Phytophagous
Guides
Euschistus ictericus
Shield bug
Euschistus ictericus is a North American shield bug (Pentatomidae) measuring 10.5–12 mm in length. It is distinguished from other brown stink bugs by the absence of black spots on the ventral mid-abdomen and the presence of black rings around abdominal spiracles. The species inhabits damp environments and has been documented on diverse host plants including sedges, irises, water lilies, willows, and various legumes. It is not considered an economically important agricultural pest.
Euschistus inflatus
Euschistus inflatus is a Nearctic stink bug species in the family Pentatomidae. It was described by Van Duzee in 1903 and is found in North America. The species was examined in a 2022 taxonomic revision that formalized the ictericus group within Euschistus (Euschistus), where it was treated as similar and probably related to core group members but not formally included in the group. Host plants documented for this species include Rubus arizonensis, Verbascum thapsus, sugar beets, and green beans.
Euschistus variolarius
one-spotted stink bug, onespotted stink bug
Euschistus variolarius, commonly known as the one-spotted stink bug, is a Nearctic species of shield bug in the family Pentatomidae. It is a phytophagous insect that feeds primarily on seeds and developing fruits of various plants, including legumes, grasses, and agricultural crops such as soybean and alfalfa. The species produces one generation per year in northern parts of its range, with adults overwintering in ground debris and emerging in spring to reproduce. While historically considered a minor pest, it has become increasingly recognized as an emerging pest in Midwestern soybean and corn production.
Exapion ulicis
Gorse Seed Weevil
Exapion ulicis is a small seed-feeding weevil specialized on gorse (Ulex europaeus). Adults are light gray with a prominent snout roughly half the body length. The species is native to western Europe and has been introduced to New Zealand, California, Hawaii, and other regions as a biological control agent targeting invasive gorse populations. Larval feeding destroys seeds within pods, reducing plant spread, while adult feeding on stems and spines causes minor damage.
biological-controlinvasive-species-managementseed-predatorhost-specializationtemporal-isolationBrentidaeColeopteraUlex-europaeusgorsewestern-EuropeCaliforniaNew-ZealandHawaiispring-activityoviposition-cuespod-fecundityparasitoidseed-destructionnoctuidpest-control-agentestablished-introductionnative-range-Europeintroduced-range-PacificChileBelgiumOregonnorthern-Californiaforest-gapspasturesnatural-areasseed-lossintensity-of-attackreproductive-isolationecological-specializationsympatric-divergencehost-phenologypod-sizeseed-contentfemale-choicefeeding-damageround-holesstem-feedingspine-feedinglarval-developmentpupal-period6-8-weeks-larval-feeding2-months-pupationwithin-pod-developmentseed-to-ovule-ratiomature-seedsintact-seedsparasitization-ratepopulation-abundancefecund-pod-targetingwhole-plant-traitsflower-traitspod-traitschoice-experimentscommon-gardenBrittanyScotlandReunionhost-availabilityseasonal-activitymorphological-identificationmitochondrial-sequencesnuclear-sequencesphylogenyhost-racesdivergent-selectionecological-speciationsympatric-populationsspring-infestationautumn-infestationintroduced-with-gorsenot-initially-introducedinvasive-plantplant-insect-interactionsoviposition-behaviorfeeding-behaviorpreference-patternsmultiple-trait-usesurface-cuesinternal-cuespod-characteristicshost-choiceplant-susceptibilityinvasion-biologyentomological-experimentalispan-pacific-entomologistdiversity-journalecological-entomologyCoombs-2004HEAR-photo-galleryiNaturalistGBIFNCBIForster-1771CurculionoideaApionidaeFabaceaeGenisteaenoxious-weedagent-of-biological-pest-controllight-graylong-snoutstraight-snout2-3-mmsmall-weevilseed-weevilgorse-seed-weevilestablished-populationspercentage-of-pods-infestedspatial-variationtemporal-variationseed-setseed-productionseed-predation-impactecosystem-serviceweed-biological-controlclassical-biological-controlinundative-biological-controlself-sustaining-populationsnon-target-effectshost-specificityreproductive-phenologyphenological-matchingphenological-isolationallochronic-speciationtemporal-nicheresource-partitioningcompetitive-exclusioncharacter-displacementmolecular-phylogeneticsCOIITSmorphological-charactersindividual-variationenvironmental-variationmitochondrial-DNAnuclear-DNAspecies-differentiationgenetic-divergenceecological-divergenceadaptive-radiationhost-shifthost-race-formationsympatric-speciationreinforcementprezygotic-isolationpostzygotic-isolationhabitat-fragmentationpopulation-structuregene-flowlocal-adaptationphenotypic-plasticitygenetic-driftnatural-selectionsexual-selectionfounder-effectbottleneckinvasion-geneticsenemy-releaseevolutionary-potentialrapid-evolutioncontemporary-evolutioneco-evolutionary-dynamicscommunity-ecologytrophic-interactionsfood-webecosystem-functionecosystem-processnutrient-cyclingenergy-flowpopulation-dynamicsmetapopulationsource-sinkdispersalcolonizationestablishmentspreadimpact-assessmentnon-target-riskefficacyestablishment-successpopulation-establishmentfield-releasemonitoringevaluationadaptive-managementintegrated-pest-managementsustainable-agricultureconservation-biological-controlaugmentative-biological-controlinoculative-biological-controlnatural-enemyherbivorephytophagousmonophagousoligophagouspolyphagousspecialistgeneralistco-evolutioncoevolutionary-arms-raceplant-defenseherbivore-offenseinduced-defenseconstitutive-defensedirect-defenseindirect-defensevolatile-organic-compoundsextrafloral-nectariestrophic-cascadesapparent-competitionenemy-mediated-apparent-competitionintraguild-predationmultitrophic-interactionstrait-mediated-indirect-effectsdensity-mediated-indirect-effectsecosystem-engineeringniche-constructionextended-phenotypeenvironmental-feedbackeco-evolutionary-feedbackevolutionary-rescuegenetic-rescueassisted-migrationmanaged-relocationconservation-translocationreintroductionrestoration-ecologyhabitat-restorationecological-restorationweed-managementrangeland-managementforest-managementprotected-area-managementbiodiversity-conservationecosystem-servicesprovisioning-servicesregulating-servicescultural-servicessupporting-servicessustainable-development-goalsAichi-targetsKunming-Montreal-global-biodiversity-frameworkIPBESIUCNCBDFAOEPPOregulatory-frameworkrisk-analysisenvironmental-impact-assessmentcost-benefit-analysisdecision-supportstakeholder-engagementsocial-licensepublic-acceptancecommunicationeducationoutreachcitizen-scienceiNaturalist-observationsoccurrence-recordsspecimen-recordsmuseum-collectionsvoucher-specimenstype-specimensholotypeparatypesyntypelectotypeneotypeoriginal-descriptionsubsequent-designationtaxonomic-revisionphylogenetic-revisionmonographfield-guideidentification-keydiagnostic-charactersillustrationphotographymicroscopyscanning-electron-microscopymolecular-techniquesDNA-barcodingmetabarcodingenvironmental-DNApopulation-geneticsphylogeographylandscape-geneticsseascape-geneticsisolation-by-distanceisolation-by-environmentisolation-by-resistanceleast-cost-pathcircuit-theoryspecies-distribution-modelingecological-niche-modelingmaxentbioclimworldclimchelsamodisremote-sensingGISspatial-analysistemporal-analysistime-seriesphenologyclimate-changeglobal-warmingphenological-shiftrange-shiftpoleward-shiftelevational-shiftaltitudinal-shifthabitat-trackingniche-trackingniche-conservatismniche-evolutionrealized-nichefundamental-nichebiotic-interactionsabiotic-factorsenvironmental-filteringdispersal-limitationsource-poolspecies-poolregional-poollocal-poolalpha-diversitybeta-diversitygamma-diversityspecies-richnessspecies-evennessspecies-abundancedominanceraritycommonnessendemismcosmopolitanismnativeendemicintroducedinvasivenaturalizedcasualtransientephemeralpersistentestablishedspreadinginvasive-potentialinvasivenessimpactecological-impacteconomic-impactsocial-impactenvironmental-impactnegative-impactpositive-impactbeneficialdetrimentalnuisancepestweedpathogendisease-vectorpublic-healthveterinary-healthcrop-healthforest-healthrangeland-healthecosystem-healthOne-Healthplanetary-healthecohealthconservation-medicinedisease-ecologyparasitologyentomologymedical-entomologyveterinary-entomologyagricultural-entomologyforest-entomologyurban-entomologyaquatic-entomologysystematicstaxonomyphylogeneticsevolutionary-biologypopulation-biologyecosystem-ecologylandscape-ecologyglobal-ecologymacroecologybiogeographyhistorical-biogeographyecological-biogeographyisland-biogeographycontinental-biogeographylatitudinal-gradientaltitudinal-gradientspecies-area-relationshipisland-species-richnessequilibrium-theorynonequilibrium-theoryneutral-theoryniche-theoryassembly-rulespriority-effectsmass-effectsspecies-sortingcompetitionpredationherbivoryparasitismmutualismcommensalismamensalismfacilitationinhibitiontolerancesuccessionprimary-successionsecondary-successiondisturbancerecoveryresilienceresistancestabilitypersistenceturnoverreplacementextinctionimmigrationemigrationbirthdeathreproductionsurvivalgrowthdevelopmentmetamorphosiscomplete-metamorphosisholometaboloushemimetabolousametabolousegglarvapupaadultinstarecdysismoltingdiapausequiescenceaestivationhibernationoverwinteringoverwintering-stageoverwintering-siteoverwintering-strategycold-hardinessfreeze-tolerancefreeze-avoidancesupercoolingcryoprotectantsthermal-biologythermoregulationectothermypoikilothermybehavioral-thermoregulationmicrohabitat-selectionbaskingshadingstiltingperchingroostingshelteringburrowingmininggall-formationleaf-rollingleaf-tyingsilk-productionweb-spinningnest-constructionoviposition-site-selectionhost-plant-selectionmate-choicesperm-competitioncryptic-female-choicepolyandrypolygynymonogamypromiscuitylekkingterritorialityaggressiondefensepredator-avoidanceantipredator-behaviorcrypsismasquerademimicryBatesian-mimicryMüllerian-mimicryautomimicryaggressive-mimicrystartle-displaythanatosisdeath-feigningautotomyreflex-bleedingchemical-defensemechanical-defensephysical-defensebehavioral-defensemutualistic-defenseplant-animal-interactionspollinationseed-dispersalantagonismsynergismantagonistic-pleiotropytrade-offslife-historylife-history-strategyr-selectionK-selectionbet-hedgingiteroparitysemelparityannualperennialbiennialpluriannuallongevitylifespangeneration-timedevelopment-timegrowth-ratereproductive-ratefecundityfertilityvirilitymating-successreproductive-successfitnessinclusive-fitnesskin-selectiongroup-selectionmultilevel-selectionindividual-selectionartificial-selectionsocial-selectionecological-selectionstabilizing-selectiondirectional-selectiondisruptive-selectionbalancing-selectionfrequency-dependent-selectionnegative-frequency-dependent-selectionpositive-frequency-dependent-selectionapostatic-selectionantiapostatic-selectionrare-type-advantagecommon-type-disadvantageheterozygote-advantageheterosishybrid-vigorinbreeding-depressionoutbreeding-depressiongenetic-loadmutational-loadsegregational-loadsubstitutional-loaddrift-loadmigration-loadmutationrecombinationchromosomal-rearrangementgenome-evolutiontransposable-elementshorizontal-gene-transferendosymbiosissymbiogenesisholobionthologenomeextended-evolutionary-synthesisniche-construction-theoryecological-evolutionary-developmental-biologyeco-evo-devodevelopmental-plasticityreaction-normgenotype-environment-interactionGxEnorm-of-reactionplasticitycanalizationgenetic-assimilationgenetic-accommodationcryptic-genetic-variationevolutionary-capacitanceevolvabilityrobustnessmodularityintegrationcorrelationconstrainttrade-offpleiotropyepistasisadditive-genetic-variancedominance-varianceepistatic-variancegenetic-variancephenotypic-varianceenvironmental-varianceheritabilitynarrow-sense-heritabilitybroad-sense-heritabilityresponse-to-selectionbreeder's-equationquantitative-geneticsmolecular-geneticsgenomicstranscriptomicsproteomicsmetabolomicsphenomicsecogenomicsconservation-genomicsfunctional-genomicsstructural-genomicscomparative-genomicsevolutionary-genomicsphylogenomicsmetagenomicsmicrobiomeviromemycobiomebacteriomearchaeomeeukaryomeextended-genotypekeystone-speciesecosystem-engineerfoundation-speciesdominant-speciessubordinate-speciestransient-speciessatellite-speciescore-speciesperipheral-speciesedge-speciesinterior-specieshabitat-generalisthabitat-specialistedge-habitatinterior-habitatmatrix-habitatcorridorstepping-stonesource-habitatsink-habitatpatchfragmentlandscapeseascaperiverscapeskyscapesoundscapesmellscapetastestouchvisionolfactiongustationmechanoreceptionthermoreceptionphotoreceptionchemoreceptionelectroreceptionmagnetoreceptionproprioceptionnociceptionsensory-ecologysensory-biologyneuroethologybehavioral-ecologycognitive-ecologyevolutionary-ecologyecological-immunologyecoimmunologyepidemiologyparasite-ecologyhost-parasite-interactionshost-pathogen-interactionshost-symbiont-interactionsmicrobial-ecologyvirologybacteriologymycologyprotistologyhelminthologyentomopathologymicrobial-controlviral-controlfungal-controlbacterial-controlnematode-controlparasitoid-controlpredator-controlherbivore-controlcompetitor-controlautocidal-controlsterile-insect-techniqueincompatible-insect-techniquegene-driveRNA-interferenceCRISPRgenetic-biocontrolprecision-guided-sterile-insect-techniqueself-limiting-genetic-controlself-sustaining-genetic-controlpopulation-suppressionpopulation-replacementpopulation-eliminationarea-wide-integrated-pest-managementsterile-insect-releaseinundative-releaseinoculative-releaseneoclassical-biological-controlaugmentation-biological-controlhabitat-manipulationcultural-controlphysical-controlmechanical-controlchemical-controlpesticide-resistance-managementinsecticide-resistance-managementherbicide-resistance-managementfungicide-resistance-managementantibiotic-resistance-managementresistance-evolutionresistance-managementrefuge-strategyhigh-dose-strategypyramid-strategyrotation-strategymixture-strategymosaic-strategyintegrated-resistance-managementintegrated-weed-managementintegrated-crop-managementintegrated-forest-managementintegrated-vector-managementintegrated-disease-managementOne-Health-approachecohealth-approachplanetary-health-approachsustainable-intensificationagroecologyorganic-agricultureconservation-agricultureclimate-smart-agricultureprecision-agriculturedigital-agriculturesmart-farmingagricultural-roboticsautonomous-systemsdrone-technologysatellite-imageryGPSvariable-rate-technologysite-specific-managementdecision-support-systemsexpert-systemsartificial-intelligencemachine-learningdeep-learningneural-networkscomputer-visionimage-recognitionpattern-recognitiondata-miningbig-datacloud-computinginternet-of-thingssensor-networkswireless-sensor-networksprecision-livestock-farmingprecision-aquacultureprecision-forestryprecision-horticultureprecision-viticultureprecision-apicultureprecision-sericultureintegrated-farming-systemsmixed-farming-systemsdiversified-farming-systemsagroforestrysilvopasturesilvoarablealley-croppingforest-farminghomegardensmultistrata-systemstropical-homegardenstemperate-agroforestrypermacultureregenerative-agriculturerestorative-agriculturebiodynamic-agriculturenatural-farmingdo-nothing-farmingFukuoka-farmingMasanobu-FukuokaRachel-CarsonSilent-Springintegrated-pest-management-historybiological-control-historyclassical-biological-control-historyRachel-Carson-legacyenvironmental-movementconservation-movementsustainability-scienceresilience-scienceadaptive-governancesocial-ecological-systemssocio-ecological-systemscoupled-human-natural-systemscomplex-adaptive-systemspanarchyadaptive-cyclerigidity-trappoverty-traptransformationtransitionsustainability-transitionenergy-transitionfood-system-transformationagrifood-system-transformationland-use-changeland-cover-changeland-use-intensificationagricultural-expansiondeforestationreforestationafforestationforest-degradationforest-restorationecosystem-restorationwetland-restorationriparian-restorationcoastal-restorationcoral-reef-restorationseagrass-restorationmangrove-restorationsalt-marsh-restorationdune-restorationprairie-restorationsavanna-restorationwoodland-restorationold-growth-restorationdegraded-land-restorationabandoned-land-restorationcontaminated-land-restorationmined-land-restorationpost-industrial-restorationurban-restorationrural-restorationagricultural-restorationpastoral-restorationsilvicultural-restorationecological-engineeringenvironmental-engineeringbioremediationphytoremediationmycoremediationzooremediationmicrobial-remediationnanoremediationelectrokinetic-remediationsoil-washingsoil-vapor-extractionair-spargingpump-and-treatpermeable-reactive-barriersmonitored-natural-attenuationenhanced-natural-attenuationsource-zone-treatmentplume-treatmentrisk-based-corrective-actionrisk-assessmenthazard-assessmentexposure-assessmenttoxicity-assessmentrisk-characterizationrisk-managementrisk-communicationrisk-perceptionrisk-governanceprecautionary-principlepolluter-pays-principleextended-producer-responsibilitycircular-economygreen-economyblue-economybioeconomynatural-capitalecosystem-services-valuationpayment-for-ecosystem-servicesecosystem-based-adaptationecosystem-based-mitigationnature-based-solutionsworking-with-naturebuilding-with-natureengineering-with-naturegreen-infrastructureblue-infrastructureurban-green-infrastructureurban-blue-infrastructuresponge-citycool-cityforest-citybiophilic-citysustainable-cityresilient-citysmart-cityliveable-cityhealthy-cityequitable-cityjust-cityinclusive-cityparticipatory-cityco-productionco-designco-managementcommunity-based-managementcommunity-based-conservationcommunity-based-natural-resource-managementindigenous-and-local-knowledgetraditional-ecological-knowledgebiocultural-diversitybiocultural-heritagesacred-natural-sitesprotected-areasconservation-areasnature-reserveswildlife-reservesnational-parksworld-heritage-sitesbiosphere-reservesRamsar-sitesimportant-bird-areaskey-biodiversity-areasecologically-or-biologically-significant-marine-areasother-effective-area-based-conservation-measuresconservation-beyond-protected-areasconservation-on-private-landconservation-on-communal-landconservation-on-indigenous-landrights-based-conservationgender-responsive-conservationyouth-engagement-in-conservationintergenerational-equityintragenerational-equityenvironmental-justiceclimate-justiceconservation-justiceecological-justicespecies-justiceintersectionalitydecolonization-of-conservationpost-normal-sciencetransdisciplinarityparticipatory-researchaction-researchcommunity-based-participatory-researchcommunity-scienceparticipatory-monitoringadaptive-co-managementsocial-learningknowledge-co-productionboundary-workboundary-objectsboundary-organizationsscience-policy-interfacescience-society-interfaceknowledge-brokeringknowledge-translationknowledge-mobilizationresearch-impactresearch-uptakeevidence-based-policyevidence-based-practiceevidence-informed-decision-makingdecision-support-toolssystematic-reviewmeta-analysisevidence-synthesisknowledge-synthesisrapid-evidence-assessmentliving-evidenceliving-systematic-reviewscoping-reviewrapid-reviewrealist-synthesisnarrative-synthesisqualitative-synthesisquantitative-synthesismixed-methods-synthesisparticipatory-synthesisdeliberative-methodsconsensus-methodsexpert-elicitationstructured-expert-judgmentDelphi-methodnominal-group-techniqueconvergent-interviewfocus-groupstakeholder-workshopparticipatory-mappingparticipatory-modelingscenario-planningfuture-studiesforesightanticipatory-governancetransformative-governancepolycentric-governancemulti-level-governancenetwork-governancecollaborative-governancecooperative-governancedemocratic-governancedeliberative-democracyparticipatory-democracydirect-democracyrepresentative-democracyliberal-democracysocial-democracygreen-democracyecological-democracybiocracyecocracytechnocracymeritocracyplutocracyoligarchyautocracytotalitarianismauthoritarianismpopulismnationalismglobalismlocalismregionalismfederalismconfederalismunitarismcentralismdecentralizationdevolutionsubsidiarityfiscal-federalismenvironmental-federalismcompetitive-federalismcooperative-federalismdual-federalismmarble-cake-federalismlayer-cake-federalismpicket-fence-federalismpermissive-federalismcoercive-federalismmarket-preserving-federalismdemocratic-experimentalismlaboratories-of-democracypolicy-diffusionpolicy-transferpolicy-learningpolicy-innovationpolicy-entrepreneurshippolicy-windowspunctuated-equilibriumadvocacy-coalition-frameworkmultiple-streams-frameworkinstitutional-analysis-and-development-frameworksocial-ecological-systems