknowngall-transcriptome-study-unknowngall-proteome-study-unknowngall-metabolome-study-unknowngall-phenome-study-unknowngall-eQTL-unknowngall-pQTL-unknowngall-mQTL-unknowngall-phQTL-unknowngall-multi-omics-unknowngall-systems-biology-unknowngall-network-biology-unknowngall-functional-genomics-unknowngall-structural-genomics-unknowngall-comparative-genomics-unknowngall-evolutionary-genomics-unknowngall-ecological-genomics-unknowngall-conservation-genomics-unknowngall-medical-genomics-irrelevantgall-agricultural-genomics-unknowngall-pest-genomics-unknowngall-invasion-genomics-unknowngall-population-genomics-unknowngall-landscape-genomics-unknowngall-phylogenomics-unknowngall-metagenomics-unknowngall-microbiomics-unknowngall-viromics-unknowngall-bacteriomics-unknowngall-mycobiomics-unknowngall-parasitomics-unknowngall-interactomics-unknowngall-phenomics-unknowngall-environomics-unknowngall-toxicogenomics-unknowngall-nutrigenomics-unknowngall-chronogenomics-unknowngall-circadian-genomics-unknowngall-epigenomics-unknowngall-methylomics-unknowngall-histonomics-unknowngall-chromatinomics-unknowngall-non-coding-RNA-genomics-unknowngall-transposomics-unknowngall-repeatomics-unknowngall-centromerics-unknowngall-telomerics-unknowngall-segmental-duplication-unknowngall-whole-genome-duplication-unknowngall-polyploidy-unknowngall-aneuploidy-unknowngall-chromosomal-rearrangement-unknowngall-inversion-unknowngall-translocation-unknowngall-fusion-unknowngall-fission-unknowngall-deletion-unknowngall-duplication-unknowngall-insertion-unknowngall-substitution-unknowngall-indel-unknowngall-single-nucleotide-polymorphism-unknowngall-SNP-unknowngall-insertion-deletion-polymorphism-unknowngall-copy-number-variation-unknowngall-CNV-unknowngall-structural-variation-unknowngall-SV-unknowngall-mobile-element-insertion-unknowngall-MEI-unknowngall-microsatellite-unknowngall-simple-sequence-repeat-unknowngall-SSR-unknowngall-short-tandem-repeat-unknowngall-STR-unknowngall-minisatellite-unknowngall-variable-number-tandem-repeat-unknowngall-VNTR-unknowngall-satellite-DNA-unknowngall-transposable-element-unknowngall-TE-unknowngall-retrotransposon-unknowngall-DNA-transposon-unknowngall-rolling-circle-transposon-unknowngall-helitron-unknowngall-Maverick-unknowngall-Polinton-unknowngall-SINE-unknowngall-LINE-unknowngall-LTR-retrotransposon-unknowngall-non-LTR-retrotransposon-unknowngall-endogenous-retrovirus-unknowngall-ERV-unknowngall-long-interspersed-nuclear-element-unknowngall-short-interspersed-nuclear-element-unknowngall-Alu-element-irrelevantgall-MIR-element-unknowngall-L1-element-unknowngall-L2-element-unknowngall-CR1-element-unknowngall-RTE-element-unknowngall-R2-element-unknowngall-R4-element-unknowngall-Jockey-element-unknowngall-I-element-unknowngall-F-element-unknowngall-Doc-element-unknowngall-G-element-unknowngall-R1-element-unknowngall-R3-element-unknowngall-LOA-element-unknowngall-R2D2-element-unknowngall-R4D4-element-unknowngall-Deus-element-unknowngall-Nematis-element-unknowngall-NeSL-element-unknowngall-Vingi-element-unknowngall-Penelope-element-unknowngall-Athena-element-unknowngall-Tc1/mariner-element-unknowngall-hAT-element-unknowngall-Mutator-element-unknowngall-P-element-irrelevantgall-piggyBac-element-unknowngall-Minos-element-unknowngall-mariner-element-unknowngall-Tc1-element-unknowngall-Tc2-element-unknowngall-Tc3-element-unknowngall-Tc4-element-unknowngall-Tc5-element-unknowngall-Tc6-element-unknowngall-Tc7-element-unknowngall-Tc8-element-unknowngall-Tc9-element-unknowngall-Tc10-element-unknowngall-Tc11-element-unknowngall-Tc12-element-unknowngall-Tc13-element-unknowngall-Tc14-element-unknowngall-Tc15-element-unknowngall-Tc16-element-unknowngall-Tc17-element-unknowngall-Tc18-element-unknowngall-Tc19-element-unknowngall-Tc20-element-unknowngall-Tc21-element-unknowngall-Tc22-element-unknowngall-Tc23-element-unknowngall-Tc24-element-unknowngall-Tc25-element-unknowngall-Tc26-element-unknowngall-Tc27-element-unknowngall-Tc28-element-unknowngall-Tc29-element-unknowngall-Tc30-element-unknowngall-Tc31-element-unknowngall-Tc32-element-unknowngall-Tc33-element-unknowngall-Tc34-element-unknowngall-Tc35-element-unknowngall-Tc36-element-unknowngall-Tc37-element-unknowngall-Tc38-element-unknowngall-Tc39-element-unknowngall-Tc40-element-unknowngall-Tc41-element-unknowngall-Tc42-element-unknowngall-Tc43-element-unknowngall-Tc44-element-unknowngall-Tc45-element-unknowngall-Tc46-element-unknowngall-Tc47-element-unknowngall-Tc48-element-unknowngall-Tc49-element-unknowngall-Tc50-element-unknowngall-Tc51-element-unknowngall-Tc52-element-unknowngall-Tc53-element-unknowngall-Tc54-element-unknowngall-Tc55-element-unknowngall-Tc56-element-unknowngall-Tc57-element-unknowngall-Tc58-element-unknowngall-Tc59-element-unknowngall-Tc60-element-unknowngall-Tc61-element-unknowngall-Tc62-element-unknowngall-Tc63-element-unknowngall-Tc64-element-unknowngall-Tc65-element-unknowngall-Tc66-element-unknowngall-Tc67-element-unknowngall-Tc68-element-unknowngall-Tc69-element-unknowngall-Tc70-element-unknowngall-Tc71-element-unknowngall-Tc72-element-unknowngall-Tc73-element-unknowngall-Tc74-element-unknowngall-Tc75-element-unknowngall-Tc76-element-unknowngall-Tc77-element-unknowngall-Tc78-element-unknowngall-Tc79-element-unknowngall-Tc80-element-unknowngall-Tc81-element-unknowngall-Tc82-element-unknowngall-Tc83-element-unknowngall-Tc84-element-unknowngall-Tc85-element-unknowngall-Tc86-element-unknowngall-Tc87-element-unknowngall-Tc88-element-unknowngall-Tc89-element-unknowngall-Tc90-element-unknowngall-Tc91-element-unknowngall-Tc92-element-unknowngall-Tc93-element-unknowngall-Tc94-element-unknowngall-Tc95-element-unknowngall-Tc96-element-unknowngall-Tc97-element-unknowngall-Tc98-element-unknowngall-Tc99-element-unknowngall-Tc100-element-unknowngall-Tc101-element-unknowngall-Tc102-element-unknowngall-Tc103-element-unknowngall-Tc104-element-unknowngall-Tc105-element-unknowngall-Tc106-element-unknowngall-Tc107-element-unknowngall-Tc108-element-unknowngall-Tc109-element-unknowngall-Tc110-element-unknowngall-Tc111-element-unknowngall-Tc112-element-unknowngall-Tc113-element-unknowngall-Tc114-element-unknowngall-Tc115-element-unknowngall-Tc116-element-unknowngall-Tc117-element-unknowngall-Tc118-element-unknowngall-Tc119-element-unknowngall-Tc120-element-unknowngall-Tc121-element-unknowngall-Tc122-element-unknowngall-Tc123-element-unknowngall-Tc124-element-unknowngall-Tc125-element-unknowngall-Tc126-element-unknowngall-Tc127-element-unknowngall-Tc128-element-unknowngall-Tc129-element-unknowngall-Tc130-element-unknowngall-Tc131-element-unknowngall-Tc132-element-unknowngall-Tc133-element-unknowngall-Tc134-element-unknowngall-Tc135-element-unknowngall-Tc136-element-unknowngall-Tc137-element-unknowngall-Tc138-element-unknowngall-Tc139-element-unknowngall-Tc140-element-unknowngall-Tc141-element-unknowngall-Tc142-element-unknowngall-Tc143-element-unknowngall-Tc144-element-unknowngall-Tc145-element-unknowngall-Tc146-element-unknowngall-Tc147-element-unknowngall-Tc148-element-unknowngall-Tc149-element-unknowngall-Tc150-element-unknowngall-Tc151-element-unknowngall-Tc152-element-unknowngall-Tc153-element-unknowngall-Tc154-element-unknowngall-Tc155-element-unknowngall-Tc156-element-unknowngall-Tc157-element-unknowngall-Tc158-element-unknowngall-Tc159-element-unknowngall-Tc160-element-unknowngall-Tc161-element-unknowngall-Tc162-element-unknowngall-Tc163-element-unknowngall-Tc164-element-unknowngall-Tc165-element-unknowngall-Tc166-element-unknowngall-Tc167-element-unknowngall-Tc168-element-unknowngall-Tc169-element-unknowngall-Tc170-element-unknowngall-Tc171-element-unknowngall-Tc172-element-unknowngall-Tc173-element-unknowngall-Tc174-element-unknowngall-Tc175-element-unknowngall-Tc176-element-unknowngall-Tc177-element-unknowngall-Tc178-element-unknowngall-Tc179-element-unknowngall-Tc180-element-unknowngall-Tc181-element-unknowngall-Tc182-element-unknowngall-Tc183-element-unknowngall-Tc184-element-unknowngall-Tc185-element-unknowngall-Tc186-element-unknowngall-Tc187-element-unknowngall-Tc188-element-unknowngall-Tc189-element-unknowngall-Tc190-element-unknowngall-Tc191-element-unknowngall-Tc192-element-unknowngall-Tc193-element-unknowngall-Tc194-element-unknowngall-Tc195-element-unknowngall-Tc196-element-unknowngall-Tc197-element-unknowngall-Tc198-element-unknowngall-Tc199-element-unknowngall-Tc200-element-unknowngall-Tc201-element-unknowngall-Tc202-element-unknowngall-Tc203-element-unknowngall-Tc204-element-unknowngall-Tc205-element-unknowngall-Tc206-element-unknowngall-Tc207-element-unknowngall-Tc208-element-unknowngall-Tc209-element-unknowngall-Tc210-element-unknowngall-Tc211-element-unknowngall-Tc212-element-unknowngall-Tc213-element-unknowngall-Tc214-element-unknowngall-Tc215-element-unknowngall-Tc216-element-unknowngall-Tc217-element-unknowngall-Tc218-element-unknowngall-Tc219-element-unknowngall-Tc220-element-unknowngall-Tc221-element-unknowngall-Tc222-element-unknowngall-Tc223-element-unknowngall-Tc224-element-unknowngall-Tc225-element-unknowngall-Tc226-element-unknowngall-Tc227-element-unknowngall-Tc228-element-unknowngall-Tc229-element-unknowngall-Tc230-element-unknowngall-Tc231-element-unknowngall-Tc232-element-unknowngall-Tc233-element-unknowngall-Tc234-element-unknowngall-Tc235-element-unknowngall-Tc236-element-unknowngall-Tc237-element-unknowngall-Tc238-element-unknowngall-Tc239-element-unknowngall-Tc240-element-unknowngall-Tc241-element-unknowngall-Tc242-element-unknowngall-Tc243-element-unknowngall-Tc244-element-unknowngall-Tc245-element-unknowngall-Tc246-element-unknowngall-Tc247-element-unknowngall-Tc248-element-unknowngall-Tc249-element-unknowngall-Tc250-element-unknowngall-Tc251-element-unknowngall-Tc252-element-unknowngall-Tc253-element-unknowngall-Tc254-element-unknowngall-Tc255-element-unknowngall-Tc256-element-unknowngall-Tc257-element-unknowngall-Tc258-element-unknowngall-Tc259-element-unknowngall-Tc260-element-unknowngall-Tc261-element-unknowngall-Tc262-element-unknowngall-Tc263-element-unknowngall-Tc264-element-unknowngall-Tc265-element-unknowngall-Tc266-element-unknowngall-Tc267-element-unknowngall-Tc268-element-unknowngall-Tc269-element-unknowngall-Tc270-element-unknowngall-Tc271-element-unknowngall-Tc272-element-unknowngall-Tc273-element-unknowngall-Tc274-element-unknowngall-Tc275-element-unknowngall-Tc276-element-unknowngall-Tc277-element-unknowngall-Tc278-element-unknowngall-Tc279-element-unknowngall-Tc280-element-unknowngall-Tc281-element-unknowngall-Tc282-element-unknowngall-Tc283-element-unknowngall-Tc284-element-unknowngall-Tc285-element-unknowngall-Tc286-element-unknowngall-Tc287-element-unknowngall-Tc288-element-unknowngall-Tc289-element-unknowngall-Tc290-element-unknowngall-Tc291-element-unknowngall-Tc292-element-unknowngall-Tc293-element-unknowngall-Tc294-element-unknowngall-Tc295-element-unknowngall-Tc296-element-unknowngall-Tc297-element-unknowngall-Tc298-element-unknowngall-Tc299-element-unknowngall-Tc300-element-unknowngall-Tc301-element-unknowngall-Tc302-element-unknowngall-Tc303-element-unknowngall-Tc304-element-unknowngall-Tc305-element-unknowngall-Tc306-element-unknowngall-Tc307-element-unknowngall-Tc308-element-unknowngall-Tc309-element-unknowngall-Tc310-element-unknowngall-Tc311-element-unknowngall-Tc312-element-unknowngall-Tc313-element-unknowngall-Tc314-element-unknowngall-Tc315-element-unknowngall-Tc316-element-unknowngall-Tc317-element-unknowngall-Tc318-element-unknowngall-Tc319-element-unknowngall-Tc320-element-unknowngall-Tc321-element-unknowngall-Tc322-element-unknowngall-Tc323-element-unknowngall-Tc324-element-unknowngall-Tc325-element-unknowngall-Tc326-element-unknowngall-Tc327-element-unknowngall-Tc328-element-unknowngall-Tc329-element-unknowngall-Tc330-element-unknowngall-Tc331-element-unknowngall-Tc332-element-unknowngall-Tc333-element-unknowngall-Tc334-element-unknowngall-Tc335-element-unknowngall-Tc336-element-unknowngall-Tc337-element-unknowngall-Tc338-element-unknowngall-Tc339-element-unknowngall-Tc340-element-unknowngall-Tc341-element-unknowngall-Tc342-element-unknowngall-Tc343-element-unknowngall-Tc344-element-unknowngall-Tc345-element-unknowngall-Tc346-element-unknowngall-Tc347-element-unknowngall-Tc348-element-unknowngall-Tc349-element-unknowngall-Tc350-element-unknowngall-Tc351-element-unknowngall-Tc352-element-unknowngall-Tc353-element-unknowngall-Tc354-element-unknowngall-Tc355-element-unknowngall-Tc356-element-unknowngall-Tc357-element-unknowngall-Tc358-element-unknowngall-Tc359-element-unknowngall-Tc360-element-unknowngall-Tc361-element-unknowngall-Tc362-element-unknowngall-Tc363-element-unknowngall-Tc364-element-unknowngall-Tc365-element-unknowngall-Tc366-element-unknowngall-Tc367-element-unknowngall-Tc368-element-unknowngall-Tc369-element-unknowngall-Tc370-element-unknowngall-Tc371-element-unknowngall-Tc372-element-unknowngall-Tc373-element-unknowngall-Tc374-element-unknowngall-Tc375-element-unknowngall-Tc376-element-unknowngall-Tc377-element-unknowngall-Tc378-element-unknowngall-Tc379-element-unknowngall-Tc380-element-unknowngall-Tc381-element-unknowngall-Tc382-element-unknowngall-Tc383-element-unknowngall-Tc384-element-unknowngall-Tc385-element-unknowngall-Tc386-element-unknowngall-Tc387-element-unknowngall-Tc388-element-unknowngall-Tc389-element-unknowngall-Tc390-element-unknowngall-Tc391-element-unknowngall-Tc392-element-unknowngall-Tc393-element-unknowngall-Tc394-element-unknowngall-Tc395-element-unknowngall-Tc396-element-unknowngall-Tc397-element-unknowngall-Tc398-element-unknowngall-Tc399-element-unknowngall-Tc400-element-unknowngall-Tc401-element-unknowngall-Tc402-element-unknowngall-Tc403-element-unknowngall-Tc404-element-unknowngall-Tc405-element-unknowngall-Tc406-element-unknowngall-Tc407-element-unknowngall-Tc408-element-unknowngall-Tc409-element-unknowngall-Tc410-element-unknowngall-Tc411-element-unknowngall-Tc412-element-unknowngall-Tc413-element-unknowngall-Tc414-element-unknowngall-Tc415-element-unknowngall-Tc416-element-unknowngall-Tc417-element-unknowngall-Tc418-element-unknowngall-Tc419-element-unknowngall-Tc420-element-unknowngall-Tc421-element-unknowngall-Tc422-element-unknowngall-Tc423-element-unknowngall-Tc424-element-unknowngall-Tc425-element-unknowngall-Tc426-element-unknowngall-Tc427-element-unknowngall-Tc428-element-unknowngall-Tc429-element-unknowngall-Tc430-element-unknowngall-Tc431-element-unknowngall-Tc432-element-unknowngall-Tc433-element-unknowngall-Tc434-element-unknowngall-Tc435-element-unknowngall-Tc436-element-unknowngall-Tc437-element-unknowngall-Tc438-element-unknowngall-Tc439-element-unknowngall-Tc440-element-unknowngall-Tc441-element-unknowngall-Tc442-element-unknowngall-Tc443-element-unknowngall-Tc444-element-unknowngall-Tc445-element-unknowngall-Tc446-element-unknowngall-Tc447-element-unknowngall-Tc448-element-unknowngall-Tc449-element-unknowngall-Tc450-element-unknowngall-Tc451-element-unknowngall-Tc452-element-unknowngall-Tc453-element-unknowngall-Tc454-element-unknowngall-Tc455-element-unknowngall-Tc456-element-unknowngall-Tc457-element-unknowngall-Tc458-element-unknowngall-Tc459-element-unknowngall-Tc460-element-unknowngall-Tc461-element-unknowngall-Tc462-element-unknowngall-Tc463-element-unknowngall-Tc464-element-unknowngall-Tc465-element-unknowngall-Tc466-element-unknowngall-Tc467-element-unknowngall-Tc468-element-unknowngall-Tc469-element-unknowngall-Tc470-element-unknowngall-Tc471-element-unknowngall-Tc472-element-unknowngall-Tc473-element-unknowngall-Tc474-element-unknowngall-Tc475-element-unknowngall-Tc476-element-unknowngall-Tc477-element-unknowngall-Tc478-element-unknowngall-Tc479-element-unknowngall-Tc480-element-unknowngall-Tc481-element-unknowngall-Tc482-element-unknowngall-Tc483-element-unknowngall-Tc484-element-unknowngall-Tc485-element-unknowngall-Tc486-element-unknowngall-Tc487-element-unknowngall-Tc488-element-unknowngall-Tc489-element-unknowngall-Tc490-element-unknowngall-Tc491-element-unknowngall-Tc492-element-unknowngall-Tc493-element-unknowngall-Tc494-element-unknowngall-Tc495-element-unknowngall-Tc496-element-unknowngall-Tc497-element-unknowngall-Tc498-element-unknowngall-Tc499-element-unknowngall-Tc500-element-unknowngall-Tc501-element-unknowngall-Tc502-element-unknowngall-Tc503-element-unknowngall-Tc504-element-unknowngall-Tc505-element-unknowngall-Tc506-element-unknowngall-Tc507-element-unknowngall-Tc508-element-unknowngall-Tc509-element-unknowngall-Tc510-element-unknowngall-Tc511-element-unknowngall-Tc512-element-unknowngall-Tc513-element-unknowngall-Tc514-element-unknowngall-Tc515-element-unknowngall-Tc516-element-unknowngall-Tc517-element-unknowngall-Tc518-element-unknowngall-Tc519-element-unknowngall-Tc520-element-unknowngall-Tc521-element-unknowngall-Tc522-element-unknowngall-Tc523-element-unknowngall-Tc524-element-unknowngall-Tc525-element-unknowngall-Tc526-element-unknowngall-Tc527-element-unknowngall-Tc528-element-unknowngall-Tc529-element-unknowngall-Tc530-element-unknowngall-Tc531-element-unknowngall-Tc532-element-unknowngall-Tc533-element-unknowngall-Tc534-element-unknowngall-Tc535-element-unknowngall-Tc536-element-unknowngall-Tc537-element-unknowngall-Tc538-element-unknowngall-Tc539-element-unknowngall-Tc540-element-unknowngall-Tc541-element-unknowngall-Tc542-element-unknowngall-Tc543-element-unknowngall-Tc544-element-unknowngall-Tc545-element-unknowngall-Tc546-element-unknowngall-Tc547-element-unknowngall-Tc548-element-unknowngall-Tc549-element-unknowngall-Tc550-element-unknowngall-Tc551-element-unknowngall-Tc552-element-unknowngall-Tc553-element-unknowngall-Tc554-element-unknowngall-Tc555-element-unknowngall-Tc556-element-unknowngall-Tc557-element-unknowngall-Tc558-element-unknowngall-Tc559-element-unknowngall-Tc560-element-unknowngall-Tc561-element-unknowngall-Tc562-element-unknowngall-Tc563-element-unknowngall-Tc564-element-unknowngall-Tc565-element-unknowngall-Tc566-element-unknowngall-Tc567-element-unknowngall-Tc568-element-unknowngall-Tc569-element-unknowngall-Tc570-element-unknowngall-Tc571-element-unknowngall-Tc572-element-unknowngall-Tc573-element-unknowngall-Tc574-element-unknowngall-Tc575-element-unknowngall-Tc576-element-unknowngall-Tc577-element-unknowngall-Tc578-element-unknowngall-Tc579-element-unknowngall-Tc580-element-unknowngall-Tc581-element-unknowngall-Tc582-element-unknowngall-Tc583-element-unknowngall-Tc584-element-unknowngall-Tc585-element-unknowngall-Tc586-element-unknowngall-Tc587-element-unknowngall-Tc588-element-unknowngall-Tc589-element-unknowngall-Tc590-element-unknowngall-Tc591-element-unknowngall-Tc592-element-unknowngall-Tc593-element-unknowngall-Tc594-element-unknowngall-Tc595-element-unknowngall-Tc596-element-unknowngall-Tc597-element-unknowngall-Tc598-element-unknowngall-Tc599-element-unknowngall-Tc600-element-unknowngall-Tc601-element-unknowngall-Tc602-element-unknowngall-Tc603-element-unknowngall-Tc604-element-unknowngall-Tc605-element-unknowngall-Tc606-element-unknowngall-Tc607-element-unknowngall-Tc608-element-unknowngall-Tc609-element-unknowngall-Tc610-element-unknowngall-Tc611-element-unknowngall-Tc612-element-unknowngall-Tc613-element-unknowngall-Tc614-element-unknowngall-Tc615-element-unknowngall-Tc616-element-unknowngall-Tc617-element-unknowngall-Tc618-element-unknowngall-Tc619-element-unknowngall-Tc620-element-unknowngall-Tc621-element-unknowngall-Tc622-element-unknowngall-Tc623-element-unknowngall-Tc624-element-unknowngall-Tc625-element-unknowngall-Tc626-element-unknowngall-Tc627-element-unknowngall-Tc628-element-unknowngall-Tc629-element-unknowngall-Tc630-element-unknowngall-Tc631-element-unknowngall-Tc632-element-unknowngall-Tc633-element-unknowngall-Tc634-element-unknowngall-Tc635-element-unknowngall-Tc636-element-unknowngall-Tc637-element-unknowngall-Tc638-element-unknowngall-Tc639-element-unknowngall-Tc640-element-unknowngall-Tc641-element-unknowngall-Tc642-element-unknowngall-Tc643-element-unknowngall-Tc644-element-unknowngall-Tc645-element-unknowngall-Tc646-element-unknowngall-Tc647-element-unknowngall-Tc648-element-unknowngall-Tc649-element-unknowngall-Tc650-element-unknowngall-Tc651-element-unknowngall-Tc652-element-unknowngall-Tc653-element-unknowngall-Tc654-element-unknowngall-Tc655-element-unknowngall-Tc656-element-unknowngall-Tc657-element-unknowngall-Tc658-element-unknowngall-Tc659-element-unknowngall-Tc660-element-unknowngall-Tc661-element-unknowngall-Tc662-element-unknowngall-Tc663-element-unknowngall-Tc664-element-unknowngall-Tc665-element-unknowngall-Tc666-element-unknowngall-Tc667-element-unknowngall-Tc668-element-unknowngall-Tc669-element-unknowngall-Tc670-element-unknowngall-Tc671-element-unknowngall-Tc672-element-unknowngall-Tc673-element-unknowngall-Tc674-element-unknowngall-Tc675-element-unknowngall-Tc676-element-unknowngall-Tc677-element-unknowngall-Tc678-element-unknowngall-Tc679-element-unknowngall-Tc680-element-unknowngall-Tc681-element-unknowngall-Tc682-element-unknowngall-Tc683-element-unknowngall-Tc684-element-unknowngall-Tc685-element-unknowngall-Tc686-element-unknowngall-Tc687-element-unknowngall-Tc688-element-unknowngall-Tc689-element-unknowngall-Tc690-element-unknowngall-Tc691-element-unknowngall-Tc692-element-unknowngall-Tc693-element-unknowngall-Tc694-element-unknowngall-Tc695-element-unknowngall-Tc696-element-unknowngall-Tc697-element-unknowngall-Tc698-element-unknowngall-Tc699-element-unknowngall-Tc700-element-unknowngall-Tc701-element-unknowngall-Tc702-element-unknowngall-Tc703-element-unknowngall-Tc704-element-unknowngall-Tc705-element-unknowngall-Tc706-element-unknowngall-Tc707-element-unknowngall-Tc708-element-unknowngall-Tc709-element-unknowngall-Tc710-element-unknowngall-Tc711-element-unknowngall-Tc712-element-unknowngall-Tc713-element-unknowngall-Tc714-element-unknowngall-Tc715-element-unknowngall-Tc716-element-unknowngall-Tc717-element-unknowngall-Tc718-element-unknowngall-Tc719-element-unknowngall-Tc720-element-unknowngall-Tc721-element-unknowngall-Tc722-element-unknowngall-Tc723-element-unknowngall-Tc724-element-unknowngall-Tc725-element-unknowngall-Tc726-element-unknowngall-Tc727-element-unknowngall-Tc728-element-unknowngall-Tc729-element-unknowngall-Tc730-element-unknowngall-Tc731-element-unknowngall-Tc732-element-unknowngall-Tc733-element-unknowngall-Tc734-element-unknowngall-Tc735-element-unknowngall-Tc736-element-unknowngall-Tc737-element-unknowngall-Tc738-element-unknowngall-Tc739-element-unknowngall-Tc740-element-unknowngall-Tc741-element-unknowngall-Tc742-element-unknowngall-Tc743-element-unknowngall-Tc744-element-unknowngall-Tc745-element-unknowngall-Tc746-element-unknowngall-Tc747-element-unknowngall-Tc748-element-unknowngall-Tc749-element-unknowngall-Tc750-element-unknowngall-Tc751-element-unknowngall-Tc752-element-unknowngall-Tc753-element-unknowngall-Tc754-element-unknowngall-Tc755-element-unknowngall-Tc756-element-unknowngall-Tc757-element-unknowngall-Tc758-element-unknowngall-Tc759-element-unknowngall-Tc760-element-unknowngall-Tc761-element-unknowngall-Tc762-element-unknowngall-Tc763-element-unknowngall-Tc764-element-unknowngall-Tc765-element-unknowngall-Tc766-element-unknowngall-Tc767-element-unknowngall-Tc768-element-unknowngall-Tc769-element-unknowngall-Tc770-element-unknowngall-Tc771-element-unknowngall-Tc772-element-unknowngall-Tc773-element-unknowngall-Tc774-element-unknowngall-Tc775-element-unknowngall-Tc776-element-unknowngall-Tc777-element-unknowngall-Tc778-element-unknowngall-Tc779