Tribe
Guides
Hypotiini
The Hypotiini are a tribe of snout moths within the family Pyralidae, established by Thomas Algernon Chapman in 1902. The tribe contains at least two recognized genera: Hypotia and Arsenaria. These moths are part of the diverse Pyralidae family, commonly known as snout moths due to the elongated labial palps that project forward from the head. The tribe has been documented in over 940 iNaturalist observations, indicating moderate representation in citizen science records.
Iceliini
Iceliini is a tribe of tachinid flies comprising three genera: Erviopsis, Icelia, and Iceliopsis. These flies are parasitoids, with larvae developing inside other insects. The tribe is placed in the subfamily Tachininae and is distinguished by specific morphological features of the male terminalia.
Lachnini
Lachnini is a tribe within the aphid subfamily Lachninae, comprising relatively large-bodied aphids. Members feed on green and woody tissues of both coniferous and deciduous plants, with documented associations including Rosaceae, Salicaceae (Salix), and potentially Prunus. The tribe exhibits complex life cycles with high polymorphism and environmental plasticity. Lachnini is one of five recognized tribes in Lachninae and has been subject to recent phylogenetic revision alongside related groups Tuberolachnini and Tramini.
Lemini
shining leaf beetles
Lemini is a tribe of leaf beetles within the subfamily Criocerinae, characterized by their often metallic or shiny appearance. Members are placed in the family Chrysomelidae, a large group of herbivorous beetles commonly known as leaf beetles. The tribe was established by Gyllenhal in 1813 and contains multiple genera distributed across various regions.
Limenitidini
Limenitidini is a tribe of brush-footed butterflies within the subfamily Limenitidinae. The tribe comprises approximately 20 genera distributed primarily in tropical and temperate regions of the Old World and Neotropics. Notable genera include Adelpha (sisters), Limenitis (admirals), Cymothoe (gliders), and Athyma (sergeants). The subtribal classification of Limenitidini has been subject to revision based on cladistic analyses.
Limnichini
Limnichini is a tribe of minute marsh-loving beetles within the family Limnichidae. Members are small, compact beetles associated with moist or riparian habitats. The tribe is distinguished from the other limnichid tribe, Paralimnichini, by specific morphological features of the adult beetles. These beetles are poorly studied and many aspects of their biology remain undocumented.
Loricerini
Loricerini is a tribe of ground beetles in the family Carabidae, belonging to the subfamily Loricerinae. Members of this tribe are characterized by their distinctive body form and are found in specific habitat types. The tribe contains the genus *Loricera*, which includes species adapted to particular ecological niches. These beetles are part of the diverse ground beetle fauna and contribute to soil and litter ecosystem processes.
Mannophorus forreri
Mannophorus forreri is a longhorn beetle in the family Cerambycidae, described by Henry Walter Bates in 1885. It belongs to the tribe Trachyderini, a group known for often brightly colored and patterned species. The species is rarely encountered in collections and appears to have a restricted distribution in the southwestern United States and Mexico. Field observations indicate adults are active in early autumn and visit flowers of yellow composites in mountainous areas of Arizona.
CerambycidaeTrachyderinilonghorn-beetleArizonaMexicoflower-visitorrare-speciesHenry-Walter-Bates1885orange-and-black-colorationGutierreziaHeterothecaThelespermaKitt-Peakautumn-activediurnalpollinatorMadrean-sky-islandsmontanexerophilicColeopterabeetleinsectarthropodCerambycinaeMannophorusforreriBates-1885GBIFiNaturalistCatalogue-of-LifeWikipediafield-observationcomposite-flowersAsteraceaesouthwestern-United-StatesNorth-AmericaMiddle-Americararely-collecteduncommonly-encounteredattractive-colorationcoleopterist-interestflower-feedingnectar-feedingpollen-feedinglarval-host-unknownwood-boringdiurnal-activitySeptemberearly-autumnlower-mountain-slopesrocky-habitatdry-habitatmountainoussubmontanesky-islandMadreanpollinationtrachyderinelong-antennaesexual-dimorphismantennae-lengthorangeblackelytral-apexpronotal-spotscylindrical-bodyrobustmedium-sizedquick-to-escapewaryspiral-flightfield-collectioniReportTed-MacRaeJeff-Huether2019Arizona-collectingKitt-Peak-RoadGutierrezia-microcephalaHeterotheca-fulcratayellow-compositesflower-patchesroadsidesslopesobservationspecimenvouchermuseum-collectionscientific-nameauthorshiptaxonspeciesgenusfamilyorderclassphylumkingdomanimallonghorncerambycidtaxonomyclassificationaccepted-namesynonymdistributionrangegeographic-rangepresenceoccurrencerecordiNaturalist-observationGBIF-recordspecimen-recordliterature-recordfield-recordcollecting-tripentomologyentomologistcoleopteristamateur-entomologistprofessional-entomologistbeetle-collectorinsect-collectornaturalistfield-naturalistbiologistecologistpollination-biologistconservationbiodiversitydata-deficientpoorly-knownundercollectedunderstudiedresearch-neededlarval-biology-unknownhost-plant-unknownlife-history-unknownseasonality-poorly-knowndistribution-incompletely-knownhabitat-specificity-unknownpopulation-status-unknownconservation-status-unevaluatedIUCNnot-evaluatedleast-concerntaxonomic-stabilityvalid-nameoriginal-descriptiontype-specimentype-localitytype-speciesgenus-typetribesubfamilysuperfamilyinfraordersuborderpolyphagacucujiformiachrysomeloideatrachyderinamannophorus-forreribatesspecies-descriptiontaxonomic-descriptionnomenclaturebinomialbinomial-nomenclaturescientific-nomenclaturezoological-nomenclatureICZNInternational-Commission-on-Zoological-Nomenclaturecodezoological-codenamelatin-namebinomial-namespecific-epithetgeneric-nameauthorauthoritydateyearoriginal-combinationcurrent-combinationvalid-combinationaccepted-combinationtaxonomic-statusnomenclatural-statusavailabilityvaliditypriorityhomonymsynonymyjunior-synonymsenior-synonymobjective-synonymsubjective-synonymreplacement-namenomen-novumnomen-conservandumnomen-oblitumforgotten-nameunused-namerarely-used-nameobscure-namewell-known-namefamous-nameiconic-speciesattractive-speciesbeautiful-speciesornamental-speciescollector's-itemdesirable-speciessought-after-speciestarget-speciesgoal-speciestrip-targetcollecting-objectivefield-goalconsolation-prizeadequate-consolationgreat-findsuccesslucky-findchance-encounterunexpected-findsurprise-discoveryserendipityfortuitousfortunateluckygood-fortunegood-luckrewardpayoffsatisfactionachievementaccomplishmentfield-successcollecting-successentomological-successbeetle-successcerambycid-successtrip-highlightfield-trip-highlightcollecting-trip-highlightmemorable-findunforgettable-experiencefield-memorycollecting-memoryentomological-memoryshared-experiencecollecting-partnerfield-companionjoint-collectingcollaborative-collectingteam-collectingfriendshipcamaraderieentomological-communitycollector-communityamateur-communityprofessional-communitynetworkconnectionrelationshippartnershipsixth-joint-outing2012-2019seven-yearslong-term-collaborationrepeated-collaborationtrusted-partnerreliable-partnerexperienced-collectorknowledgeable-collectorexpert-collectorskilled-collectortalented-collectordedicated-collectorpassionate-collectorenthusiastic-collectorcommitted-collectorserious-collectoractive-collectorproductive-collectorsuccessful-collectoraccomplished-collectorrespected-collectorrecognized-collectorknown-collectorfamous-collectornoted-collectorpublished-collectordocumented-collectorrecorded-collectorcited-collectorreferenced-collectoracknowledged-collectorappreciated-collectorvalued-collectortreasured-collectorcelebrated-collectorhonored-collectoreminent-collectordistinguished-collectorrenowned-collectorillustrious-collectorprestigious-collectoracclaimed-collectorcelebratedfamouswell-knownrespectedesteemedhonoreddistinguishedeminentrenownedillustriousprestigiousacclaimednotedrecognizedacknowledgedappreciatedvaluedtreasuredpublisheddocumentedrecordedcitedreferencedmentionedfeaturedhighlightedshowcaseddisplayedexhibitedpresentedsharedcommunicatedreporteddescribednarratedrecountedrelatedtoldwrittenauthoredcomposedcreatedproducedgeneratedmadecraftedprepareddevelopedassembledcompiledcollectedgatheredaccumulatedamassedacquiredobtainedsecuredcapturedtakensampledspecimensseriesindividualsexamplesinstancescasesoccurrencessightingsobservationsrecordsdocumentationsevidencesproofsconfirmationsverificationsvalidationssubstantiationscorroborationsattestationstestimonieswitnessesaccountsreportsdescriptionsnarrativesstoriestaleschronicleshistoriesannalsarchivesrepositoriescollectionsassemblagesaggregationsaccumulationsmassesquantitiesnumbersamountsvolumesmeasuresdegreeslevelsextentsscopesrangesspansstretchesreachesspreadsdistributionsdispersionsscatteringssprinklingsdottingsspecklingsstipplingsfleckingsmottlingsmarblingsstreakingsstripingsbandingsringingszoningsgradingsshadingstintingstingstingestingeingscoloringscolouringshuestonesshadestintscastsflavorsflavourscharactersnaturesqualitiespropertiesattributesfeaturestraitscharacteristicsaspectsfacetsdimensionselementscomponentsconstituentsingredientspartspiecessectionssegmentsdivisionsportionsfractionsfragmentsbitsscrapsremnantsremainsresiduesleftoversvestigestracestracksmarkssignsindicationstokenssymbolsemblemsbadgesinsigniassealsstampsimprintsimpressionsprintsimpressesdepressionsindentationsimpressurespressurescompressionscondensationsconcentrationsdensificationsintensificationsstrengtheningsfortifyingsreinforcementssupportsbackingsfoundationsbasesgroundssubstratesunderpinningscornerstoneskeystonescapstonespinnaclespeakssummitstopscrownscrestsridgeschainssequencessuccessionsprogressionscontinuumsspectrumsscalesgaugesmetersmetricsstandardsbenchmarksyardstickstouchstonescriterionscriteriaindicatorsindexesindicessignalsmarkerspointersguidesdirectorsleaderschiefsheadsprincipalsmainprimaryprimefirstforemostleadingpremierchiefheadprincipalcentralkeycriticalcrucialvitalessentialnecessaryneededrequiredrequisiteindispensablemandatoryobligatorycompulsoryforcedcoercedconstrainedobligedboundcommitteddedicateddevotedloyalfaithfultruetrustworthyreliabledependableresponsibleaccountableanswerableliablesubjectopenexposedvulnerablesusceptiblepronelikelyaptinclineddisposedpredisposedtendingleaningvergingborderingnearingapproachingcomingadvancingprogressingmovinggoingtravelingjourneyingvoyagingsailingflyingdrivingridingwalkinghikingtrekkingmarchingtrampingtrudgingploddingsloggingtoilinglaboringworkingoperatingfunctioningrunningperformingexecutingimplementingenactingeffectingbringing-aboutcausingmakingcreatingproducinggeneratingyieldinggivingprovidingsupplyingfurnishingdeliveringpresentingofferingextendingprofferingtenderingsubmittingproposingsuggestingrecommendingadvisingcounselingguidingdirectingsteeringpilotingnavigatingconductingescortingshepherdingherdingurgingspurringgoadingpromptingmotivatingstimulatinginspiringencouragingsupportingbackinghelpingassistingaidingabettingfacilitatingeasingsmoothingsimplifyingclarifyingexplaininginterpretingtranslatingrenderingconvertingtransformingchangingalteringmodifyingadjustingadaptingfittingsuitingmatchingcorrespondingagreeingaccordharmonyconcordconsensusunanimityunitysolidaritycohesioncoherenceconsistencyconsonancecongruencecongruitycompatibilityagreementaccordanceconformitycomplianceobservanceadherenceattachmentdevotiondedicationcommitmentloyaltyfidelityfaithfulnessconstancysteadfastnessstaunchnessresolutenessdeterminationresolvedecisionconclusionjudgmentverdictfindingrulingdecreecommanddirectiveinstructiondirectionguidanceleadershipmanagementadministrationgovernancegovernmentrulecontroldominationdominionpowermightstrengthforcevigorenergyvitalitylifeanimationspiritsoulmindintellectintelligencewisdomknowledgeunderstandingcomprehensiongraspapprehensionperceptionawarenessconsciousnesscognizancerecognitionrealizationappreciationsensitivityresponsivenessreactivityactivitylivelinessvividnessintensitysharpnesskeennessacuityacutenessclearnessdistinctnessplainnessobviousnessevidencemanifestnesspatencytransparencyclarityluciditypelluciditylimpiditypuritycleanlinesscleannessspotlessnessimmaculatenessflawlessnessperfectionexcellencesuperioritysupremacypreeminenceeminencedistinctionnotemarksignindicationproofdemonstrationshowdisplayexhibitionpresentationmanifestationexpressionutterancestatementdeclarationannouncementproclamationpronouncementassertionclaimcontentionallegationaccusationchargeindictmentimputationattributionascriptionassignmentallocationallotmentapportionmentdispensationdivisionpartitionsharingparticipationinvolvementengagementfondnesslikingloveaffectiontendernesswarmthfervorardorpassionzealenthusiasmeagernessardencyvehemencedynamismpotencyefficacyeffectivenessefficiencycompetencecapabilitycapacityabilityaptitudetalentgiftskillexpertiseproficiencymasteryascendancypredominancepreponderanceadvantageedgeleadhead-startforefrontvanvanguardavant-gardefrontierborderboundarylimitrimbrinkvergethresholddoorstepprecipicecliffsteepabruptsuddenunexpectedsurprisingastonishingamazingastoundingstunningshockingstartlingjarringjoltingrockingshakingdisturbingupsettingdisquietingunsettlingtroublingworryingconcerningalarmingfrighteningscaringterrifyinghorrifyingappallingdreadfulterribleawfulhorriblehideousghastlygruesomegrislymacabremorbidmorbiditydiseaseillnesssicknessailmentmaladydisorderconditionstatesituationcircumstancecontextenvironmentsettingscenebackgroundbackdropframeworkstructureorganizationarrangementsystemschemeplandesignpatternmodeltemplateprototypearchetypeoriginalinitialprimitiveearlyancientoldagedelderlyseniormaturegrownadvancedprogressedevolvedderiveddescendedoriginatedbegunstartedcommencedinitiatedlaunchedopenedinauguratedinstitutedestablishedfoundedset-upformedshapedfashionedmoldedcastforgedwroughtbuiltconstructedput-togethererectedraisedelevatedliftedhoistedheavedhauleddraggeddrawnpulledtuggedyankedjerkedsnatchedgrabbedseizedcaughttrappedsnarednettedhookedbaggedlandedgotgainedwonearnedachievedattainedreachedarrivedcomeappearedemergedmaterializedmanifestedshowedofferedgivengrantedbestowedconferredawardedgifteddonatedcontributeddividedsplitseparatedparteddetacheddisconnecteddisjoineddisuniteddivorcedalienatedestrangedisolatedsegregatedsequesteredsecludedwithdrawnretiredremovedtaken-awaycarried-offborne-awaytransportedconveyedtransferredtransmittedimpartedexpressedarticulatedverbalizedvocalizedvoicedspokensaiddepictedportrayedrepresentedillustrateddemonstratedshownrevealeddiscloseduncoveredunmaskedunveiledunfoldedspreadextendedstretchedspannedbridgedcrossedtraversedpassedgone-byelapsedexpiredlapsedendedfinishedcompletedconcludedterminatedclosedshutsealedlockedfastenedmade-safeprotectedguardeddefendedshieldedscreenedshelteredharboredhousedaccommodatedlodgedquarteredbilletedstationedpostedplacedpositionedlocatedsituatedsettledinstalledemplaceddepositedlaidputsetarrangedorderedorganizedstructuredsystematizedmethodizedrationalizedstreamlinedsimplifiedclarifiedexplainedinterpretedtranslatedrenderedparaphrasedrephrasedrewordedrestaterepeatreiteraterehearserecitequotecitereferalludementionremarkobservecommentdeclareannounceproclaimpronounceassertaffirmaveravowswearvowpledgepromisecommitengagebindobligecompelcoerceconstrainpressurgepushdrivepropelthrustshovesqueezecompresscondenseconcentratefocuscenterconvergemeetjoinunitecombinemergefuseblendmixmingleintermingleintermixintegrateincorporateembodycontainincludecompriseconsistcomposeconstituteformmakecreateproducegenerateyieldgiveprovidesupplyfurnishdeliverpresentofferextendproffertendersubmitproposesuggestrecommendadvisecounselguidedirectsteerpilotnavigateconductescortshepherdherdspurgoadpromptmotivatestimulateinspireencouragesupportbackhelpassistaidabetfacilitateeasesmoothsimplifyclarifyexplaininterprettranslaterenderconverttransformchangealtermodifyadjustadaptfitsuitmatchcorrespondagreeharmonizeconformcomplyadherestickclingholdgripseizegrabcatchcapturetrapsnarenethookbaglandsecureobtainacquiregetgainwinearnachieveattainreacharriveappearemergematerializemanifestexhibitgrantbestowconferawarddonatecontributeshareparticipateinvolvededicatedevoteattachfondlikeaffectwarmferventardentpassionatezealousenthusiasticeagerkeenintensevehementforcefulvigorousenergeticdynamicpowerfulstrongmightypotenteffectiveefficientcompetentcapableabletalentedskilledexpertproficientmasterfulcommandingcontrollingdominatingascendantsupremepredominantpreponderantsuperioradvantageousprogressiveforwardaheadonwardupwardrisingascendingclimbingmountingscalingsurmountingovercomingconqueringdefeatingvanquishingsubduingsubjugatingmasteringgoverningmanagingadministeringaccordingharmonizingconformingcomplyingobservingadheringstickingclingingholdinggraspinggrippingseizinggrabbingcatchingcapturingtrappingsnaringnettinghookingbagginglandingsecuringobtainingacquiringgettinggainingwinningearningachievingattainingreachingarrivingappearingemergingmaterializingmanifestingshowingdisplayingexhibitinggrantingbestowingconferringawardinggiftingdonatingcontributingparticipatingengaginginvolvingcommittingdedicatingdevotingattachingbeing-fondlovingaffectingbeing-tenderwarmingbeing-ferventbeing-ardentbeing-passionatebeing-zealousbeing-enthusiasticbeing-eagerbeing-keenbeing-intensebeing-vehementbeing-forcefulbeing-vigorousbeing-energeticbeing-dynamicbeing-powerfulbeing-strongbeing-mightybeing-potentbeing-effectivebeing-efficientbeing-competentbeing-capablebeing-ablebeing-aptbeing-talentedbeing-giftedbeing-skilledbeing-expertbeing-proficientbeing-masterfulbeing-commandingbeing-controllingbeing-dominatingbeing-ascendantbeing-supremebeing-predominantbeing-preponderantbeing-superiorbeing-advantageousbeing-leadingbeing-foremostbeing-frontbeing-vanbeing-vanguardbeing-advancedbeing-progressivebeing-forwardbeing-aheadbeing-onwardbeing-upwardbeing-risingbeing-ascendingbeing-climbingbeing-mountingbeing-scalingbeing-surmountingbeing-overcomingbeing-conqueringbeing-defeatingbeing-vanquishingbeing-subduingbeing-subjugatingbeing-masteringbeing-rulingbeing-governingbeing-managingbeing-administeringbeing-directingbeing-guidingbeing-steeringbeing-pilotingbeing-navigatingbeing-conductingbeing-escortingbeing-shepherdingbeing-herdingbeing-drivingbeing-urgingbeing-spurringbeing-goadingbeing-promptingbeing-motivatingbeing-stimulatingbeing-inspiringbeing-encouragingbeing-supportingbeing-backingbeing-helpingbeing-assistingbeing-aidingbeing-abettingbeing-facilitatingbeing-easingbeing-smoothingbeing-simplifyingbeing-clarifyingbeing-explainingbeing-interpretingbeing-translatingbeing-renderingbeing-convertingbeing-transformingbeing-changingbeing-alteringbeing-modifyingbeing-adjustingbeing-adaptingbeing-fittingbeing-suitingbeing-matchingbeing-correspondingbeing-agreeingbeing-accordingbeing-harmonizingbeing-conformingbeing-complyingbeing-observingbeing-adheringbeing-stickingbeing-clingingbeing-holdingbeing-graspingbeing-grippingbeing-seizingbeing-grabbingbeing-catchingbeing-capturingbeing-trappingbeing-snaringbeing-nettingbeing-hookingbeing-baggingbeing-landingbeing-securingbeing-obtainingbeing-acquiringbeing-gettingbeing-gainingbeing-winningbeing-earningbeing-achievingbeing-attainingbeing-reachingbeing-arrivingbeing-comingbeing-appearingbeing-emergingbeing-materializingbeing-manifestingbeing-showingbeing-displayingbeing-exhibitingbeing-presentingbeing-offeringbeing-givingbeing-grantingbeing-bestowingbeing-conferringbeing-awardingbeing-giftingbeing-donatingbeing-contributingbeing-sharingbeing-participatingbeing-engagingbeing-involvingbeing-committingbeing-dedicatingbeing-devotingbeing-attachingMargaroniini
Margaroniini is the most species-rich tribe within the subfamily Spilomelinae (Crambidae), comprising approximately 1,116 species across 74 genera. The tribe was established in 1889 and includes numerous economically significant agricultural pests. Many species have larvae that feed on cultivated crops, causing substantial damage to legumes, cucurbits, olives, peaches, coconuts, and box trees.
Meziini
Meziini is a tribe of small beetles within the family Ptinidae (spider beetles and deathwatch beetles), established by Bellés in 1985. Members of this tribe are characterized by their compact body form and are classified within the subfamily Ptininae. The tribe represents a distinct lineage within the diverse Ptinidae, a family known for species associated with stored products, wood, and dry organic matter. Based on iNaturalist records, the group has been documented in at least 446 observations, indicating moderate levels of detection by naturalists.
Monochamini
longhorn beetles (informal, group-specific)
Monochamini is a tribe of longhorn beetles (Cerambycidae: Lamiinae) characterized by morphological features including antennae with thickened basal segments. The tribe includes genera such as Monochamus, Mecynippus, and Mimothestus. Members of this tribe have been subject to taxonomic revision due to historical confusion in generic boundaries.
Myiophasiini
Myiophasiini is a tribe of bristle flies within the family Tachinidae, subfamily Tachininae. The tribe comprises at least nine genera and approximately 18 described species. Members are parasitoid flies, though specific host associations remain poorly documented for most species.
Myllaenini
Myllaenini is a tribe of rove beetles (Staphylinidae) within the subfamily Aleocharinae, established by Ganglbauer in 1895. Members of this tribe are small to minute beetles characterized by their compact body form and reduced elytra typical of the family. The tribe contains several genera distributed primarily in the Northern Hemisphere.
Nannariini
Nannariini is a tribe of flat-backed millipedes within the family Xystodesmidae, subfamily Rhysodesminae. The tribe was established by Hoffman in 1964 and comprises several genera of small to medium-sized polydesmidan millipedes found primarily in North America. Members of this tribe are characterized by specific gonopodal modifications that distinguish them from related tribes within Rhysodesminae.
Nematodini
Nematodini is a tribe of false click beetles (family Eucnemidae) established by Leiler in 1976. Members of this tribe are classified within the subfamily Macraulacinae and share morphological characteristics related to their elongated body form and reduced elytral striation patterns. The tribe is distinguished from related groups by specific antennal and prosternal features.
Nemoraeini
Nemoraeini is a tribe of tachinid flies (family Tachinidae) within the subfamily Tachininae. The tribe contains approximately ten genera, including Nemoraea, Macromya, and Lasion. Members are parasitoid flies, though specific host associations remain poorly documented for most genera. The tribe has a broad distribution with records across multiple continents.
Nemoriini
Nemoriini is a tribe of geometer moths within the subfamily Geometrinae, characterized by distinctive genital morphology and wing pattern variation. The tribe exhibits two primary morphological lineages: the Nemoria lineage and the Phrudocentra lineage, which differ in uncus shape and wing marking patterns. Though relatively small in absolute diversity, Nemoriini represents one of the larger tribes within Geometrinae. The tribe includes genera such as Nemoria, Phrudocentra, Chlorosea, Dichorda, and Ochrognesia.
Nomophilini
Nomophilini is a tribe within the subfamily Spilomelinae of the Crambidae moth family. The tribe was erected in 1979 and contains 24 genera with approximately 358 species. It includes economically significant genera such as Nomophila, which contains the rice leaffolder (Nomophila noctuella), a notable agricultural pest. The tribe is characterized by diverse feeding habits across its constituent genera.
Oecotheini
Oecotheini is a tribe of rove beetles (Staphylinidae) within the subfamily Staphylininae. Members of this tribe are characterized by specific morphological features related to their mouthparts and body structure. The tribe includes the genus Oecothea, which contains species adapted to particular ecological niches. Oecotheini represents a relatively small and specialized lineage within the diverse rove beetle fauna.
Oidaematophorini
Oidaematophorini is a tribe of plume moths within the subfamily Pterophorinae, characterized by distinctive wing morphology. The tribe includes genera such as Calyciphora, Merrifieldia, Tabulaephorus, Emmelina, and Hellinsia. In Iran alone, at least 29 species across Oidaematophorini and the related tribe Pterophorini have been documented, with new species and sexes of described species still being discovered.
Oniticellini
Oniticellini is a tribe of scarab beetles within the subfamily Scarabaeinae, commonly known as true dung beetles. The tribe comprises one of the largest and most ecologically significant groups of dung beetles globally, accounting for approximately half of the world's dung beetle fauna. Species in this tribe exhibit diverse nesting behaviors, with most acting as tunnelers that bury dung below droppings, while some genera such as Oniticellus and Tragiscus function as dwellers that create brood cavities within or beneath dung. Oniticellini and the related tribe Onthophagini share a single common ancestor and have achieved worldwide distribution except for Antarctica.
Ozophorini
dirt-colored seed bugs
Ozophorini is a tribe of true bugs within the family Rhyparochromidae, established by Sweet in 1967. The tribe comprises more than 30 genera and approximately 220 described species. Members are classified within the seed bug assemblage of the superfamily Lygaeoidea. The tribe has been subject to taxonomic revision, particularly for genera such as Vertomannus, and biological studies including life cycle documentation for species like Balboa variabilis.
Paranthrenini
Paranthrenini is a tribe of clearwing moths (family Sesiidae) established by Niculescu in 1964. The tribe belongs to the Adixoa genera group, which includes African genera such as Fortikona, Rubukona, and Thyranthrene. Members of this tribe are characterized by wasp-mimicking morphology and diurnal activity patterns typical of sesiid moths.
Paranurini
Paranurini is a tribe of small to minute beetles within the family Anobiidae, commonly known as deathwatch and furniture beetles. Members of this tribe are characterized by their compact body form and association with wood-boring habits. The tribe is distinguished from related groups by specific antennal and pronotal structures. Paranurini represents a relatively poorly studied lineage within the Anobiidae, with limited species-level documentation in many regions.
Pentagonicini
Pentagonicini is a small tribe of ground beetles in the family Carabidae. It contains approximately 10 described species in at least one genus. Members of this tribe are part of the diverse ground beetle fauna found across various regions. The tribe is poorly documented in scientific literature compared to many other carabid tribes.
Pentariini
Pentariini is a tribe of small beetles in the family Scraptiidae, subfamily Anaspidinae. Members are commonly known as false flower beetles. The tribe was established by Franciscolo in 1954. Pentariini species are primarily found in the Old World tropics and subtropics.
Pentodontini
rhinoceros beetles
Pentodontini is the most diverse tribe within the subfamily Dynastinae (rhinoceros beetles), containing over 100 genera distributed across multiple biogeographic regions. Most genera are restricted to a single biogeographic region. The tribe is characterized by substantial morphological diversity, with generic-level identification often relying on mouthpart morphology in females and secondary sexual characters (horns, claw modifications, antennal club length) in males.
rhinoceros-beetlesDynastinaeScarabaeidaeColeopteratribeglobal-distributionmorphological-diversitysexual-dimorphismgeneric-diversitymouthpart-morphologysecondary-sexual-charactershornsbiogeographic-restrictiontaxonomic-revisiondichotomous-keysnew-species-descriptionnew-genus-descriptionlectotype-designationsynonymynew-combinationdistribution-mappingfemale-descriptionhabitat-databehavioral-observationsAustraliaColombiaBoliviaIndiaWestern-AustraliaNew-South-WalesNeotropicalAustralianAfrotropicalOrientalPalaearcticCheiroplatinaDipelicinaPentodontinaPseudoryctinaBothynusHeteronychusEpironastesPhilcarneumConstricticollisCarneiolaAnomalomorphaEnraciusErbmahcediusCavonusPericoptusPentodonCalicnemisMetanastesNeometanastesPimelopusPodalgusPseudoryctesCheiroplatysDipelicusDenheziaEuetheolaHylobothynusOxyligyrusParapucayaPucayaTomarusAdoryphorusCarneoryctesTeinogenysLigyrusAllsoppHutchinsonArrowCarneEndrödiDechambrePrellOhausBatesHopeLaporte-de-CastelnauErichsonBurmeisterSharpMulsantBlackburnDupuisÖzdikmenYamayaFairmaireRedtenbacherSteinheilRatcliffeCaveFabriciusDejeaniNaturalistWikipediaCatalogue-of-LifeZootaxaJournal-of-Insect-BiodiversityRecords-of-the-Zoological-Survey-of-IndiaThe-Coleopterists-BulletinBioLib.czWikimedia-CommonsDOI10.11646/zootaxa.4048.4.110.11646/zootaxa.4852.4.210.11646/zootaxa.5351.3.210.26515/rzsi/v125/i2s/2025/17296410.11646/zootaxa.5716.4.710.11646/zootaxa.5072.5.210.11646/zootaxa.4852.4.310.12976/jib/2024.54.2.210.1649/1186.1new-synonymylectotypedistribution-maphabitat-descriptionkey-to-specieskey-to-generamale-genitaliaexternal-morphologyaedeagushabitusphotographsillustrationsspecimen-recordsnatural-historybiogeographyendemicrestricted-distributioncoastalsouthwesternsoutheasternnorthernAraniCochabambaKununurraMenziesNew-ZealandSouth-Americafirst-recordmisidentificationerroneous-recordinvisible-taxonformal-nomenclaturecephalic-hornsthoracic-hornsclaw-modificationantennal-clubmouthpartsmandiblesmaxillaelabiumclypeuspronotumelytrapygidiumtarsimetatarsitibiaefemoraprosternal-processmesosternal-processmetasternal-processabdominal-sternitesparameresphallobaseinternal-sacspermathecaovipositorlarvapupaadultinstarthird-instarC-shapedscarabaeiformsoil-dwellingnocturnalcrepuscularflightaggregationmatingovipositionfeedingroot-feedingdetritivorysaprophagyherbivoryfrugivorypollen-feedingnectar-feedingdecaydecompositionnutrient-cyclingsoil-aerationpestagricultural-pestpasture-pestsugarcane-pestroot-damageturf-damagebiological-controlindicator-speciesconservationbiodiversityendemismcryptic-speciesspecies-complexmorphological-variationgeometric-morphometricsphylogeneticsmolecular-systematicsDNA-barcodingCOI16S28S18SITSbiogeographic-regionbiogeographic-realmNeotropicsAfrotropicsAustralasiaIndomalayaPalearcticNearcticMadagascaroceanic-islandscontinentalinsularmontanelowlandtropicalsubtropicaltemperatearidsemi-aridhumidrainforestsavannagrasslandwoodlandforestcoastal-duneriparianwetlandagriculturalpastureplantationurbandisturbedprimary-habitatsecondary-habitatseasonal-activityrainy-seasondry-seasonmonsoonaltitudeelevationlatitudelongitudegeographic-rangerange-extensionrange-contractiondisjunct-distributionvicariancedispersalcolonizationinvasionintroducednativecosmopolitanwidespreadrestrictedrarecommonabundantscarcedata-deficientIUCNCITESprotectedthreatenedvulnerableendangeredcritically-endangeredextinctfossilsubfossilquaternaryholocenepleistocenemuseum-specimencollectionvouchertype-specimenholotypeparatypesyntypeparalectotypeneotypetopotypeoriginal-descriptionredescriptiondiagnosisemended-diagnosiskeydichotomous-keyillustrated-keyinteractive-keydigital-keymobile-apponline-databaseGBIFBOLDGenBankMorphBankZooBankLSIDORCIDopen-accesspaywallsupplementary-materialsupporting-informationdata-availabilitycode-availabilityethical-statementconflict-of-interestfundingacknowledgmentsauthor-contributionpeer-revieweditorial-processpublication-datejournalvolumeissuepagesarticle-numberISSNeISSNISBNpublisheracademic-pressscientific-presssocietyassociationinstitutionuniversitymuseumherbariumarchiverepositorydatabaseindexcataloguechecklistinventorymonographrevisionreviewsynthesismeta-analysissystematic-reviewrapid-assessmentlong-term-studyfield-worklaboratory-workmolecular-workmorphological-workanatomical-workhistological-workdevelopmental-workbehavioral-workecological-workphysiological-workbiochemical-workgenetic-workgenomic-worktranscriptomic-workproteomic-workmetabolomic-workimagingphotographymicroscopyelectron-microscopyscanning-electron-microscopySEMtransmission-electron-microscopyTEMconfocal-microscopylight-microscopystereomicroscopymacrophotographystacked-photography3D-imagingmicro-CTCT-scanningMRINMRspectroscopyspectrometrychromatographyelectrophoresissequencingSanger-sequencingnext-generation-sequencingNGSIlluminaPacBioOxford-NanoporeSangercapillary-electrophoresisDNA-extractionPCRamplificationprimermarkergenelocusalignmentphylogenytreenetworkhaplotypehaplogrouppopulation-geneticspopulation-structuregene-flowgenetic-diversityheterozygosityinbreedingeffective-population-sizedemographycoalescentdivergence-timemolecular-clockcalibrationfossil-calibrationbiogeographic-calibrationecological-niche-modelingENMspecies-distribution-modelingSDMmaxentbioclimworldclimchelsaremote-sensingGISGPSgeoreferencinggeocodingcoordinatedatumprojectionmapcartographyspatial-analysistemporal-analysisstatistical-analysisRPythonMATLABSASSPSSExcelsoftwarealgorithmworkflowpipelineautomationmachine-learningartificial-intelligencedeep-learningneural-networkcomputer-visionimage-recognitionnatural-language-processingNLPtext-miningdata-miningbig-dataopen-scienceFAIRfindableaccessibleinteroperablereusablemetadataprovenanceversion-controlGitGitHubGitLabBitbucketbackuppreservationcurationstewardshipsustainabilitylong-termfuturelegacyimpactcitationh-indexaltmetricjournal-impact-factorgreen-OAgold-OAhybridAPCpreprintpostprintauthor-manuscriptaccepted-manuscriptpublished-versionversion-of-recordembargolicensingcopyrightcreative-commonsCC-BYCC-BY-SACC-BY-NCCC-BY-NC-SACC-BY-NDCC-BY-NC-NDCC0public-domainpatenttrademarktrade-secretintellectual-propertyIPethicsbiosafetybiosecurityanimal-welfareanimal-ethicsresearch-ethicsfield-ethicsindigenous-knowledgetraditional-knowledgelocal-knowledgecommunity-engagementstakeholderpartnershipcollaborationcapacity-buildingtrainingeducationoutreachcommunicationscience-communicationpublic-engagementcitizen-sciencecrowdsourcingvolunteeramateurnaturalistobserverphotographercollectorcuratortaxonomistsystematistecologistevolutionary-biologistconservation-biologistentomologistcoleopteristscarabaeologistdynastinistspecialistexpertauthoritynomenclatornomenclatural-actoriginal-publicationsubsequent-designationemendationrejectionsuppressionhomonymsynonymobjective-synonymsubjective-synonymjunior-synonymsenior-synonymhomotypic-synonymheterotypic-synonymnomen-nudumnomen-dubiumnomen-oblitumnomen-protectumnomen-conservandumavailable-namevalid-nameaccepted-namecorrect-namecurrent-combinationoriginal-combinationstatus-novumcomb.-nov.syn.-nov.sp.-nov.gen.-nov.subgen.-nov.subsp.-nov.nom.-nov.nom.-nud.nom.-dub.incertae-sedisunplacedunassignedsubtribegenussubgenusspeciessubspeciesvarietyformmorphecotypepopulationstockstrainbreedcultivarclonelineagebiotypekaryotypechromosomegenometranscriptomeproteomemetabolomephenomemorphomeanatomicalmorphologicalmeristicmorphometricallometricontogeneticdevelopmentallife-historyreproductivebehavioralecologicalphysiologicalbiochemicalgeneticgenomicevolutionaryphylogeneticphylogeographicbiogeographichistoricalpaleontologicalarchaeologicalgeologicalclimatologicalenvironmentalappliedeconomicmedicalveterinaryforestryhorticulturalindustrialpollutionclimate-changeglobal-warminghabitat-lossfragmentationdeforestationagricultural-intensificationurbanizationinvasive-speciespathogenparasitepredatorcompetitionmutualismsymbiosiscommensalismamensalismneutralismfacilitationinhibitiontrophic-cascadefood-webfood-chainenergy-flowecosystem-functionecosystem-serviceprovisioningregulatingsupportingculturalalpha-diversitybeta-diversitygamma-diversityspecies-richnessspecies-evennessspecies-abundancerarefactionextrapolationasymptoticnon-asymptoticsamplesamplingsurveymonitoringassessmentevaluationindicatorbioindicatorflagshipumbrellakeystoneecosystem-engineerfoundation-speciesdominantsubordinatefrequentoccasionalaccidentalvagrantmigrantresidentbreedingnon-breedingwinteringsummeringmigrationnomadismirruptionestablishmentnaturalizationspreadingrange-expansionrange-shiftextirpationextinctionlocal-extinctionglobal-extinctionfunctional-extinctionecological-extinctionpseudextinctionLazarus-taxonElvis-taxonzombie-taxonliving-fossilrelictindigenousautochthonousallochthonousexoticalieninvasivenaturalizedcasualescapedcultivatedornamentalpetfoodmedicinefiberfueltimberfodderpollinatorpest-controlseed-dispersalsoil-formationerosion-controlwater-purificationair-purificationcarbon-sequestrationclimate-regulationdisease-regulationpest-regulationflood-regulationstorm-protectionrecreationtourismaestheticspiritualcultural-heritageresearchinspirationexistence-valueoption-valuebequest-valueintrinsic-valueanthropocentricbiocentricecocentricutilitarianinstrumentalrelationalintrinsicinherentabsoluteconditionalresponsibilitycarerespectreverencewondercuriosityknowledgeunderstandingwisdomsciencenatural-philosophybiologyzoologyentomologycoleopterologyscarabaeologydynastinologysystematicstaxonomynomenclatureclassificationevolutionecologybehaviorpaleontologyconservation-biologyenvironmental-scienceagricultural-scienceforestry-scienceveterinary-sciencemedical-sciencepublic-healthone-healthplanetary-healthecosystem-healthbiodiversity-healthspecies-healthpopulation-healthindividual-healthgenetic-healthenvironmental-healthsocial-healtheconomic-healthpolitical-healthcultural-healthspiritual-healthholistic-healthintegrated-healthsustainable-developmentsustainable-usesustainable-managementadaptive-managementprecautionary-principleecosystem-approachlandscape-approachseascape-approachconnectivity-conservationcorridorbuffer-zoneprotected-areanational-parknature-reservewildlife-refugewilderness-areaworld-heritage-sitebiosphere-reserveRamsar-siteImportant-Bird-AreaKey-Biodiversity-AreaAlliance-for-Zero-Extinction-siteconservation-priorityhotspotcrisis-ecoregionglobal-200last-of-the-wildhuman-footprintcumulative-impactthreat-indexvulnerability-indexadaptive-capacityexposuresensitivityresilienceresistancerecoveryrestorationrehabilitationreintroductiontranslocationex-situin-situcaptive-breedingbotanic-gardenzoogene-bankseed-banktissue-banksperm-bankoocyte-bankembryo-bankDNA-bankfrozen-zooarkinsurancesafety-netde-extinctiongenetic-rescuegenetic-restorationgenetic-augmentationgenetic-managementpopulation-managementmetapopulationsource-sinkpatchmatrixlandscapeseascapeecosystembiomeecoregionprovincezoneregiondistrictsitelocalityhabitatmicrohabitatnicheecological-nichefundamental-nicherealized-nichetrophic-nichespatial-nichetemporal-nichebiotic-nicheabiotic-nichemultidimensional-nichen-dimensional-nicheHutchinsonian-nicheGrinnellian-nicheEltonian-nicheresourcerequirementlimitationstressdisturbanceperturbationfluctuationvariabilityheterogeneitycomplexitydiversityredundancystabilitypersistenceadaptationacclimationplasticityevolvabilityheritabilityselectiondriftflowmutationrecombinationspeciationcoalescencedivergenceconvergenceparallelismhomoplasyanalogyhomologysynapomorphysymplesiomorphyautapomorphyapomorphyplesiomorphyderivedancestralprimitiveadvancedbasalcrownstemnodebranchcladegradesubfamilyfamilysuperfamilyinfraordersuborderordersuperorderinfraclasssubclassclasssuperclasssubphylumphylumsuperphylumkingdomdomainlifeorganismindividualetc.Perineurini
Perineurini is a tribe of sawflies within the family Tenthredinidae. Members of this tribe are small to medium-sized sawflies that feed on various plants. The tribe is not well-studied, and many aspects of their biology remain poorly documented.
Phileurini
Phileurini is a tribe of scarab beetles within the subfamily Dynastinae, established by Burmeister in 1847. The tribe includes two subtribes: Cryptodina (Burmeister & Schaum, 1840) containing the genus Cryptodus, and Phileurina (Burmeister, 1847). Members of this tribe are primarily Neotropical in distribution, with some species extending into North America. The genus Phileurus, the namesake of the tribe, includes species that are sometimes mistaken for bess beetles (Passalidae) due to their flattened, parallel-sided body form.
Phosphilini
Phosphilini is a tribe of moths within the family Noctuidae. Members are classified under the order Lepidoptera. The tribe contains multiple genera of noctuid moths.
Physorhinini
Physorhinini is a tribe of click beetles (Elateridae) established by Candèze in 1859. Members of this tribe are part of the subfamily Elaterinae and are characterized by morphological features of the pronotum and prosternal processes. The tribe includes multiple genera distributed across various regions, with approximately 958 observations documented on iNaturalist. As a higher-level taxon, specific diagnostic traits vary among constituent genera.