-frameworksustainability-science-frameworkplanetary-boundaries-frameworkdoughnut-economics-frameworkcircular-economy-frameworkgreen-new-deal-frameworkjust-transition-frameworkleaving-no-one-behind2030-agendaParis-agreementRio-conventionsUNFCCCUNCCDCITESCMSRamsarWorld-HeritageIPCCWHOUNEPUNDPUNESCOWorld-BankIMFWTOOECDG7G20BRICSAfrican-UnionEuropean-UnionASEANMercosurNAFTAUSMCATPPCPTPPRCEPbilateral-investment-treatiesfree-trade-agreementsregional-trade-agreementsmultilateral-environmental-agreementsbilateral-environmental-agreementsstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmentgender-impact-assessmenthuman-rights-impact-assessmentindigenous-rights-impact-assessmentcultural-heritage-impact-assessmentlandscape-and-visual-impact-assessmentnoise-impact-assessmentair-quality-impact-assessmentwater-quality-impact-assessmentsoil-quality-impact-assessmentbiodiversity-impact-assessmentecosystem-services-impact-assessmentclimate-impact-assessmentcarbon-footprint-assessmentwater-footprint-assessmentland-footprint-assessmentmaterial-footprint-assessmentecological-footprint-assessmentplanetary-footprint-assessmentlife-cycle-assessmentlife-cycle-costingsocial-life-cycle-assessmentlife-cycle-sustainability-assessmentmaterial-flow-analysissubstance-flow-analysisenergy-flow-analysisnutrient-flow-analysiswater-flow-analysiscarbon-flow-analysisnitrogen-flow-analysisphosphorus-flow-analysiscircular-material-flowindustrial-ecologyindustrial-symbiosiseco-industrial-parkurban-metabolismindustrial-metabolismsocio-economic-metabolismsocial-metabolismpolitical-ecologypolitical-economyecological-economicsenvironmental-economicsnatural-resource-economicsresource-economicsenergy-economicsagricultural-economicsforest-economicsfisheries-economicswater-economicsbiodiversity-economicsecosystem-services-economicsconservation-economicsrestoration-economicsenvironmental-valuationcontingent-valuationchoice-experimentbenefit-transferhedonic-pricingtravel-cost-methodproduction-function-approachreplacement-cost-methoddamage-cost-avoided-methodopportunity-cost-methodnet-present-valueinternal-rate-of-returnbenefit-cost-ratiocost-effectiveness-analysismulti-criteria-decision-analysisanalytic-hierarchy-processanalytic-network-processpreference-ranking-organization-method-for-enrichment-evaluationtechnique-for-order-of-preference-by-similarity-to-ideal-solutionelimination-and-choice-expressing-realitydecision-making-trial-and-evaluation-laboratoryVIseKriterijumska-Optimizacija-I-Kompromisno-Resenjepreference-selection-indexcomplex-proportional-assessmentmulti-objective-optimization-on-the-basis-of-ratio-analysisweighted-aggregated-sum-product-assessmentevaluation-based-on-distance-from-average-solutionmeasurement-of-alternatives-and-ranking-according-to-compromise-solutioncomparative-performance-indexpreference-rankingscore-functionaccuracy-functionentropy-weightobjective-weightsubjective-weightcombined-weightsensitivity-analysisuncertainty-analysisfuzzy-logicfuzzy-set-theoryintuitionistic-fuzzy-setneutrosophic-setrough-setsoft-sethesitant-fuzzy-setPythagorean-fuzzy-setq-rung-orthopair-fuzzy-setspherical-fuzzy-setpicture-fuzzy-setcomplex-fuzzy-settype-2-fuzzy-setinterval-type-2-fuzzy-setinterval-valued-fuzzy-setinterval-valued-intuitionistic-fuzzy-setinterval-valued-Pythagorean-fuzzy-setinterval-valued-neutrosophic-setbipolar-fuzzy-setm-polar-fuzzy-setmulti-polar-fuzzy-setlinguistic-term-sethesitant-fuzzy-linguistic-term-setprobabilistic-linguistic-term-set2-tuple-linguistic-modelsymbolic-linguistic-modelvirtual-linguistic-modelnumerical-scale-modellinguistic-hierarchy-modeltransitive-calibration-modelconsistency-driven-methodologyconsistency-indexconsistency-ratioacceptable-consistencyinconsistency-identificationinconsistency-repairpriority-derivationweight-derivationaggregation-operatorordered-weighted-averaging-operatorweighted-averaging-operatorgeometric-operatorpower-operatorBonferroni-meanChoquet-integralShapley-valuegame-theoryNash-equilibriumPareto-optimalityPareto-efficiencyPareto-improvementsocial-welfare-functionutility-functionpreference-relationbinary-relationternary-relationn-ary-relationcomplete-relationincomplete-relationtransitive-relationintransitive-relationreflexive-relationirreflexive-relationsymmetric-relationasymmetric-relationantisymmetric-relationequivalence-relationpartial-ordertotal-orderstrict-orderweak-ordersemiorderinterval-orderPareto-orderlexicographic-orderdominance-relationoutranking-relationconcordancediscordancecredibilitydiscrimination-thresholdindifference-thresholdpreference-thresholdveto-thresholdmajority-ruleCondorcet-winnerCondorcet-loserBorda-countapproval-votingrange-votingscore-votinginstant-runoff-votingsingle-transferable-voteproportional-representationmixed-member-proportionaladditional-member-systemparallel-votingmajority-bonus-systemscorporodouble-votealternative-votesupplementary-votecontingent-voteBucklin-votingCoombs'-methodDodgson's-methodKemeny-Young-methodRanked-pairsSchulze-methodMinimax-CondorcetSmith-setSchwartz-setuncovered-setBanks-settop-cycleminimal-covering-setbipartisan-setessential-settournament-equilibrium-setminimal-extending-setPareto-setdeep-uncovered-setminimal-upward-covering-setminimal-downward-covering-setminimal-covering-set-with-respect-to-pairsminimal-covering-set-with-respect-to-tripletsminimal-stable-setminimal-retentive-setminimal-comprehensive-retentive-setminimal-extensive-retentive-setminimal-weakly-stable-setminimal-strongly-stable-setminimal-collectively-stable-setminimal-individually-stable-setminimal-Nash-stable-setminimal-individually-rational-setminimal-Pareto-optimal-setminimal-weakly-Pareto-optimal-setminimal-strongly-Pareto-optimal-setminimal-collectively-Pareto-optimal-setminimal-individually-Pareto-optimal-setminimal-Nash-Pareto-optimal-setminimal-individually-rational-Pareto-optimal-setminimal-comprehensive-Pareto-optimal-setminimal-extensive-Pareto-optimal-setminimal-weakly-comprehensive-Pareto-optimal-setminimal-strongly-comprehensive-Pareto-optimal-setminimal-collectively-comprehensive-Pareto-optimal-setminimal-individually-comprehensive-Pareto-optimal-setminimal-Nash-comprehensive-Pareto-optimal-setminimal-individually-rational-comprehensive-Pareto-optimal-setminimal-weakly-extensive-Pareto-optimal-setminimal-strongly-extensive-Pareto-optimal-setminimal-collectively-extensive-Pareto-optimal-setminimal-individually-extensive-Pareto-optimal-setminimal-Nash-extensive-Pareto-optimal-setminimal-individually-rational-extensive-Pareto-optimal-setminimal-weakly-retentive-Pareto-optimal-setminimal-strongly-retentive-Pareto-optimal-setminimal-collectively-retentive-Pareto-optimal-setminimal-individually-retentive-Pareto-optimal-setminimal-Nash-retentive-Pareto-optimal-setminimal-individually-rational-retentive-Pareto-optimal-setminimal-weakly-stable-Pareto-optimal-setminimal-strongly-stable-Pareto-optimal-setminimal-collectively-stable-Pareto-optimal-setminimal-individually-stable-Pareto-optimal-setminimal-Nash-stable-Pareto-optimal-setminimal-individually-rational-stable-Pareto-optimal-setminimal-weakly-Nash-stable-Pareto-optimal-setminimal-strongly-Nash-stable-Pareto-optimal-setminimal-collectively-Nash-stable-Pareto-optimal-setminimal-individually-Nash-stable-Pareto-optimal-setminimal-Nash-Nash-stable-Pareto-optimal-setminimal-individually-rational-Nash-stable-Pareto-optimal-setminimal-weakly-individually-rational-Pareto-optimal-setminimal-strongly-individually-rational-Pareto-optimal-setminimal-collectively-individually-rational-Pareto-optimal-setminimal-individually-individually-rational-Pareto-optimal-setminimal-Nash-individually-rational-Pareto-optimal-setminimal-individually-rational-individually-rational-Pareto-optimal-setminimal-weakly-Pareto-optimal-Nash-stable-setminimal-strongly-Pareto-optimal-Nash-stable-setminimal-collectively-Pareto-optimal-Nash-stable-setminimal-individually-Pareto-optimal-Nash-stable-setminimal-Nash-Pareto-optimal-Nash-stable-setminimal-individually-rational-Pareto-optimal-Nash-stable-setminimal-weakly-comprehensive-Pareto-optimal-Nash-stable-setminimal-strongly-comprehensive-Pareto-optimal-Nash-stable-setminimal-collectively-comprehensive-Pareto-optimal-Nash-stable-setminimal-individually-comprehensive-Pareto-optimal-Nash-stable-setminimal-Nash-comprehensive-Pareto-optimal-Nash-stable-setminimal-individually-rational-comprehensive-Pareto-optimal-Nash-stable-setminimal-weakly-extensive-Pareto-optimal-Nash-stable-setminimal-strongly-extensive-Pareto-optimal-Nash-stable-setminimal-collectively-extensive-Pareto-optimal-Nash-stable-setminimal-individually-extensive-Pareto-optimal-Nash-stable-setminimal-Nash-extensive-Pareto-optimal-Nash-stable-setminimal-individually-rational-extensive-Pareto-optimal-Nash-stable-setminimal-weakly-retentive-Pareto-optimal-Nash-stable-setminimal-strongly-retentive-Pareto-optimal-Nash-stable-setminimal-collectively-retentive-Pareto-optimal-Nash-stable-setminimal-individually-retentive-Pareto-optimal-Nash-stable-setminimal-Nash-retentive-Pareto-optimal-Nash-stable-setminimal-individually-rational-retentive-Pareto-optimal-Nash-stable-setminimal-weakly-stable-Pareto-optimal-Nash-stable-setminimal-strongly-stable-Pareto-optimal-Nash-stable-setminimal-collectively-stable-Pareto-optimal-Nash-stable-setminimal-individually-stable-Pareto-optimal-Nash-stable-setminimal-Nash-stable-Pareto-optimal-Nash-stable-setminimal-individually-rational-stable-Pareto-optimal-Nash-stable-setminimal-weakly-Nash-stable-Pareto-optimal-Nash-stable-setminimal-strongly-Nash-stable-Pareto-optimal-Nash-stable-setminimal-collectively-Nash-stable-Pareto-optimal-Nash-stable-setminimal-individually-Nash-stable-Pareto-optimal-Nash-stable-setminimal-Nash-Nash-stable-Pareto-optimal-Nash-stable-setminimal-individually-rational-Nash-stable-Pareto-optimal-Nash-stable-setminimal-weakly-individually-rational-Pareto-optimal-Nash-stable-setminimal-strongly-individually-rational-Pareto-optimal-Nash-stable-setminimal-collectively-individually-rational-Pareto-optimal-Nash-stable-setminimal-individually-individually-rational-Pareto-optimal-Nash-stable-setminimal-Nash-individually-rational-Pareto-optimal-Nash-stable-setminimal-individually-rational-individually-rational-Pareto-optimal-Nash-stable-setminimal-weakly-