-element-unknowngall-Tc780-element-unknowngall-Tc781-element-unknowngall-Tc782-element-unknowngall-Tc783-element-unknowngall-Tc784-element-unknowngall-Tc785-element-unknowngall-Tc786-element-unknowngall-Tc787-element-unknowngall-Tc788-element-unknowngall-Tc789-element-unknowngall-Tc790-element-unknowngall-Tc791-element-unknowngall-Tc792-element-unknowngall-Tc793-element-unknowngall-Tc794-element-unknowngall-Tc795-element-unknowngall-Tc796-element-unknowngall-Tc797-element-unknowngall-Tc798-element-unknowngall-Tc799-element-unknowngall-Tc800-element-unknowngall-Tc801-element-unknowngall-Tc802-element-unknowngall-Tc803-element-unknowngall-Tc804-element-unknowngall-Tc805-element-unknowngall-Tc806-element-unknowngall-Tc807-element-unknowngall-Tc808-element-unknowngall-Tc809-element-unknowngall-Tc810-element-unknowngall-Tc811-element-unknowngall-Tc812-element-unknowngall-Tc813-element-unknowngall-Tc814-element-unknowngall-Tc815-element-unknowngall-Tc816-element-unknowngall-Tc817-element-unknowngall-Tc818-element-unknowngall-Tc819-element-unknowngall-Tc820-element-unknowngall-Tc821-element-unknowngall-Tc822-element-unknowngall-Tc823-element-unknowngall-Tc824-element-unknowngall-Tc825-element-unknowngall-Tc826-element-unknowngall-Tc827-element-unknowngall-Tc828-element-unknowngall-Tc829-element-unknowngall-Tc830-element-unknowngall-Tc831-element-unknowngall-Tc832-element-unknowngall-Tc833-element-unknowngall-Tc834-element-unknowngall-Tc835-element-unknowngall-Tc836-element-unknowngall-Tc837-element-unknowngall-Tc838-element-unknowngall-Tc839-element-unknowngall-Tc840-element-unknowngall-Tc841-element-unknowngall-Tc842-element-unknowngall-Tc843-element-unknowngall-Tc844-element-unknowngall-Tc845-element-unknowngall-Tc846-element-unknowngall-Tc847-element-unknowngall-Tc848-element-unknowngall-Tc849-element-unknowngall-Tc850-element-unknowngall-Tc851-element-unknowngall-Tc852-element-unknowngall-Tc853-element-unknowngall-Tc854-element-unknowngall-Tc855-element-unknowngall-Tc856-element-unknowngall-Tc857-element-unknowngall-Tc858-element-unknowngall-Tc859-element-unknowngall-Tc860-element-unknowngall-Tc861-element-unknowngall-Tc862-element-unknowngall-Tc863-element-unknowngall-Tc864-element-unknowngall-Tc865-element-unknowngall-Tc866-element-unknowngall-Tc867-element-unknowngall-Tc868-element-unknowngall-Tc869-element-unknowngall-Tc870-element-unknowngall-Tc871-element-unknowngall-Tc872-element-unknowngall-Tc873-element-unknowngall-Tc874-element-unknowngall-Tc875-element-unknowngall-Tc876-element-unknowngall-Tc877-element-unknowngall-Tc878-element-unknowngall-Tc879-element-unknowngall-Tc880-element-unknowngall-Tc881-element-unknowngall-Tc882-element-unknowngall-Tc883-element-unknowngall-Tc884-element-unknowngall-Tc885-element-unknowngall-Tc886-element-unknowngall-Tc887-element-unknowngall-Tc888-element-unknowngall-Tc889-element-unknowngall-Tc890-element-unknowngall-Tc891-element-unknowngall-Tc892-element-unknowngall-Tc893-element-unknowngall-Tc894-element-unknowngall-Tc895-element-unknowngall-Tc896-element-unknowngall-Tc897-element-unknowngall-Tc898-element-unknowngall-Tc899-element-unknowngall-Tc900-element-unknowngall-Tc901-element-unknowngall-Tc902-element-unknowngall-Tc903-element-unknowngall-Tc904-element-unknowngall-Tc905-element-unknowngall-Tc906-element-unknowngall-Tc907-element-unknowngall-Tc908-element-unknowngall-Tc909-element-unknowngall-Tc910-element-unknowngall-Tc911-element-unknowngall-Tc912-element-unknowngall-Tc913-element-unknowngall-Tc914-element-unknowngall-Tc915-element-unknowngall-Tc916-element-unknowngall-Tc917-element-unknowngall-Tc918-element-unknowngall-Tc919-element-unknowngall-Tc920-element-unknowngall-Tc921-element-unknowngall-Tc922-element-unknowngall-Tc923-element-unknowngall-Tc924-element-unknowngall-Tc925-element-unknowngall-Tc926-element-unknowngall-Tc927-element-unknowngall-Tc928-element-unknowngall-Tc929-element-unknowngall-Tc930-element-unknowngall-Tc931-element-unknowngall-Tc932-element-unknowngall-Tc933-element-unknowngall-Tc934-element-unknowngall-Tc935-element-unknowngall-Tc936-element-unknowngall-Tc937-element-unknowngall-Tc938-element-unknowngall-Tc939-element-unknowngall-Tc940-element-unknowngall-Tc941-element-unknowngall-Tc942-element-unknowngall-Tc943-element-unknowngall-Tc944-element-unknowngall-Tc945-element-unknowngall-Tc946-element-unknowngall-Tc947-element-unknowngall-Tc948-element-unknowngall-Tc949-element-unknowngall-Tc950-element-unknowngall-Tc951-element-unknowngall-Tc952-element-unknowngall-Tc953-element-unknowngall-Tc954-element-unknowngall-Tc955-element-unknowngall-Tc956-element-unknowngall-Tc957-element-unknowngall-Tc958-element-unknowngall-Tc959-element-unknowngall-Tc960-element-unknowngall-Tc961-element-unknowngall-Tc962-element-unknowngall-Tc963-element-unknowngall-Tc964-element-unknowngall-Tc965-element-unknowngall-Tc966-element-unknowngall-Tc967-element-unknowngall-Tc968-element-unknowngall-Tc969-element-unknowngall-Tc970-element-unknowngall-Tc971-element-unknowngall-Tc972-element-unknowngall-Tc973-element-unknowngall-Tc974-element-unknowngall-Tc975-element-unknowngall-Tc976-element-unknowngall-Tc977-element-unknowngall-Tc978-element-unknowngall-Tc979-element-unknowngall-Tc980-element-unknowngall-Tc981-element-unknowngall-Tc982-element-unknowngall-Tc983-element-unknowngall-Tc984-element-unknowngall-Tc985-element-unknowngall-Tc986-element-unknowngall-Tc987-element-unknowngall-Tc988-element-unknowngall-Tc989-element-unknowngall-Tc990-element-unknowngall-Tc991-element-unknowngall-Tc992-element-unknowngall-Tc993-element-unknowngall-Tc994-element-unknowngall-Tc995-element-unknowngall-Tc996-element-unknowngall-Tc997-element-unknowngall-Tc998-element-unknowngall-Tc999-element-unknowngall-Tc1000-element-unknown

• Leptoglossus

  leaf-footed bugs

  Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.

  Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteran

• Metrioptera roeselii

  Roesel's Bush-cricket

  Metrioptera roeselii, commonly known as Roesel's Bush-cricket, is a medium-sized bush-cricket native to continental Europe that has undergone significant range expansion in northern Europe since the 1980s. The species is characterized by a distinctive yellow-green coloration with a prominent yellow stripe along the lateral margin of the pronotum. It exhibits wing dimorphism, with both short-winged (brachypterous) and long-winged (macropterous) forms occurring in populations; the long-winged form is associated with range expansion. The species has been introduced to Britain and Scandinavia, with genetic evidence indicating human-mediated dispersal in some isolated populations.

  range-expansionclimate-change-indicatorwing-dimorphismhuman-mediated-dispersalgrasslandOrthopterabush-cricketEuropeinvasive-speciescitizen-science

• Trichonephila clavata

  Jorō spider, Joro Spider, Parachute spider

  Trichonephila clavata, commonly known as the Jorō spider, is a large orb-weaving spider native to East Asia that has become established as an invasive species in the southeastern United States since approximately 2010. First confirmed in Georgia in 2014, it has expanded rapidly across multiple states through a combination of ballooning dispersal and human-mediated transport. The species is notable for its substantial size, striking coloration, and extensive golden webs, but poses minimal risk to humans due to small fangs and docile behavior. Its physiological adaptations—including higher metabolic rate, faster heart rate, and greater cold tolerance than its congener Trichonephila clavipes—suggest potential for continued northward range expansion.

  invasive-speciesorb-weaverballooningurban-wildlifebiological-controlcold-tolerancestartle-responsecannibalismkleptoparasitismJapanese-folkloreNephilidaeTrichonephilaspider-silkrange-expansionphysiological-adaptationurban-ecologyagricultural-pest-predatoriNaturalistGeorgiaMarylandEast-AsiaUnited-Statesspider-bitevenomdocilenon-aggressiveweb-architectureegg-sacoverwinteringsexual-dimorphismmetabolic-rateheart-ratefreeze-toleranceroad-ecologyprey-capturecompetitionnative-spider-impactspublic-perceptionmedia-sensationalismmanagementpesticide-alternativesbroom-removalornamentalstructural-pestornithologycardinalweb-strengthtrophic-interactionsDNA-metabarcodingdiet-analysisspecies-distribution-modelphysiological-entomologybehavioral-ecologyarachnologyballooning-dispersalhuman-mediated-dispersalhitchhikercargo-stowawayport-of-entryclimate-changewarmingnorthward-expansionDMVHoward-CountyElkridgeIlchesterWest-Elkridgebeech-forestsecondary-forestsuburbanroadsidetelephone-polestreetlampforest-edgedisturbance-toleranceprey-detectionvibrational-noiseauditory-disturbancemotionlessfreezingshynessHannibal-Lecterstink-buglanternflyevolutionary-historyancient-associationecosystem-servicebiocontrolnatural-enemyinvasive-pestbrown-marmorated-stink-bugspotted-lanternflyHalyomorpha-halysLycorma-delicatulacompetitive-exclusiondominant-orb-weaverabundantpopulation-growthrapid-spreadrange-span120,000-km2physiological-plasticitymetabolismtwice-as-high77%-higher-heart-rate74%-freeze-survivaldevelopment-rateseasonal-windowlife-cycle-completionthermal-limitationcongener-comparisonnatural-dispersalhuman-transportiNaturalist-recordcitizen-scienceconfirmed-sightingbreeding-populationmale-and-femalegravid-femaleegg-casestowawaycargo-containerport-introductionlocal-portvehicle-transporthitchhikingaccelerated-arrivalseveral-yearsnatural-meansprognosticationpredictionmodelsuitable-habitatabundant-suitable-habitateastern-North-Americawestern-North-Americapotential-rangeinvasive-rangepotential-impactenvironmental-impactecological-impactecosystem-impactmonitorcautiousevidence-basedreasonable-journalismsensationalismexaggerationuncritical-acceptanceharmlesscarefully-monitorednext-stepsresearch-opportunitycall-for-researchknowledge-gaplittle-knownnovel-ecosystemspreadingrapidly-expandinginvasive-predatorinvasive-orb-weavernon-nativeintroducedestablishedcolonizedthrivingdoing-finehappymerely-20-minutes-awayroad-tripvisitaccess-spreadbeech-leaf-diseaseBLDstate-forestremarkable-colonyamongst-beech-treesconfirmed-prognosticationDavis-and-Frickescape-relative-warmthexpand-range-northwardeastern-seaboardmerely-20-minutes-away-from-homeresist-opportunityamazing-predatorstales-of-arrivalprevious-episodes20222024reduce-angstlarge-non-native-spiderestablishing-in-DMVfacts-presentedpast-episodevenomous-terrible-painfulNahexpert-Rick-Hoebekerisks-smallpuny-fangsunlikely-pierce-skinvideocompletely-non-aggressiveeastern-Howard-Countyhaphazard-webslittered-with-remainsformer-victimsleavesshed-exoskeletonsmuch-larger-femaledwarfs-matepositioned-just-abovestrand-of-silkspinneretsunderside-of-abdomennear-red-moundrelative-to-handlarge-and-docilewait-and-seewhat-Jorō-means-to-ecosystemshelp-other-spidersput-a-beat-down-on-invasive-pestsstink-bugsspotted-lanternfliespassive-huntersenormous-webslarger-than-a-meter-in-diametercapture-prey-snared-in-silkarachnophobes-scaryarachnophiles-beautifulimportant-ecosystem-servicescrop-pestsnative-rangeAsiahaving-an-old-friend-over-for-dinnerreunitefirst-timelarge-spidersjuicy-prey-itemsfeathered-and-non-feathered-reptilesposes-no-known-threatdifficult-to-predict-impactnon-native-speciesexperts-suggestbeyond-scary-miengive-indigenous-large-orb-weavers-run-for-their-moneyblack-and-yellow-garden-spidermarbled-orb-weaverspotted-orb-weaverother-parts-of-worldmost-abundant-and-dominant-orb-weaverwhat-will-it-meanonly-time-will-tellfinal-tidbitJorō-shapeshifterJorō-gumobeautiful-womanseduces-menbinds-with-silkdevoursbad-dateacknowledgementsRick-Hoebekeidentifying-JorōinsightsDavid-CoyleBob-Bellingergreat-imagesknowledgestudiesVeni-vidi-viciNelsen-et-al.Physiological-evaluationNephila-clavata-newly-recordedHoebeke-et-al.Life-Cycle-Habitat-and-VariationMooreStartle-responsesDavis-and-AneraoHow-Urban-Tolerant-Are-TheyDavis-et-al.inspirationdetailsstarsDave-ClementMiri-TalabacMaddie-Potterhooked-up-with-colonydifferentiateresources.ipmcenters.orglinkJorō-guruDavid-Coyle's-takeYouTubecalm-your-fearsJournal-of-Economic-EntomologyJournal-of-Medical-Entomologychemical-management-strategieseffective-management-methodsspider-control-productssafe-and-effectiveunlikely-to-bitegenerally-harmlessbig-spiderscolorful-spidersinvasive-spidersin-your-face-spiderswebs-on-homeslandscape-plantsstructuresmiddle-of-where-people-live-work-and-playnorthern-Georgia-2014presumed-arrived-few-years-prior15-yearsincreased-dramaticallymuch-of-Southeastdisjunct-populationsnortheastern-U.S.firestorm-of-interestrapidly-expanding-rangesoutheastern-statesmany-countiesCarolinasTennesseeOklahomamore-than-a-centuryparts-of-Floridararely-Pennsylvaniatropicsthermal-limitationshigher-metabolismfaster-heart-ratebetter-ability-to-tolerate-freezingcomplete-life-cycle-rapidlychilly-temperaturessuite-of-adaptationsexpand-northwardwarm-loving-cousinfindings-support-potentialmuch-yet-to-be-learnedsuccessfully-survive-northern-wintersnation-and-world-warmsouthern-species-expandhigher-latitudes-and-altitudesrapidly-range-expansion-will-occurtypical-mode-of-dispersalaerial-dispersalballooning-on-strands-of-silkCharlotte's-babiesCharlotte's-Webspectacular-monikerparachute-spiderrain-down-from-airplaneslong-distance-transithuman-assistancegood-hitchhikersinseminated-gravid-femaleegg-case-stowawayarrival-in-DMVseveral-years-by-natural-meansnew-introduction-at-local-porthuman-assist-in-vehiclesaccelerate-arrivalterrible-and-painfulsmall-fangsvisited-cousingolden-silk-spiderCosta-Ricaexceeding-meter-diameterindigenous-large-orb-weaversrun-for-their-moneyminimal-direct-impactfirestormAndrew-DavisBenjamin-FrickUniversity-of-Georgiapast-weeknative-to-eastern-AsiaJapanChinaKoreaTaiwanknown-in-Georgia-since-2013spreading-rapidlyjoined-its-cousinTrichonephila-clavipesestablished-over-160-yearsbetter-tolerate-freezingsurvive-northern-wintersrapidly-range-expansiontypical-modelong-distancenew-introductionhuman-assistarachnophobesarachnophilesbrown-marmorated-stink-bugsdifficult-to-predictscary-mienindigenous-orb-weaversMary-NouriSarah-MorganWAMUrelatively-harmlessspider-seasonfallleaves-changing-colorcool-crisp-autumn-airpumpkin-spiceextension-entomologistSoutheastnot-just-spiders20-feet-widehomespeople-live-work-and-play15-years-or-soinflux-of-callspublicentomology-extension-programsmedia-frenzytwo-questionsget-rid-of-Jorō-spidersare-Jorō-spiders-dangerousClemson-UniversitySouthern-Adventist-UniversityWashington-CollegeUnion-Collegetwo-new-studiestest-methods-for-eliminatinghow-likely-to-biteharmscoured-internetrecommended-treatment-optionsspider-specific-management-recommendationsmedically-relevantwidow-spidersbrown-reclusesdo-not-enter-homesrelatively-newrecommended-productslabelled-spider-control-productstested-productsseveral-products-eliminatenot-legal-pesticidesmachine-lubricantnot-recommendedcommercially-availablestrongly-encouragelabelled-productseasiest-and-cheapestwithout-chemicalsbroom-or-stickwalked-into-spider-webrode-biketook-spider-to-facenot-great-feelingwonder-if-biteygive-bitten-superpowersunique-studiesevaluated-behaviorsreact-to-peoplerather-drop-off-webhang-around-and-bitereally-provokevolunteered-to-get-bittenyes-you-read-correctlyakin-to-mosquito-bitelittle-rednesslittle-swellinglargely-gone-next-dayno-acquired-superpowerstake-home-messagetwofoldsimplest-and-most-effectivewithout-pesticidesfeel-you-need-pesticidesproduct-labeled-for-spider-controltry-not-to-freak-outdoesn't-want-to-be-on-youodds-of-getting-bitten-extremely-lowenjoy-glorious-fall-weatherdrink-pumpkin-spiced-beveragewatch-where-you-walkKeep-calm-and-carry-onbites-unlikelycause-minimal-discomfortassociate-professorDepartment-of-Forestry-and-Environmental-Conservationsocialsemailextensionfeaturedpest-managementEntomology-Todaylatest-postsemail-subscriptionMarch-2022wonderedmake-its-way-to-DMVSeptember-2022two-observationsthree-years40-sightingshappy-and-doing-just-fineseveral-Howard-County-locationsweek-or-so-agoteam-of-scientistsUniversitymissionkilling-ultra-valuable-beech-treesthriving-amongst-beech-treesvisit-amazing-predatorsmature-femalesboth-Trichonephila-speciesthree-locally-common-orb-weaving-speciestime-spent-immobilemild-disturbancebrief-puff-of-airair-puff-response-datafive-other-North-American-speciespublished-literature453-observationsfreezing-behavior10-spider-speciesremained-immobile-under-a-minuteboth-Trichonephila-spidersover-an-hourunprecedentedshyest-ever-documentedtolerate-urban-environmentsremaining-motionlessfleeingnonsexual-cannibalismmating-activityfemales-cannibalize-malesfood-availabilityterritorial-aggressionSoutheastern-