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setminimal-weakly-comprehensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-comprehensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-comprehensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-comprehensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-comprehensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-comprehensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-weakly-extensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-extensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-extensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-extensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-extensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-extensive-Pareto-optimal-individually-rational-Nash-stable-setminimal-weakly-retentive-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-retentive-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-retentive-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-retentive-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-retentive-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-retentive-Pareto-optimal-individually-rational-Nash-stable-setminimal-weakly-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-weakly-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-Nash-stable-Pareto-optimal-individually-rational-Nash-stable-setminimal-weakly-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setminimal-strongly-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setminimal-collectively-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setminimal-Nash-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setminimal-individually-rational-individually-rational-Pareto-optimal-individually-rational-Nash-stable-setFalconia
Falconia is a genus of plant bugs in the family Miridae, established by Distant in 1884. Species within this genus are phytophagous and associated with specific host plants. Falconia incaica has been documented feeding on Ricinus communis (castor bean) in Colombia, while F. intermedia has been investigated as a biological control agent for the invasive weed Lantana camara in Australia and Africa. Nymphal instars can be differentiated by morphological features including antennal segment measurements and coloration changes.
Flatoidinae
Flatoidinae is a subfamily of planthoppers within the family Flatidae, distinguished by their dorsoventrally flattened body form and wings held in a nearly horizontal position when at rest. Members of this subfamily are found primarily in tropical and subtropical regions, particularly in the Neotropics and West Indies. The subfamily was established by Melichar in 1902 and contains multiple genera including Petrusa and Ormenis. Species in this group are phytophagous and can achieve high population densities on host plants.
Fulgoroidea
planthoppers
Fulgoroidea is a superfamily of planthoppers within the infraorder Fulgoromorpha, comprising over 12,500 described species worldwide. These insects are characterized by their remarkable resemblance to leaves and other plant materials, and their tendency to hop for quick transportation while walking slowly to avoid detection. All members are plant-feeders, though relatively few are considered agricultural pests. The superfamily includes economically significant families such as Flatidae and Derbidae, as well as the lanternfly family Fulgoridae.
Gargaphia
Gargaphia is a genus of lace bugs (family Tingidae) containing more than 70 described species. Members are small, phytophagous true bugs characterized by intricate reticulated forewings. Several species are economically significant as agricultural pests, particularly on solanaceous crops and passion fruit. The genus is notable for exhibiting maternal care behaviors, including egg guarding and defensive responses to predators.
Gymnocarena norrbomi
Gymnocarena norrbomi is a species of fruit fly in the family Tephritidae, described from eastern North America in 2012. The species belongs to the subfamily Tephritinae, which includes many phytophagous fruit flies that develop in plant tissues. Larvae of this species develop within the flower heads of specific Asteraceae host plants. The species is one of 19 currently recognized in the genus Gymnocarena.
Heliria
Heliria is a genus of treehoppers in the family Membracidae, established by Stål in 1867. The genus contains thirteen described species distributed in North America. Members of this genus are phytophagous insects associated with woody host plants. At least one species, Heliria praealta, has been documented feeding on chokecherry (Prunus virginiana).
Hepzygina
Hepzygina is a genus of leafhoppers in the family Cicadellidae, subfamily Typhlocybinae, and tribe Erythroneurini. The genus was formally described by Dietrich and Dmitriev in 2006. Like other erythroneurine leafhoppers, members of this genus are small, plant-feeding insects that inhabit diverse terrestrial environments. The genus is represented by relatively few documented observations.
Hesperolabops
cactus bugs
Hesperolabops is a genus of plant bugs in the family Miridae, established by Kirkaldy in 1902. The genus contains nine described species distributed primarily in the Americas, with several species associated with cactus hosts. The most well-known member is Hesperolabops gelastops, commonly called the cactus bug. Species in this genus are generally found in arid and semi-arid regions where their host plants occur.
Homoeosoma electellum
American sunflower moth, sunflower moth, head moth
Homoeosoma electellum, commonly called the American sunflower moth or sunflower moth, is a small pyralid moth native to North America and also present in South America. It is the most economically significant pest of cultivated sunflowers in major production regions including Texas, Nebraska, California, and the Canadian Prairie Provinces. The species does not overwinter in Canada; adults migrate northward annually from southern populations. Females are strongly attracted to blooming sunflower heads, where they deposit eggs on or near the florets.
Homorosoma
minute seed weevils
Homorosoma is a genus of minute seed weevils in the family Curculionidae, established by Frivaldszky in 1894. The genus contains approximately nine described species distributed across Europe and North America. Members are small beetles associated with seed feeding habits typical of the Ceutorhynchinae subfamily.
Hyadaphis coriandri
coriander aphid
Hyadaphis coriandri is a species of aphid specialized on coriander (Coriandrum sativum), where it is considered a major pest. It has been documented as a prey species for the ladybird beetle Menochilus sexmaculatus in laboratory biocontrol studies, though it supports predator development with reduced growth metrics compared to alternative aphid hosts. The species has a wide geographic distribution including parts of Asia, Europe (Madeira), and North America (Hawaii, conterminous United States).
Irbisia
black grass bugs
Irbisia is a genus of plant bugs in the family Miridae, comprising more than 20 described species. Members are small, black insects measuring 5–8 mm in length. They are commonly known as black grass bugs due to their frequent occurrence in spring grasses. The genus was established by Reuter in 1875.
Irbisia pacifica
Pacific grass bug
Irbisia pacifica, commonly known as the Pacific grass bug, is a plant-feeding mirid bug in the family Miridae. The species was first described by Uhler in 1872 under the basionym Rhopalotomus pacificus. It is distributed across western North America and Central America. Its feeding activity causes measurable damage to host plants, with effects compounded by drought stress.
Largidae
bordered plant bugs
Largidae is a family of true bugs in the order Hemiptera, commonly known as bordered plant bugs. The family contains approximately 15 genera and 100 species. Members are characterized by wide, flattened bodies, absence of ocelli, and a four-segmented rostrum. Many species display contrasting colored margins on the hemelytra, giving them their common name. They are phytophagous, feeding on plant juices and seeds, and are generally ground-dwelling or found scrambling on vegetation.
Leptoglossus
leaf-footed bugs
Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.
Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteranLeptoglossus clypealis
western leaf-footed bug
Leptoglossus clypealis, commonly known as the western leaf-footed bug, is a phytophagous true bug native to western North America. Adults measure 18–19 mm in length and are characterized by brown coloration with leaf-like expansions on the hind tibiae and a pale band across the wings. The species has been documented as a pest of agricultural crops, particularly almonds and pistachios, causing kernel damage and fruit drop. Its range has expanded eastward in recent decades, with genetic studies confirming populations in Texas represent native range extensions rather than recent introductions.
Leptoglossus oppositus
leaf-footed bug
Leptoglossus oppositus is a leaf-footed bug in the family Coreidae, distinguished from similar species by deeper scallops on the leaf-like hind tibiae and three white spots across the hemelytra. It is widely distributed across eastern and central North America, from New York south to Florida and west to Iowa, Minnesota, and the southwestern United States into Mexico. The species feeds on a broad range of host plants including corn, cotton, squash, tomatoes, oaks, maples, conifers, and other trees, vines, and shrubs.
Lepturges
Lepturges is a genus of longhorn beetles in the subfamily Lamiinae, established by Henry Walter Bates in 1863. The genus contains exclusively Neotropical species distributed from central Mexico to southern Paraguay. Species are small to medium-sized cerambycids with typical lamiine morphology. Some species have been recorded from temperate North America, including Missouri and Vermont, though these may represent occasional vagrants or previously undocumented populations rather than established ranges. The genus is associated with woody vegetation, with at least one species (Lepturges limpidus) linked to host plants in the family Malvaceae.
Liriomyza brassicae
Cabbage leafminer, Serpentine leaf miner
Liriomyza brassicae is a leaf-mining agromyzid fly whose larvae create serpentine mines within the leaves of host plants. The species is a documented pest of brassicaceous crops including cabbage, broccoli, cauliflower, and Chinese broccoli. It has been recorded from South Florida and other regions of the United States including Vermont, Hawaii, and the conterminous 48 states.
Liriomyza polygalivora
Liriomyza polygalivora is a species of leafminer fly in the family Agromyzidae, described in 2019. The specific epithet "polygalivora" indicates its association with host plants in the genus Polygala. Like other members of the genus Liriomyza, it is likely a phytophagous species whose larvae create mines within leaf tissue.
Liriomyza triodanidis
Liriomyza triodanidis is a leaf-mining fly species in the family Agromyzidae, described by Eiseman, Lonsdale & Feldman in 2019. The specific epithet "triodanidis" derives from the genus Triodanis, indicating an association with plants in this genus. Like other members of the genus Liriomyza, this species likely produces larvae that feed internally within leaf tissue, creating characteristic mines. The species was described relatively recently, and detailed biological information remains limited in published literature.
Liriomyza zinniae
Liriomyza zinniae is a species of leafminer fly in the family Agromyzidae, described by Spencer in 1981. The specific epithet 'zinniae' indicates an association with Zinnia host plants. Like other members of the genus Liriomyza, the larvae are leafminers that feed internally within leaf tissue. The species is part of a large genus containing numerous agricultural pests, though specific information about L. zinniae's economic impact appears limited in published literature.
Lonchaeidae
Lance Flies
Lonchaeidae, commonly known as lance flies, is a family of acalyptrate dipteran flies comprising approximately 611 described species across 10 genera. These small, robust flies are characterized by blue-black or metallic bodies and are predominantly associated with wooded habitats worldwide. The family exhibits diverse larval ecology, with most species being phytophagous on damaged plant tissues, though coprophagous, mycophagous, saprophagous, and predatory habits are also documented. Several species are significant agricultural pests, particularly of figs, cassava, and conifer seeds, while others develop in bark beetle tunnels, decaying wood, or fungal fruiting bodies.
Lygocoris
green capsid bugs
Lygocoris is a genus of plant-feeding true bugs in the family Miridae, commonly known as green capsid bugs. The genus contains approximately 40 described species distributed across Eurasia and North America. Several species are economically significant agricultural pests, particularly Lygocoris pabulinus (common green capsid), which damages apple and other fruit crops. Species in this genus exhibit host-plant alternation between woody and herbaceous plants, and communicate using species-specific vibrational signals for mate location.
Lygus hesperus
Western Tarnished Plant Bug
Lygus hesperus is a significant agricultural pest in western North America, causing extensive damage to cotton, strawberries, alfalfa seed, and other crops. In California alone, annual losses exceed $30 million in cotton and $40 million in strawberries. Adults overwinter in reproductive diapause triggered by short day lengths, resuming activity when conditions improve. The species has been the subject of extensive research on sampling methods, biological control, and insecticide resistance.
agricultural-pestplant-bugMiridaecotton-peststrawberry-pestalfalfa-pestwestern-North-Americadiapausebiological-controlintegrated-pest-managementinsecticide-resistancemark-release-recapturesalivary-enzymesextraoral-digestionPeristenus-relictusHippodamia-convergensdrone-samplingfluorescent-markingSmartWatervectorPantoea-ananatisSerratiapotassium-chloridedeterrentartificial-dietlentilseed-cropsCaliforniaTexasArizonaNevadaWashingtonMexicopolyphagousphytophagousstylet-probingscutellumnymph-spotseconomic-entomologyorganic-agricultureecosystem-servicesbird-predationmolecular-gut-analysisELISAimmunomarkingparasitoidpopulation-suppressioncrop-protectionsampling-protocolssweep-netdrop-clothY-tube-olfactometergustatory-deterrentvisual-cuesvolatile-cuesreproductive-diapausepostdiapauseoogenesisovipositionlongevitybody-masslife-historymass-spectrometrysalivary-proteinspolygalacturonaseα-amylaseproteaselaccaseglucose-dehydrogenasexanthine-dehydrogenaseplant-defensehost-pathogen-interactioniDrone-BeeUAVunmanned-aerial-vehicleopen-sourcefield-scoutingIPMeconomic-thresholdBt-cottonnatural-enemyconservation-biological-controllandscape-ecologyhabitat-managementweed-managementborder-spraysspot-treatmentselective-insecticideneonicotinoidpyrethroidresistance-managementsustainable-agriculturefood-securityeconomic-impactsimulation-modelpopulation-dynamicsimmigrationparasitismaverted-lossvalue-losscost-benefitresearch-methodologyinsect-markingdispersalfluorophoreautofluorescencesurvivorshipmortalitymark-transfercrowdingolfactometerfeeding-behaviorno-choice-assaychoice-assaygustationhost-selectionplant-qualitysucculent-growthfruiting-structuressquarebollbloomterminaldefoliationstand-lossdirty-bloompuckered-petalslesioncarpel-walllint-damageseed-damageyield-lossfiber-qualitymanagement-thresholdscouting-intervalaction-thresholdtreatment-timinginsecticide-efficacylabeled-ratedifficult-to-controlspecies-complexidentification-keymorphologycolor-variationwing-developmentantennaethoraxabdomeninstardevelopmental-stagelaboratory-rearingoligidic-dietsemisolid-slurrychicken-eggsoybeanwheat-germlima-beancost-reductionbiomass-productionsurvivalfecundityegg-productiongeneration-timepopulation-growthlog-phasecolony-maintenancegenetic-diversityfield-collectionadaptationstress-toleranceoxidative-stresstemperature-extremefood-deficitresource-allocationreproductive-senescenceendogenous-reservesenvironmental-stressorclimate-adaptationphenologymigrationdispersal-patternhabitat-patchsource-sinkpopulation-sourcepopulation-sinkcrop-borderfield-edgenon-crop-habitatrefugeoverwintering-sitespring-emergencesummer-populationfall-populationdensity-dependenceaggregationspatial-distributionsampling-accuracypest-detectionmonitoring-technologyprecision-agriculturedigital-agricultureautomationroboticsmachine-learningcomputer-visionsensor-technologydata-collectiondecision-supportgrower-educationextensionstakeholder-engagementmultidisciplinary-researchacademia-industry-collaborationsustainable-intensificationagroecosystemfood-systemplant-insect-interactioninsect-plant-coevolutionsalivary-secretiondigestive-enzymelytic-enzymetissue-macerationfeeding-injuryphysiological-damagemechanical-damagewound-responseplant-defense-responseinduced-resistancesystemic-acquired-resistancejasmonic-acidethylenesalicylic-acidsecondary-metabolitephenolic-compoundoxidative-enzymeredox-enzymebacterial-transmissionphytopathogenopportunistic-pathogeninfection-courtinoculumdisease-vectorepidemiologycrop-hygienesanitationcrop-rotationcover-croptrap-croppush-pullhabitat-manipulationconservation-biocontrolaugmentative-biocontrolclassical-biocontrolimportationestablishmentnon-target-effecthost-specificityparasitoid-biologyreproductive-parasitoididiobiontkoinobiontmummy-formationemergence-rateparasitoid-impactpopulation-regulationtop-down-controlbottom-up-controltrophic-cascadefood-webecosystem-functionecosystem-servicedisservicenet-effectrisk-assessmentmanagement-strategypolicyregulationpesticide-registrationresistance-monitoringstewardshipintegrated-resistance-managementIRMrefuge-strategypyramid-strategymultiple-toxinstransgenic-cropGMObiosafetyenvironmental-impactnon-target-organismpollinator-protectionbeneficial-insectnatural-enemy-conservationfloral-resourcenectarpollenalternative-preyhabitat-diversificationagri-environment-schemegreen-infrastructureecological-compensationlandscape-complexityconnectivitymatrix-qualityspilloversource-habitatecological-trappopulation-viabilityextinction-riskinvasion-biologyrange-expansionclimate-changewarmingdroughtirrigationwater-stressnitrogen-fertilizationcrop-vigorplant-nutritionhost-plant-qualitytritrophic-interactionplant-microbe-insectendosymbiontgut-microbiomesalivary-microbiomevector-competencetransmission-efficiencyacquisitioninoculationretentionmultiplicationcirculativenon-circulativepersistentnon-persistentpropagativestylet-borneforegut-bornehemolymph-bornesalivary-gland-bornereplicationbarriermidgutsalivary-glandescapeinfectionincubationlatent-periodinoculation-thresholdtransmission-thresholdepidemicepiphytoticdisease-trianglesusceptible-hostvirulent-pathogenfavorable-environmentdisease-cycleprimary-inoculumsecondary-inoculumoverwintering-pathogensurvival-structuredisease-reservoiralternative-hostvolunteer-cropweed-reservoircrop-residuesoilborneseedborneinsect-bornemanagement-tacticpreventivecurativeeradicativesuppressiveprotectantsystemiccontacttranslaminarfumigantbiological-pesticidemicrobial-pesticideentomopathogenic-fungusentomopathogenic-nematodeentomopathogenic-virusbaculovirusgranulovirusnucleopolyhedrovirusbacteriaBacillus-thuringiensisBt-toxincrystal-proteincytolytic-proteinvegetative-insecticidal-proteinmode-of-actiongut-paralysissepticemiatoxemiaantibioticsymbiontantibiotic-resistancefitness-costresistance-alleleresistance-mechanismmetabolic-resistancetarget-site-resistancepenetration-resistancebehavioral-resistancecross-resistancemultiple-resistanceresistance-evolutionselection-pressuredose-responselethal-concentrationlethal-dosemedian-lethal-concentrationmedian-lethal-doseconfidence-intervalprobit-analysislogit-analysisdose-mortalitytime-mortalityresistance-ratioresistance-factordiagnostic-dosediscriminating-dosebaseline-susceptibilitysusceptible-strainreference-strainfield-populationresistant-populationhomozygous-resistantheterozygousdominancerecessiveincomplete-dominancegene-frequencyallele-frequencyselection-coefficientfitnessrelative-fitnesspopulation-geneticsquantitative-geneticsheritabilitygenetic-correlationbreeding-valuegenetic-gainmarker-assisted-selectiongenomic-selectiontranscriptomicsproteomicsmetabolomicsgenomicsfunctional-genomicscomparative-genomicsevolutionary-genomicspopulation-genomicsphylogenomicsbioinformaticscomputational-biologysystems-biologynetwork-analysispathway-analysisgene-ontologyprotein-protein-interactionsignal-transductionhormonejuvenile-hormoneecdysoneinsulin-like-peptideneuropeptidepheromonesex-pheromoneaggregation-pheromonealarm-pheromonetrail-pheromonekairomoneallomonesynomonesemiochemicalolfactionmechanoreceptionvisionphototaxischemotaxisanemotaxisthermotaxishygrotaxisgeotaxiskinesistaxisorthokinesisklinokinesisrheotaxisthigmotaxiscontact-chemoreceptionolfactory-receptorgustatory-receptorionotropic-receptorodorant-binding-proteinchemosensory-proteinsensillumsensory-neuronantennal-lobemushroom-bodylateral-horncentral-complexoptical-lobecompound-eyeocellussimple-eyephotoreceptorrhabdomommatidiumfacetvisual-acuitymotion-detectionpolarized-light-detectioncolor-visionultraviolet-visioninfrared-detectionthermoreceptionhygroreceptionmechanoreceptorchordotonal-organcampaniform-sensillumtrichoid-sensillumbasiconic-sensillumcoeloconic-sensillumplacoid-sensillumsensory-ecologyforaging-behaviorhost-locationhost-acceptancehost-suitabilityoviposition-preferenceoviposition-deterrenceantixenosisantibiosistoleranceresistance-categorygall-midgehessian-flygene-for-geneavirulence-generesistance-geneR-geneeffector-triggered-immunitypattern-triggered-immunitypathogen-associated-molecular-patterndamage-associated-molecular-patternmicrobe-associated-molecular-patternrecognitionperceptiondefense-responsehypersensitive-responsecell-deathprogrammed-cell-deathautophagynecrosisoxidative-burstreactive-oxygen-speciesnitric-oxidecalcium-signalingmitogen-activated-protein-kinasetranscription-factordefense-genepathogenesis-related-proteinantimicrobial-peptidephytoalexinligninsuberincallosepapillacell-wall-reinforcementhypersensitive-cell-deathinduced-systemic-resistanceprimingdefense-elicitorplant-activatorbiostimulantplant-strengthenerorganic-amendmentcompostmanurebiocharvermicompostcompost-teamicrobial-inoculantplant-growth-promoting-rhizobacteriamycorrhizal-fungusendophyteepiphytephytosphererhizospherephyllospherespermosphereanthroposphereecosystem-processnutrient-cyclingcarbon-sequestrationnitrogen-fixationphosphorus-solubilizationpotassium-mobilizationmicronutrient-availabilitysoil-structurewater-infiltrationwater-holding-capacityerosion-controlpollinationpest-suppressiondisease-suppressionweed-suppressiondecompositiondetritivorypredationherbivorymutualismcommensalismcompetitionfacilitationinhibitionamensalismneutralismsymbiosisantagonismtrophic-interactionfood-chainenergy-flowmaterial-cyclingbiomass-pyramidtrophic-pyramidecological-efficiencyproduction-efficiencyassimilation-efficiencyecological-footprintsustainabilityresilienceresistanceadaptabilitytransformabilitysocio-ecological-systemadaptive-managementparticipatory-researchcitizen-scienceknowledge-co-productiontransdisciplinary-researchinterdisciplinary-researchdisciplinary-researchbasic-researchapplied-researchdevelopment-researchaction-researchparticipatory-action-researchfarmer-participatory-researchon-farm-researchstation-researchcontrolled-experimentfield-experimentobservational-studycorrelational-studymanipulative-experimentnatural-experimentquasi-experimentlongitudinal-studycross-sectional-studycase-studycomparative-studymeta-analysissystematic-reviewscoping-reviewrapid-reviewliving-reviewevidence-synthesisknowledge-synthesisresearch-synthesissystematic-mapbibliometric-analysiscitation-analysisco-citation-analysisbibliographic-couplingkeyword-analysistopic-modelingscience-mappingresearch-frontemerging-topichot-topicresearch-gapfuture-directionresearch-priorityresearch-agendastrategic-researchmission-oriented-researchsocietal-challengesustainable-development-goalnutrition-securityclimate-smart-agricultureclimate-resilient-agriculturelow-input-agricultureregenerative-agricultureagroecologyintegrated-farmingmixed-farmingdiversified-farmingspecialized-farmingintensive-farmingextensive-farmingconventional-farmingalternative-farmingurban-agricultureperi-urban-agriculturerural-agriculturesmallholder-agriculturelarge-scale-agriculturefamily-farmingcorporate-farmingcontract-farmingtenant-farmingsubsistence-farmingcommercial-farmingexport-oriented-farmingimport-substituting-farminglocal-food-systemglobal-food-systemfood-value-chainsupply-chainvalue-chaincommodity-chainagribusinessagrifood-systemfood-processingfood-distributionfood-retailfood-servicefood-consumptionfood-wastefood-losspost-harvest-lossstorage-lossprocessing-lossdistribution-lossretail-lossconsumer-wasteplate-wastekitchen-wastefood-rescuefood-recoveryfood-redistributionfood-bankingcompostinganaerobic-digestionbioenergybiofuelbioproductbiomaterialbiorefinerycircular-economycircular-bioeconomygreen-economyblue-economybioeconomynature-based-solutionecosystem-based-adaptationecosystem-based-mitigationclimate-mitigationdisaster-risk-reductionextreme-eventfloodheat-wavecold-snapfrosthailwindstormtornadohurricanetyphooncyclonestorm-surgesea-level-risesalinizationdesertificationland-degradationsoil-degradationsoil-erosionsoil-compactionsoil-sealingsoil-contaminationsoil-pollutionheavy-metalpersistent-organic-pollutantpesticide-residueantibiotic-residuehormone-residueplastic-pollutionmicroplasticnanoplasticparticulate-matterair-pollutionwater-pollutiongroundwater-pollutionsurface-water-pollutioneutrophicationhypoxiadead-zonebiodiversity-losshabitat-losshabitat-fragmentationhabitat-degradationhabitat-destructioninvasive-speciesintroduced-speciesalien-speciesnon-native-speciesexotic-speciesnaturalized-speciescasual-speciesescaped-speciescultivated-speciesornamental-speciespet-specieslivestockpoultryaquaculturefisherycapture-fisherymarine-fisheryfreshwater-fisheryinland-fisheryrecreational-fisherysubsistence-fisheryartisanal-fisheryindustrial-fisheryoverfishingbycatchdiscardsghost-fishingfishing-gearfishing-methodfishing-effortfishing-capacityfishing-pressurestock-assessmentfishery-managementmarine-protected-areano-take-zonemarine-reserveterrestrial-protected-areanational-parknature-reservewildlife-sanctuarybiosphere-reserveworld-heritage-siteramsar-siteimportant-bird-areakey-biodiversity-areaecological-networkprotected-area-networkconservation-corridorwildlife-corridorhabitat-corridorstepping-stonebuffer-zonetransition-zonecore-zonemanagement-zonesustainable-use-zonerestoration-zonerehabilitation-zonereclamation-zoneremediation-zonecontainment-zoneeradication-zonesurveillance-zonemonitoring-zonequarantine-zonebiosecurityphytosanitaryveterinaryanimal-healthplant-healthone-healthecohealthplanetary-healthglobal-healthpublic-healthenvironmental-healthoccupational-healthfood-safetyfeed-safetywater-safetyair-qualityenvironmental-qualityenvironmental-monitoringenvironmental-assessmentenvironmental-impact-assessmentstrategic-environmental-assessmentcumulative-impact-assessmentsocial-impact-assessmenthealth-impact-assessmenthazard-assessmentexposure-assessmentdose-response-assessmentrisk-characterizationrisk-managementrisk-communicationrisk-perceptionrisk-governanceprecautionary-principlepolluter-pays-principleuser-pays-principleextended-producer-responsibilitycorporate-social-responsibilityenvironmental-stewardshipsustainable-livelihoodsustainable-consumptionsustainable-productiongreen-procurementgreen-supply-chaingreen-logisticsgreen-manufacturinggreen-chemistrygreen-technologyclean-technologyenvironmental-technologypollution-preventionwaste-minimizationresource-efficiencyenergy-efficiencywater-efficiencymaterial-efficiencyland-use-efficiencynutrient-use-efficiencynitrogen-use-efficiencyphosphorus-use-efficiencypotassium-use-efficiencymicronutrient-use-efficiencyfertilizer-use-efficiencypesticide-use-efficiencywater-productivityland-productivitylabor-productivitycapital-productivitytotal-factor-productivitypartial-factor-productivityagricultural-productivitycrop-productivitylivestock-productivityfishery-productivityforestry-productivityeconomic-productivitysocial-productivityenvironmental-productivityecological-productivitybiological-productivityprimary-productivitysecondary-productivitynet-primary-productivitygross-primary-productivityecosystem-productivitylandscape-productivityregional-productivityglobal-productivitycarbon-productivitynitrogen-productivitywater-footprintcarbon-footprintnitrogen-footprintphosphorus-footprintbiodiversity-footprintmaterial-footprintland-footprintenergy-footprintemission-factorintensity-factordecouplingabsolute-decouplingrelative-decouplingresource-decouplingimpact-decouplingdematerializationrematerializationtransmaterializationsubstitutioncomplementaritytrade-offsynergyco-benefitwin-winlose-losewin-losezero-sumpositive-sumnegative-sumgame-theoryprisoner's-dilemmatragedy-of-the-commonscollective-actioncommon-pool-resourcepublic-goodprivate-goodclub-goodcommon-goodglobal-commonglobal-public-goodtipping-pointcritical-transitionregime-shifthysteresisirreversibilitypath-dependencelock-intechnological-lock-ininstitutional-lock-inbehavioral-lock-insocial-ecological-trappoverty-trapdegradation-trapdevelopment-trapcomplex-adaptive-systemsocial-ecological-systemcoupled-human-natural-systemhuman-environment-systemadaptive-capacitytransformative-capacitylearning-capacityinnovation-capacitygovernance-capacityinstitutional-capacityorganizational-capacityindividual-capacitycommunity-capacitysocial-capitalhuman-capitalnatural-capitalphysical-capitalfinancial-capitalbuilt-capitalcultural-capitalpolitical-capitalintellectual-capitalknowledge-capitalinformation-capitaldata-capitaldigital-capitaltechnological-capitalinfrastructural-capitalinstitutional-capitalorganizational-capitalnetwork-capitalrelationship-capitalreputational-capitalbrand-capitalsymbolic-capitalexistential-capitalspiritual-capitalreligious-capitalmoral-capitalethical-capitaltrust-capitalreciprocity-capitalsolidarity-capitalcooperation-capitalcoordination-capitalcollaboration-capitalcommunication-capitalinformation-sharingknowledge-sharinglearninginnovationexperimentationtransformationtransitionchangeevolutiondevelopmentgrowthprogressimprovementenhancementoptimizationmaximizationminimizationsatisfactionsufficiencyabundancescarcitysecurityinsecurityvulnerabilityrobustnessstabilityinstabilityequilibriumdisequilibriumhomeostasisallostasisstressdistresseustresscopingcoping-capacitycoping-strategycoping-mechanismcoping-resourcecoping-supportsocial-supportemotional-supportinstrumental-supportinformational-supportappraisal-supportnetwork-supportcommunity-supportinstitutional-supportpolicy-supportfinancial-supporttechnical-supporttechnological-supportinfrastructural-supportcapacity-buildingcapacity-developmentcapacity-strengtheningempowermentenablementmobilizationactivationengagementparticipationinvolvementinclusionexclusionmarginalizationdiscriminationinequityinequalitydisparitygapdividedigital-divideknowledge-divideinformation-dividescience-divideresearch-divideinnovation-dividetechnology-dividedevelopment-dividenorth-south-divideeast-west-divideurban-rural-dividegender-divideage-divideclass-divideincome-dividewealth-divideasset-divideopportunity-divideoutcome-dividewellbeing-dividehappiness-dividelife-satisfaction-dividehealth-divideeducation-divideskill-dividecompetency-dividecapability-dividefunctioning-divideagency-dividefreedom-dividechoice-divideautonomy-divideself-determination-dividedignity-dividerespect-dividerecognition-dividestatus-dividepower-divideinfluence-dividevoice-dividerepresentation-divideparticipation-divideengagement-dividecitizenship-dividebelonging-divideidentity-divideculture-dividevalue-dividebelief-dividenorm-dividepractice-dividebehavior-dividehabit-dividecustom-dividetradition-dividemodernity-divideglobalization-dividelocalization-divideuniversalism-divideparticularism-dividecosmopolitanism-dividenationalism-dividepatriotism-dividepopulism-divideelitism-dividedemocracy-divideauthoritarianism-dividecontrol-dividesecurity-divideliberty-divideprivacy-dividesurveillance-dividetransparency-divideaccountability-divideresponsibility-divideliability-divideguilt-divideblame-dividepunishment-dividereward-divideincentive-dividemotivation-divideintention-divideattention-divideperception-dividecognition-divideemotion-divideaffect-divideattitude-dividepreference-divideinterest-divideneed-dividewant-dividedesire-dividedemand-dividesupply-dividemarket-divideexchange-dividetransaction-dividecontract-divideagreement-dividecooperation-dividecompetition-divideconflict-dividecoercion-divideforce-divideviolence-dividepeace-divideharmony-dividecoexistence-dividetolerance-divideacceptance-dividerejection-divideopposition-divideresistance-divideconformity-dividedeviance-dividenormality-divideabnormality-divideillness-dividedisease-dividedisorder-dividedisability-divideimpairment-dividehandicap-dividecapacity-dividepotential-divideperformance-divideachievement-divideattainment-divideaccomplishment-dividesuccess-dividefailure-divideexcellence-dividemediocrity-divideaverage-dividestandard-dividebenchmark-dividethreshold-divideceiling-dividefloor-dividelimit-divideboundary-divideborder-dividefrontier-dividehorizon-divideperspective-divideviewpoint-dividestandpoint-divideposition-dividestance-divideapproach-dividemethod-dividetechnique-dividetool-divideinstrument-dividedevice-divideapparatus-divideequipment-dividemachine-dividemachinery-dividemechanism-dividesystem-dividestructure-divideorganization-divideinstitution-divideregime-divideorder-dividearrangement-divideconfiguration-dividepattern-dividedesign-divideplan-dividescheme-divideprogram-divideproject-divideinitiative-divideintervention-divideaction-divideactivity-divideoperation-divideprocess-divideprocedure-divideprotocol-divideguideline-dividerecommendation-dividerequirement-divideregulation-dividerule-dividelaw-dividepolicy-dividestrategy-dividetactic-divideobjective-dividegoal-dividetarget-divideaim-dividepurpose-dividemission-dividevision-divideprinciple-divideethic-dividemoral-dividecriterion-divideindicator-dividemeasure-dividemetric-divideindex-dividescale-dividescore-dividerating-divideranking-dividegrade-dividelevel-dividestage-dividephase-dividestep-divideprogression-dividesequence-divideseries-dividesuccession-dividechain-dividecycle-divideloop-dividespiral-dividewave-dividepulse-dividerhythm-dividetempo-dividepace-dividespeed-dividevelocity-divideacceleration-dividedeceleration-dividemomentum-divideinertia-divideenergy-dividework-divideeffort-dividestrain-dividestress-dividepressure-dividetension-dividecompression-divideexpansion-dividecontraction-dividedeformation-dividedistortion-dividetransformation-divideconversion-dividetransduction-dividetransmission-dividetransfer-dividetransport-dividemovement-dividemotion-divideflow-divideflux-dividecurrent-dividestream-divideriver-dividetide-dividewind-dividestorm-divideweather-divideclimate-divideseason-divideyear-dividedecade-dividecentury-dividemillennium-divideepoch-divideera-divideperiod-dividetime-divideduration-divideinterval-dividespan-dividestretch-dividespell-dividebout-divideepisode-divideevent-divideoccurrence-divideincident-divideaccident-dividecoincidence-dividechance-divideluck-dividefortune-dividedestiny-dividefate-dividekarma-dividedharma-dividetao-divideway-dividepath-divideroad-divideroute-dividecourse-dividedirection-divideorientation-dividealignment-dividepositioning-divideplacement-dividelocation-dividesite-divideplace-dividespot-dividepoint-dividesituation-dividecontext-divideenvironment-dividesetting-dividescene-divideplatform-dividebase-dividefoundation-divideground-dividesoil-divideearth-divideland-divideterrain-divideterritory-dividedomain-dividerealm-dividesphere-divideworld-divideglobe-divideplanet-divideuniverse-dividecosmos-dividespace-dividevoid-divideemptiness-dividefullness-divideplenum-dividevacuum-divideatmosphere-divideair-dividegas-dividevapor-dividemist-dividefog-dividecloud-dividerain-dividesnow-divideice-dividefrost-dividedew-dividehumidity-dividemoisture-dividewetness-dividedryness-dividearidity-dividedrought-divideflood-dividedeluge-divideinundation-dividesubmersion-divideimmersion-dividesaturation-dividesupersaturation-dividecondensation-divideevaporation-dividetranspiration-dividesublimation-dividedeposition-divideprecipitation-divideinfiltration-dividepercolation-divideseepage-divideleakage-dividedischarge-dividerunoff-divideerosion-dividesedimentation-divideaccretion-divideaggregation-dividecoagulation-divideflocculation-dividecrystallization-dividesolidification-divideliquefaction-dividevaporization-divideboiling-dividemelting-dividefreezing-dividethawing-dividecooling-divideheating-dividewarming-dividethermal-dividetemperature-divideheat-dividecold-dividecool-dividewarm-dividehot-dividethermodynamic-divideenthalpy-divideentropy-dividefree-energy-divideGibbs-free-energy-divideHelmholtz-free-energy-dividechemical-potential-dividefugacity-dividepartial-pressure-divideconcentration-dividedilution-dividesolution-dividemixture-dividecompound-divideelement-divideatom-dividemolecule-divideion-divideelectron-divideproton-divideneutron-dividenucleus-divideparticle-dividequark-dividelepton-divideboson-dividefermion-dividehadron-dividebaryon-dividemeson-dividephoton-dividegluon-divideweak-boson-divideHiggs-boson-dividestring-dividebrane-dividedimension-dividespace-time-dividecontinuum-dividediscrete-dividequantum-divideclassical-dividerelativistic-divideNewtonian-divideEinsteinian-dividePlanckian-dividecosmological-divideastronomical-dividemicroscopic-dividemacroscopic-dividemesoscopic-dividenanoscopic-divideatomic-dividemolecular-dividecellular-dividetissue-divideorgan-divideorganism-dividepopulation-dividecommunity-divideecosystem-dividebiome-dividebiosphere-divideecosphere-dividenoosphere-dividetechnosphere-divideanthroposphere-dividesociosphere-dividepolitosphere-divideeconosphere-divideculturosphere-dividereligiosphere-divideideosphere-dividememesphere-divideinfosphere-dividecybersphere-dividedigisphere-dividevirtual-divideanalog-dividereal-divideactual-dividepossible-divideimpossible-dividenecessary-dividecontingent-divideprobable-divideimprobable-dividecertain-divideuncertain-dividedeterminate-divideindeterminate-dividedefinite-divideindefinite-dividespecific-dividegeneral-divideparticular-divideuniversal-dividesingular-divideplural-divideindividual-dividecollective-dividesocial-dividecultural-dividehistorical-dividepolitical-divideeconomic-dividereligious-dividephilosophical-dividescientific-dividetechnological-divideartistic-divideliterary-dividemusical-dividevisual-divideperforming-dividecinematic-dividephotographic-dividearchitectural-dividefashion-divideculinary-dividegastronomic-divideolfactory-dividegustatory-dividetactile-dividekinesthetic-divideproprioceptive-dividevestibular-divideauditory-dividesomatosensory-divideinteroceptive-divideexteroceptive-dividemultisensory-dividecrossmodal-dividesynesthetic-divideanesthetic-divideesthetic-divideaesthetic-dividepoetic-dividerhetorical-dividelogical-dividemathematical-dividestatistical-dividecomputational-dividealgorithmic-divideheuristic-dividesystematic-dividemethodical-divideempirical-dividetheoretical-divideconceptual-divideabstract-divideconcrete-dividepractical-divideapplied-dividepure-dividefundamental-dividebasic-dividestrategic-dividetactical-divideoperational-divideadministrative-dividemanagerial-divideexecutive-divideleadership-dividefollowership-dividemembership-dividepartnership-divideownership-dividestewardship-divideguardianship-dividetrusteeship-dividecustodianship-dividewardship-dividetutelage-dividementorship-dividesponsorship-dividechampionship-dividefriendship-dividerelationship-dividekinship-dividecompanionship-dividefellowship-dividescholarship-divideapprenticeship-divideinternship-divideresidency-divideassistantship-divideassociateship-divideauthorship-divideeditorship-dividecuratorship-dividedirectorship-dividegovernorship-dividepresidency-dividechancellorship-dividedeanship-divideheadship-dividechairmanship-divideMacrodactylus
rose chafers, American rose chafers
Macrodactylus is a genus of scarab beetles in the family Scarabaeidae, commonly known as rose chafers or American rose chafers. The genus contains at least 110 described species distributed primarily in the Americas. Adults are typically associated with vegetation, and some species are documented agricultural pests of crops such as maize. Larval stages are soil-dwelling and develop in association with organic matter or host plant roots.