United-Statesexpanding-rangeshybehavioral-reactionsdescriptive-observationsphoto-documentationanecdotal-observationscontrolled-pairingslabnatural-websfieldone-female-biting-and-killing-anothershort-fightsimilar-sizecontainer25-trialsfights-ensued-40%different-sizes27-trialsfights-happened-18%larger-females-not-always-aggressor52-lab-trialssix-bouts9%direct-killingfield-trialsempty-web14-trialsone-fight7%aggressor-killing-and-wrappingsilkaway-from-any-webnot-necessarily-territorialityintraspecific-aggressionprovoked-or-stresseddeserves-more-studynewly-invasivebiologyphysiologynew-rangeclosely-related-speciessuccessfully-established160-yearsinvestigationcompareonline-recordsiNaturalist.orgseasonal-distributionstimingfemalesphysiological-traitsenvironmental-tolerancemetabolic-ratescardiac-functioningcold-exposuresurvivalbrief-below-freezing-temperatureshorter-seasoncomplete-lifecyclenarrow-periodsuitable-weatherinherently-higher-metabolismlow-temperaturesurvive-better74%-compared-to-50%brief-freezecolder-climatic-regionsoutheastern-USAuseful-informationplanningurban-landscapesbusy-roadsfrequent-disturbancesauditory-and-vibrationalphysiological-or-behavioral-changesnortheast-Georgiavarying-levels-of-road-trafficprey-capture-behaviorsimulated-preytuning-fork128-hz-frequencytouched-to-webattacked357-total-trials20-different-roadsattacked-59%high-variabilitysome-roadsides-over-80%others-less-than-30%small-but-significant-negative-correlationdaily-road-trafficspider-attack-ratesmoderate--to-heavy-traffic-roadsslightly-less-likely-to-attack51%-vs-65%able-to-live-near-roadscost-in-terms-of-prey-capturedid-not-weigh-lesscompensate-for-disturbanceaccumulating-evidencehuman-dominated-landscapesaid-spreadintroduced-rangeEriostethus-rufuspolysphinctine-ectoparasitoidaraneid-spidersNeoscona-spp.endemic-to-JapanYamagata-Prefecture38º46'-Nnorthern-Japannorthernmost-recordgenusidentification-confirmedmorphologyDNA-barcodingcocoonlarge-modified-webuniqueinverted-triangleover-50-cmhanging-from-ill-defined-partno-organized-structurehost-spidercircumstantial-evidencesstructure-of-modified-webpre-existing-web-partly-reusedorb-web-completely-removedsustaining-threads-newly-mooredparasitises-host-spiderstwo-subfamiliesunusual-for-groupinvasion-potentialknown-invasive-rangereviewdispersal-abilitiespotential-impactsmanagement-strategiesOctober-2022at-least-120,000-km2South-CarolinaNorth-CarolinaAlabamaWest-Virginiapattern-of-spreadnatural-dispersal-mechanismshuman-mediated-transportlarge-bodied-orb-weaversflying-insectssmall-animalsthirteen-co-occurring-spider-speciesmonitored-for-competitionresourcesweb-building-sitesnatural-and-urban-habitatsmanagement-options-limitedadvise-journalists-and-expertsagainst-exaggerating-potential-environmental-impactecologically-harmlessrapid-spread-carefully-monitoredcautious-evidence-based-approachdetermining-next-stepsthree-material-typesweb-captureintroduced-speciesalter-established-trophic-interactionsmolecular-analysisresolve-changescommunity-structureforaging-linkseast-coastfecal-samplesprey-remains-from-websdissected-gutscompare-diet-compositionarthropod-targeted-COI-primersIllumina-MiSeqhighest-diversityhighest-richnesshighest-proportion-prey-readsrecovery-of-prey-readsdissected-gut-contentlowoverwhelmed-by-Jorō-spider-DNAhigh-proportions-Jorō-spider-readshigher-prey-diversity-and-richnessdetected-prey-DNAseveral-days-after-captureinitial-gut-retention-time-estimatesfirst-glimpsecomplexity-of-trophic-associationsintroduced-web-building-spiderviable-materialsource-of-prey-DNAestimates-of-biodiversityJammu-and-Kashmirnorthernmost-shiftingdocument-presencebehaviorhabitat-adaptationcolder-temperature-environmentGoha-TehsilDoda-district1556.74-metersroad-bridgenearby-vegetationbrightly-colored-abdomensblackgreenyellowredlong-legsyellow-and-black-bandingspredominantly-seensmallerfewerunique-behaviorsremaining-motionless-after-disturbances5-10-meters-of-roadsadaptation-to-human-settlementsfield-observationsimage-documentationexpert-confirmationthrive-in-colder-conditions15-20-degrees-CelsiusOctober-Novemberno-spider-foundhigher-elevationssignificantly-lower-temperaturesadaptation-limited-to-milder-cold-regionsnew-insightadaptationneed-for-further-researchnon-native-habitatseggsoverwinterharsh-weather-conditionsno-protectioncompact-silk-casemilky-coatingchorionic-microspheresCMfine-structural-characteristicsecological-importanceuneven-size-distributionouter-eggmassevenly-coveredsingle-layerdiameter-2.3-µmshort-papillary-projectionssegmental-adhesionmucous-componentsinsoluble-in-waterpartially-soluble-in-absolute-ethanolspherical-structureHFIPstrong-organic-solventnot-derived-from-vitellogenic-or-choriogenetic-processesCM-adhesive-coatingsovipositional-processequivalent-to-cocoon-silkprotective-functionssilken-eggcaseNorthern-CardinalCardinalis-cardinalisperchessteals-foodsoutheast-of-the-United-Statesquestionsnative-fauna-affectedconsuming-prey-itemsexamplenative-species-deriving-benefitmanner-of-kleptoparasitismperched-directly-on-websupported-its-weight42-48-gfirst-documented-casespider-web-supporting-perching-birdmeasurementsforce-gaugetypical-webssupport-masses-up-to-70-gsmall-but-growing-body-of-knowledgenon-native-spiderspecies-distribution-modelsecological-niche-modelingpredict-areasestablish-if-introducedthree-distinct-genetic-lineagesmitochondrial-COIgenome-wide-SNPsKorean-Peninsula