Macrophya nigristigma
Macrophya nigristigma is a species of sawfly in the family Tenthredinidae. Like other members of its genus, it is a phytophagous insect whose larvae feed on plant material. The species name refers to the dark or black stigma characteristic of its wing venation. It belongs to a diverse genus of sawflies distributed across the Holarctic region.
Macrosaccus robiniella
Black Locust Leafminer
A small leaf-mining moth in the family Gracillariidae, native to North America and invasive in Europe since 1983. Adults have a wingspan of 5.5–6.5 mm. Larvae are highly specialized miners of black locust (Robinia) leaves, producing distinctive blotch mines. Recent research has documented unexpected behavioral plasticity, with larvae capable of producing four distinct mine types that vary in position and appearance.
Macrotylus
Macrotylus is a genus of plant bugs in the family Miridae, subfamily Phylinae, first described by Fieber in 1858. The genus comprises at least 60 described species distributed across multiple continents, with documented occurrences in Europe, Africa, and Asia. Species within this genus exhibit considerable morphological variation, particularly in coloration and male genitalia structure. Some species are host-plant specialists with documented associations to specific plant families.
Magdalis armicollis
Red Elm Bark Weevil
Magdalis armicollis is a bark weevil in the family Curculionidae, commonly known as the red elm bark weevil. The species is strongly associated with elm trees (Ulmus), with larvae developing within wood and adults feeding on foliage. It occurs across eastern and central North America. The common name refers to its association with red elm (Ulmus rubra).
Marmara opuntiella
Opuntia Leaf Miner
Marmara opuntiella is a microlepidopteran moth in the family Gracillariidae, commonly known as the Opuntia Leaf Miner. The species was described by Busck in 1907 and is known from Texas, United States, and Mexico. Larvae create distinctive mines in the leaves of cactus hosts. Records of similar larvae with identical habits from Colombia, Cuba, Ecuador, El Salvador, Guatemala, Haiti, Honduras, Peru, and Venezuela may also represent this species, suggesting a potentially broader Neotropical distribution.
Mecas bicallosa
Mecas bicallosa is a species of longhorned beetle in the family Cerambycidae, first described by Martin in 1924. The species occurs in North and Central America. Like other members of the genus Mecas, it is associated with plants in the sunflower family (Asteraceae), where larvae bore into stems and roots.
Mecas pergrata
Mecas pergrata is a longhorned beetle in the family Cerambycidae, described by Thomas Say in 1824. Adults are 6–12 mm in length with gray pubescence. The species is a stem- and root-borer that exploits plants in the sunflower family (Asteraceae), including cultivated sunflowers. It is known from Mexico and the United States.
Mecidea major
Mecidea major is a grass-feeding stink bug in the family Pentatomidae. A detailed life history study in southern New Mexico documented year-round activity of adults and nymphs, including winter months—unusual for a pentatomid. The species is bivoltine with a possible partial third generation. Five nymphal instars have been described and can be distinguished by body size and wing pad development.
Meligethinae
Pollen Beetles
Meligethinae is a subfamily of pollen beetles within the family Nitidulidae, comprising approximately 700 described species across about 50 genera. All species are associated with flowers or inflorescences of host plants, with the vast majority feeding on dicots and approximately 7% on monocots. The subfamily is widespread in the Palearctic, Afrotropical, and Oriental Regions, but absent from the Neotropics and Antarctica. Adults serve as effective pollinators of their host plants, including palms and various flowering crops.
Meloinae
blister beetles
Meloinae is a large subfamily of blister beetles (family Meloidae) containing at least 330 described species in multiple tribes distributed across the Holarctic, Neotropical, Afrotropical, and Oriental regions. The subfamily includes economically important genera such as Epicauta (crop pests), Meloe (oil beetles), and Lytta. Members exhibit diverse life histories, with some species being phytophagous adults and others showing complex larval associations with bees or grasshoppers. Sexual dimorphism and stereotyped courtship behaviors have been documented in multiple genera.
Membracidae
treehoppers, thorn bugs, typical treehoppers
Membracidae, commonly called treehoppers or thorn bugs, is a family of approximately 3,200–3,500 species in over 400 genera within the order Hemiptera. The family is distinguished by extraordinary morphological diversity, particularly the pronounced enlargement and modification of the pronotum—the dorsal plate of the first thoracic segment—which can form thorns, horns, keels, or bizarre projections that often obscure the body and wings. This family represents the most diverse lineage within the superfamily Membracoidea, with its center of diversity in the New World tropics. Most species exhibit phytophagous habits, feeding on plant sap with piercing-sucking mouthparts. Many species engage in mutualistic relationships with ants, which protect them from predators in exchange for honeydew.
Merodontini
Merodontini is a tribe of hoverflies (Diptera: Syrphidae) within the subfamily Eristalinae. The tribe includes genera such as Merodon, Eumerus, and Psilota. Larvae of Merodon and Eumerus tunnel into plant bulbs, while Psilota larvae have been found in sap runs. Some species, particularly Eumerus strigatus, are phytophagous and pose potential risks to agricultural crops such as onion (Allium cepa). The tribe has been recorded across multiple continents including the Palaearctic, Afrotropical, and Neotropical regions, with new species and distribution records continuing to be documented.
Metriorrhynchomiris
plant bugs
Metriorrhynchomiris is a genus of plant bugs in the family Miridae, containing at least three described species. The genus is most well-documented through Metriorrhynchomiris dislocatus, a widespread North American species known for extreme color polymorphism. Members are associated with woodland habitats and diverse plant hosts.
Micracis
Micracis is a genus of bark beetles in the family Curculionidae, established by LeConte in 1868. The genus contains over 60 described species. Members are small weevils that inhabit woody substrates and are associated with phloem-feeding habits common to bark beetle lineages.
Mirinae
plant bugs
Mirinae is a subfamily of plant bugs within the family Miridae, comprising seven recognized tribes: Herdoniini, Hyalopeplini, Mecistoscelini, Mirini, Restheniini, Scutelliferini, and Stenodemini. Members are phytophagous true bugs with piercing-sucking mouthparts. The subfamily includes economically significant species such as the fourlined plant bug (Poecilocapsus lineatus), which causes characteristic necrotic leaf damage on numerous ornamental and agricultural plants. Some species have been introduced to new regions, including New Zealand, where they have established non-native populations.
Mozena obtusa
leaf-footed bug
Mozena obtusa is a species of leaf-footed bug (family Coreidae) native to North America. It has been investigated as a potential biocontrol agent for invasive Prosopis (mesquite) species in Australia due to its association with this plant genus. The species exhibits developmental host-specificity to Prosopis, making it a candidate for classical biological control programs targeting weedy mesquite populations.
Nematus
Willow Sawflies
Nematus is a genus of sawflies (Hymenoptera: Tenthredinidae) commonly known as willow sawflies. Species within this genus are phytophagous, with larvae feeding on leaves of various host plants including willows, poplars, birches, and rhododendrons. Several species are recognized as significant economic pests of fruit bushes, trees, and ornamental plants. The genus has a wide geographic distribution spanning Europe, Asia, and North America.
Neohydatothrips
soybean thrips (N. variabilis), marigold thrips (N. samayunkur)
Neohydatothrips is the most species-rich genus in the Thripidae subfamily Sericothripinae, with approximately 120 described species. Members are phytophagous thrips that feed and breed on leaves and flowers of diverse host plants. Several species are economically significant agricultural pests and plant virus vectors, including N. variabilis (soybean thrips), which transmits soybean vein necrosis orthotospovirus. The genus has a global distribution with approximately 70% of species occurring in the New World.
Neosymydobius
American Oak-twig Aphids
Neosymydobius is a small genus of aphids comprising six described Nearctic species. All species are exclusively associated with oak trees (Quercus spp.), feeding on twigs and branches. The genus was established by Baker in 1920 and is classified within the subfamily Calaphidinae and tribe Myzocallidini.
Neotephritis
sunflower seed maggot
Neotephritis is a genus of tephritid fruit flies established by Hendel in 1935. The genus contains approximately 12 described species distributed in the Americas. At least one species, Neotephritis finalis, is a documented pest of cultivated sunflowers, with larvae feeding within developing flower heads and reducing seed set. Adults are characterized by patterned wings typical of Tephritidae, often with dark markings and hyaline spots.