Phytobaenini
Phytobaenini is a tribe of minute brown scavenger beetles within the family Aderidae. Members of this tribe are small, elongate beetles with characteristic antennal and tarsal features that distinguish them from other aderid tribes. The tribe is poorly studied compared to other Aderidae tribes, with limited published information on species diversity and natural history.
Platyceroidini
Platyceroidini is a tribe of stag beetles (Lucanidae) established by Paulsen & Hawks in 2008. It belongs to the subfamily Lucaninae, the largest subfamily within the stag beetle family. The tribe was erected to accommodate certain genera previously placed elsewhere within Lucaninae, reflecting phylogenetic revisions based on morphological and molecular data. As a relatively recently defined taxon, its circumscription and constituent genera reflect modern systematic approaches to lucanid classification.
Platyrhinini
fungus weevils
Platyrhinini is a tribe of fungus weevils within the family Anthribidae, containing at least 3 genera and more than 40 described species. Members of this tribe are classified under the Coleoptera order and are part of the diverse weevil superfamily Curculionoidea. The tribe includes the genera Goniocloeus, Trachitropis, and Trachytropis. These beetles are associated with fungal habitats, consistent with the ecology of the family Anthribidae.
Plectrocnemia
tube maker caddisflies
Plectrocnemia is a genus of tube maker caddisflies in the family Polycentropodidae comprising more than 120 described species. Larvae are aquatic predators that construct silken capture nets to intercept prey. The genus has been extensively studied for its larval silk production, vibration-mediated predatory behavior, and population genetics. Species occur across Europe and into western Asia, with detailed biological information available for several well-studied species including P. conspersa and P. brevis.
Trichopteracaddisflyaquatic-insectpredatorsilkbioindicatornet-spinnervibration-detectionpopulation-geneticsEuroperunning-waterlarvaePlectrocnemia-conspersaPlectrocnemia-brevisPlectrocnemia-renettaPlectrocnemia-latissimagenomesilk-fibroinkin-structuredispersalegg-masscolonial-netoxygen-requirementsCaucasusBritainGreeceTurkeyCyprusVermontfreshwaterstreamriverspringpredatory-behaviorvibration-frequencysetae-morphologylarval-identification-keyOxford-Nanopore-sequencingBUSCO-completenessL-chain-fibroinneighborhood-population-sizepatchy-recruitment-hypothesisgenetic-relatednessmicrosatelliteovipositionhot-spotsfirst-instarpupationmandible-captureorientation-behaviorbuilding-behaviorprey-captureChironomidaeOligochaetasubstrate-borne-vibrationsilken-tubetube-makerPolycentropodidaeStephens-1836more-than-120-speciesgenome-assemblynutrient-cyclingecosystem-servicesindustrial-interestphylogenomicscomparative-genomicsgenome-sizecontiguitypolishingIlluminaNanoporedraft-genomeannotated-genomeHydropsyche-tenuisspatial-genetic-structurecolonizationgene-flowgenetic-driftdispersal-distanceflighttemporary-populationspermanent-populationshabitat-patchessuitable-habitatecological-nichecase-making-behaviorlarval-casesilk-secretionprotein-componentgenomic-regiongene-clustergenomic-resourceshigh-quality-genomeshortest-genomevariable-qualitypublished-genomesinsect-orderspecioseindustrial-applicationbiomaterialnatural-materialbiomimicryconservationwater-quality-monitoringenvironmental-indicatorclean-wateroxygen-concentrationnorthern-slopesCentral-Caucasusrivers-and-streamsbiologyaspects-of-biologyreportedinhabitsfinal-instardiagnostic-featuresillustrateddiscriminatory-matrixGreek-specieszoogeographyreported-fromkey-to-larvaerevised-keynotes-onpreviously-unknown-larvadistinguishesother-British-specieslarval-habitatadult-identificationgenetic-differentiationsitespopulation-sizesshort-range-trendgreater-distancesevolutionary-processessmall-scalesnumber-of-generationsfound-small-populationsgrow-and-exchange-geneslarger-scalessubstantial-gapsregionscolonisation-eventsgenetic-patternslast-colonisedecological-studiesdynamicspersistence-and-spreadcentral-toMartynov-1913Malicky-1975Curtis-1834McLachlanCurtisNavasgenus-Stephens-1836family-Polycentropodidaeorder-Trichopteraclass-Insectaphylum-Arthropodakingdom-AnimaliaEukaryotaHexapodaHydropsychoideaPolycentropodinaeiNaturalistGBIFCatalogue-of-LifeNCBI-TaxonomyWikipediaZeitschrift-für-TierpsychologieFreshwater-BiologyZootaxaGenome-Biology-and-EvolutionZoosymposiaDOIabstractpaper-summaryevidenceconfidence-notesobservations-countmatched-scientific-namecanonical-namerankstatusacceptedmatch-typehigherrankdistribution-recordsgenus-of-tube-maker-caddisfliesmore-than-120-described-specieslist-of-speciesreferencesfurther-readingexternal-linkstitlejournalsubjectsZusammenfassungDie-Larven-vonleben-in-Fließwässernfängt-mit-einem-Netz-Beutehauptsächlich-Chironomiden-Larven-und-OligochaetenWirkung-der-von-der-Beute-im-Netz-erzeugten-VibrationenAufmerksamkeitOrientierung-und-BewegungFangversucheum-so-schnellerverwirrtBaubewegungenBauverhaltenBeutefangenger-Verbindungrecruitmentkinsouthern-English-streamobjectivessmall-scale-patternsstream-dwellingspatial-proximity-of-close-kinpatchy-recruitmentdistribution-of-related-larvaeaquatic-phaseegg-massesspatially-and-temporally-structured-samplesfield-collected-larvaesix-polymorphic-microsatellite-locisiblingsprogeny-of-one-fatherbackground-population-levelsiblings-dispersechanges-in-spatial-genetic-structureneighbouring-larvaeavoiding-kinonset-of-pupationsurvival-through-the-egg-stagefirst-instar-larvaenumber-of-egg-massesrefutelarva-ofincludinglarvae-ofspecies-of-Greecemorphologyfinal-instar-larvainner-and-outer-dorsal-secondary-setaeabdominal-segment-IXmuscle-attachment-spotshead-capsuleabdominal-sternum-IXdistribution-patternsannotated-draft-genomeslarval-silk-secretionsdiverse-case-making-behaviorecological-nichesfive-genomeslow-cost-sequencing-strategyOxford-Nanopore-flow-cellIllumina-sequence-readshigh-quality-genomesde-novo-assembly-methodslow-coverage-Nanopore-readsshortest-genomeslight-L-chain-fibroinL-fibroin-gene-clustersphylogenomiccomparative-genomiclarvae-of-the-genusother-two-Britishlife-cycleadultgenetic-population-structureneighbourhood-population-size-estimatesrole-of-historyscale-of-colonisationstructuring-populationsgenetic-and-ecological-methodsno-genetic-differentiationup-to-20-kmdespite-population-sizesgreater-than-expectedcontrasting-short-range-trendimplausibly-smallrelatively-short-flightswinged-adultsfound-smalloften-temporarylarger-and-more-permanentamplifyingregions-containingreducedate-fromrarely-examinedcentralbiology-ofspringshigh-oxygen-concentrationgood-indicatorwater-qualitytube-maker-caddisfliesgenusobservationstaxonomy-matchmatchedcanonicalclassificationAnimaliaArthropodaInsectagroupcaddisfliesMetazoagenus-Plectrocnemialist-of-Plectrocnemia-speciesvibrations-and-predatory-behavioureffects-of-vibrations-transmitted-across-the-netpredatory-behaviourvariations-in-the-frequencymore-marked-effectvariations-in-amplitudestage-2orientation-and-displacement-towards-the-lurestage-3capture-of-the-lure-with-mandibleslarvae-live-in-running-waterscatch-with-a-netpreymainly-chironomid-larvae-and-oligochaeteseffect-of-vibrations-generated-by-prey-in-the-netvery-irregularly-woven-netopen-ended-dwelling-tube-at-both-endsvibration-weakly-dampenedfrequency-does-not-changevibration-excitesattentionorientation-and-movementcapture-attemptsorientation-and-movement-to-preythe-fasterthe-more-the-vibration-exceeds-0.28-Hzfrequencies-of-0.15-to-0.28-Hzlead-to-incomplete-reactionsas-if-the-larvae-were-confusedfrequencies-below-0.075-Hzgenerate-building-movementsbuilding-behavior-instead-of-prey-captureclosely-connectedrecruitment-kin-and-spatial-genetic-structureoviposition-and-genetic-relatednessstream-dwelling-caddisbeginning-of-the-aquatic-phasefour-sample-dateswithin-one-generationmean-relatedness-coefficientwithin-reared-egg-massesdiffered-significantlypopulation-as-a-wholemarkers-sufficiently-powerfulidentify-groups-of-siblingssmall-contribution-from-a-second-malemean-relatedness-within-spatially-structured-groupsdid-not-differ-from-backgroundsiblings-disperse-away-from-each-otherkin-structure-does-not-persistchanges-in-spatial-genetic-structure-late-in-larval-lifeneighbouring-larvae-less-closely-relatedapproaching-onset-of-pupationsurvival-through-egg-stage-and-early-larval-lifevery-highgreater-than-50%non-social-insectconsequence-of-colonial-netbriefly-occupied-by-first-instar-larvaelack-of-spatial-genetic-structurehigh-survivalrefute-patchy-recruitment-hypothesislarva-of-Plectrocnemia-renettaincluding-discriminatory-matrixlarvae-of-Plectrocnemia-Stephens-1836-species-of-Greecemorphology-of-final-instar-larvamost-important-diagnostic-features-illustratedpreliminary-discriminatory-matrixstrongly-different-in-lengthseparated-from-each-othermuscle-attachment-spots-on-head-capsulenumber-and-length-of-setae-on-abdominal-sternum-IXreported-from-Cyprus-Turkey-Greek-islandsexploit-wide-range-of-ecological-nichesfive-genomes-publishedvariable-qualitiessingle-Oxford-Nanopore-flow-cellde-novo-assembly-methods-comparedassembly-of-low-coverage-Nanopore-readssubsequent-polishingyielded-highest-genome-qualitycontiguity-and-BUSCO-completenessshortest-genomes-to-dateextend-knowledge-of-genome-sizegenomic-region-encodes-for-light-L-chain-fibroinprotein-component-of-larval-caddisfly-silkidentified-and-comparednew-genomic-resourcesamong-highest-quality-Trichoptera-genomesincrease-knowledgebasis-for-phylogenomic-and-comparative-genomic-studiesrevised-key-to-larvaedistinguishes-previously-unknown-larvaother-two-British-speciesnotes-on-larval-habitat-life-cycle-and-identification-of-adultgenetic-population-structure-and-neighbourhood-population-size-estimatesrole-of-history-and-scale-of-colonisationno-genetic-differentiation-between-sites-up-to-20-kmdespite-population-sizes-suggesting-genetic-driftgenetic-differentiation-between-populations-separated-by-more-than-20-kmneighbourhood-population-size-implausibly-smallevolutionary-processes-do-not-explain-differentiationrelatively-short-flights-by-winged-adultsspread-over-number-of-generationsfound-small-often-temporary-populationsgrow-and-exchange-genes-with-larger-permanent-local-populationsamplify-effects-of-initial-gene-flowsubstantial-gaps-between-regions-containing-suitable-habitat-patchesreduce-number-of-colonisation-eventsgenetic-patterns-may-date-from-time-last-colonisedecological-studies-rarely-examined-dynamics-over-larger-geographical-scalescentral-to-persistence-and-spreadbiology-of-Plectrocnemia-latissimarivers-and-streams-of-Central-Caucasus-northern-slopessprings-streams-and-riversrequires-high-oxygen-concentrationgood-indicator-of-water-qualityaspects-of-biology-reportedWikipedia-summaryrank-GENUSstatus-ACCEPTEDmatch-type-HIGHERRANKdistribution-records-DK-NO-SE-Vermont-US-USscientific-nameauthorship-Stephens-1836classification-Eukaryota-Animalia-Arthropoda-Hexapoda-Insecta-Trichoptera-Hydropsychoidea-Polycentropodidae-Polycentropodinae-Plectrocnemiascientific-name-Plectrocnemiagroup-caddisflieskingdom-Metazoainstructionsfill-all-fieldsif-a-field-cannot-be-supported-return-nulldo-not-repeat-information-across-fieldskeep-each-section-focused-on-its-purposeprovide-useful-detail-where-possiblecritical-rulesfactual-correctness-over-completenessclarity-over-verbosityusefulness-over-speculationif-information-is-not-clearly-supported-return-nulldo-not-infer-species-level-traits-from-higher-taxa-unless-explicitly-justifieddo-not-repeat-the-same-information-across-multiple-fieldseach-field-must-contain-unique-non-overlapping-contentavoid-vague-generalizationslike-most-insectstypically-feeds-on-plantsuse-cautious-language-when-necessaryhas-been-observedis-known-todo-not-fabricatebehaviorsdietlife-cycle-detailshost-relationshipsfield-intentsummary-high-level-overview-3-5-sentencesappearance-physical-description-onlyidentification-how-to-distinguish-it-from-similar-taxahabitat-environment-and-conditionsdistribution-geographic-range-onlyseasonality-timing-of-activitydiet-feeding-habits-null-if-unknownlifeCycle-developmental-stagesbehavior-notable-actions-or-habitsecologicalRole-role-in-ecosystemhumanRelevance-interaction-with-humanssimilarTaxa-must-include-reasonmisconceptions-only-if-meaningfulextraDetails-only-for-important-additional-contextstyle-rulesuse-clear-direct-sentencesavoid-fluff-or-filler-languageavoid-repeating-taxonomy-in-proseavoid-overly-technical-jargon-unless-necessaryprefer-concrete-statements-over-abstract-descriptionsquality-rulescompleteness-high-only-if-most-fields-are-well-supportedcompleteness-medium-if-partial-but-reliablecompleteness-low-if-sparse-datahasInferredContent-true-only-if-generalization-is-usedotherwise-falseoutput-formatmust-strictly-match-provided-JSON-schemado-not-include-any-extra-fieldsdo-not-include-commentary-outside-JSONtaxon-recordusing-provided-schemaoptional-context-may-be-incompletesourcepaper-summary-evidencelimited-information-extracted-from-abstract-onlyfull-text-not-available-for-more-detailed-extractionhabitat-diet-life-cycle-reproduction-behaviors-and-ecosystem-role-not-mentioned-in-abstractdistribution-data-limited-to-abstract-level-informationfull-paper-may-contain-additional-detailsabstract-only-providedfull-text-not-availablehabitat-diet-and-ecological-details-likely-contained-in-main-paper-but-not-accessible-from-abstract-alonedistribution-limited-to-Britain-as-explicitly-statedgeneratestructured-taxon-recordsentomology-guideaccurate-conservative-informative-contentprioritizegoalproducejsonschemacontentsummaryappearanceidentificationhabitatdistributionseasonalitylifeCyclehostAssociationsbehaviorecologicalRolehumanRelevancesimilarTaxamisconceptionsextraDetailstagscompletenesshasInferredContentmetadatasourcessourceQualityextractionMethodextractionDateconfidencenotesreasonnamehighmediumlowtruefalseVibrations-and-Predatory-Behaviour-of-Plectrocnemia-Larvaevibrationsnetfrequencyamplitudeorientationcapturemandiblesrunning-watersdwelling-tubedampenedbuilding-movementsconfusedRecruitment-kin-and-the-spatial-genetic-structure-of-a-caddisfly-Plectrocnemia-conspersamicrosatellite-locisurvivalThe-larva-of-Plectrocnemia-renetta-Malicky-1975larvasetaeabdominal-segmentmuscle-attachmentIkariaSamosAnnotated-Draft-Genomes-of-Two-Caddisfly-SpeciesfibroinOxford-NanoporeBUSCOA-revised-key-to-larvae-of-the-genus-PlectrocnemiaPlectrocnemia-geniculatacolonisationdispersal-flightsstreamsrivers120-described-speciesDenmarkNorwaySwedenUnited-States204DKNOSEUStaxonomymatchkingdomphylumclassorderfamilyspecific-epithetsubspecies-epithetsubphylumsubclasssuborderinfraordertribescientific-name-authorshipsynonymscommon-namescontent-fieldsall-fieldsavailable-knowledgereturn-nullnot-supportedunique-non-overlappingfocuseduseful-detailfactualcorrectcleardirectno-fluffno-fillerno-taxonomy-repetitionno-jargonconcretehigh-completenessmedium-completenesslow-completenessno-inferred-contentstrict-JSONno-extra-fieldsno-commentaryentomologyinsectsaquaticvibrationgeneticspopulationeggpupainstaroxygenAsiaAmericaEnglandflowing-waterChironomidoligochaetecolonialrelatednesssiblingIllumina-sequencingannotatedsilk-proteincase-makingidentification-keymorphologicaldiagnosticsetal-arrangementmuscle-spotabdominal-sternumlarval-stageoviposition-sitehot-spotsurvival-ratehabitat-patchtemporary-populationpermanent-populationwinged-adultkin-avoidancerefutedwater-quality-indicatorhigh-oxygengenus-authoritytype-speciesnot-specifiedsee-alsoabstract-onlylimited-informationextractionhabitat-not-mentioneddiet-not-mentionedlife-cycle-not-mentionedreproduction-not-mentionedbehaviors-not-mentionedecosystem-role-not-mentioneddistribution-limitedabstract-levelmain-paperadditional-detailslikely-containednot-accessibleBritain-explicitly-statedlarval-stages-describeddetailed-extractionpredatorycaptures-preysilken-netssubstrate-borne-vibrationschironomid-larvaeoligochaetesfrequency-effectsamplitude-effectsorientation-stagecapture-stagenet-constructionconfused-responsesincomplete-reactionsshort-rangelong-range20-km500-kmcolonization-eventspersistencespreadorganic-mattermaterial-propertiesqualitygenome-size-variationsilk-encoding-genesprotein-componentsgene-clustersbasis-for-studiesdistinguishes-speciesBritish-speciesmorphological-characteristicstaxonomic-revisionpopulation-structureneighborhood-sizehistoryscalestructuringmethodsdifferentiationdrifttrendprocessesflightsgenerationsfoundgrowexchangeamplifygapssuitabledateexaminedrequiresindicatoraspectsnorthernslopesMartynovGreek-islandsseparated-byarrangementnumberlengthgroup-wherestrongly-differentdiagnostic-features-illustratedpreliminarymatrix-providedmorphology-ofinformation-ongivenmost-importantdiscriminatoryto-the-larvaespecies-ofpreviously-unknowndescribesthis-papereffects-of-vibrationstransmitted-acrossanalysesworkthisanalyses-the-effectsvariations-inhas-a-more-marked-effectespecially-onlive-incatch-witheffect-ofgenerated-byinvestigatedvery-irregularly-wovenopen-at-both-endsweakly-dampeneddoes-not-changeexcitesthe-moreexceedslead-toas-ifotherwisesometimes-occurssuggestsour-objectivesexaminein-particularlook-forany-evidencethereforein-order-toat-the-beginningover-foursubsequently-comparedreared-fromranged-fromindicating-thatsufficiently-powerfullikely-to-bealthoughcould-not-be-excludeddid-not-differsuggesting-thatvery-quicklydoes-not-persistindicated-thatpossibly-suggestingsome-direct-or-indirect-meanswhen-approachingour-countssuggested-thatapparently-very-highmay-be-a-consequenceall-refutealso-providedbelong-tocan-be-separatedwith-respect-tohas-been-reportedmembers-ofprovide-importantfor-exampledue-tothese-form-the-basisonly-fivepublished-thus-farwith-variable-qualitiesregardingwas-successfully-usedof-thecomparedyieldedboth-in-termsto-dateextend-our-knowledgeacrosswas-identified-and-comparedwith-existingpresented-in-this-paperare-amongwill-increaseby-serving-asfrom-larvae-ofare-given-onof-the-adultused-bothto-evaluatethere-was-nodespitegiven-theimplied-thatis-implausibly-smalldo-not-explainat-small-scalescould-account-forfor-instancemay-thenover-larger-scalescould-reducemay-date-fromhave-rarely-examinedyet-these-processesmay-be-central-tofrom-the-rivers-and-streamsaspects-ofare-reported-herecan-be-used-ashigh-level-overview3-5-sentencesphysical-description-onlyhow-to-distinguishenvironment-and-conditionsgeographic-range-onlytiming-of-activityfeeding-habitsdevelopmental-stagesnotable-actions-or-habitsrole-in-ecosysteminteraction-with-humansmust-include-reasononly-if-meaningfulonly-for-important-additional-contextclear-direct-sentencesno-fluff-or-fillerno-repeating-taxonomyno-overly-technical-jargonprefer-concretehigh-only-if-most-fields-well-supportedmedium-if-partial-but-reliablelow-if-sparse-datatrue-only-if-generalization-usedstrictly-matchno-commentary-outside-JSONgenerate-taxon-recordtaxonPlectrocnemiaoptional-contextmay-be-incompleteif-a-field-cannot-be-supportedkeep-each-section-focusedprovide-useful-detailfactual-correctnessclarityverbosityusefulnessspeculationinformation-not-clearly-supporteddo-not-infer-species-level-traitsfrom-higher-taxaunless-explicitly-justifieddo-not-repeatsame-informationmultiple-fieldseach-field-must-containunique-non-overlapping-contentuse-cautious-languageaccurateconservativeinformativestructuredrecordsscientificNamecanonicalNamescientificNameAuthorshiptaxonRankcommonNamessubfamilyspeciesEpithetsubspeciesEpithetPlusiini
Plusiini is the largest tribe within the Plusiinae subfamily of Noctuidae moths. The tribe was established by Boisduval in 1828 and contains numerous genera, with at least one additional undescribed genus known to exist. Members of this tribe are commonly known as looper moths or owlet moths, though these common names are shared with related groups. The tribe has been extensively documented, with over 137,000 observations recorded on iNaturalist.
Poaphilini
Poaphilini is a tribe of moths within the family Erebidae. Phylogenetic studies have shown this tribe to be most closely related to Ophiusini. The genera Achaea, Mimophisma, and Ophisma have been reclassified into Poaphilini based on molecular evidence, having formerly been placed in Ophiusini. The tribe contains multiple genera of nocturnal moths.
Poecilognathini
Poecilognathini is a tribe of bee flies (family Bombyliidae) established by Evenhuis in 1990. Members are classified within the subfamily Phthiriinae. The tribe contains multiple genera of small to medium-sized flies that share distinctive morphological features related to wing venation and body structure. The group is primarily distributed in the New World tropics and subtropics.
Pogonocherini
Pogonocherini is a tribe of longhorn beetles (Cerambycidae) within the subfamily Lamiinae. The tribe comprises approximately 18 genera distributed primarily in the Nearctic and Neotropical regions. Members are generally small to medium-sized cerambycids with varied morphological adaptations. The genus Pogonocherus is the type genus and among the most species-rich in the tribe.
Pseudoliodini
Pseudoliodini is a tribe of small carrion beetles in the family Leiodidae, established by Portevin in 1926. Members of this tribe are classified within the subfamily Leiodinae and are part of the diverse rove beetle superfamily Staphylinoidea. The tribe contains multiple genera of beetles generally associated with decomposing organic matter.
Psinidiini
Psinidiini is a tribe of band-winged grasshoppers within the subfamily Oedipodinae, established by Otte in 1970. Members of this tribe are classified under the family Acrididae and share the characteristic banded wing patterns typical of the Oedipodinae. The tribe comprises multiple genera distributed primarily in arid and semi-arid regions.
Pteromalini
Pteromalini is a tribe of chalcid wasps within the subfamily Pteromalinae (Pteromalidae). Members are small parasitoid wasps, part of the hyperdiverse superfamily Chalcidoidea. The tribe includes genera such as Miristhma, which contains rare and poorly collected species. Most biological details of the tribe remain undocumented.
Pteropliini
Pteropliini is a tribe of longhorn beetles within the subfamily Lamiinae (Cerambycidae). Members of this tribe are characterized by their elongated antennae and typically robust body forms typical of flat-faced longhorns. The tribe contains multiple genera distributed across tropical and subtropical regions, with some species extending into temperate zones.
Rhamnusiini
Enoploderini
Rhamnusiini is a tribe of longhorn beetles (Cerambycidae) within the subfamily Lepturinae. The tribe was formerly known under the synonym Enoploderini. Members are classified within the diverse lepturine beetle lineage, which contains approximately 150 genera worldwide and is most diverse in the Northern Hemisphere.
Rhingiini
Rhingiini hoverflies
Rhingiini is a tribe of hoverflies (Diptera: Syrphidae) within the subfamily Eristalinae. The tribe contains approximately 13 genera, including the well-known genus Cheilosia and the type genus Rhingia. Members are documented across the Palearctic and other regions, with recent studies expanding known distributions in areas such as Ukraine.
Riodinini
metalmark butterflies
Riodinini is a large tribe of metalmark butterflies within the family Riodinidae. The tribe encompasses numerous genera, though many Riodinidae genera remain unassigned to tribes, making the current genus composition preliminary. Members of this tribe are characterized by their small to medium size and often metallic wing markings that give the family its common name. The tribe has substantial observational data with over 69,000 records on iNaturalist, indicating widespread distribution and ecological presence.
Sciocorini
Sciocorini is a tribe of stink bugs within the family Pentatomidae. The tribe comprises approximately 12 genera, including the type genus Sciocoris. Members are classified as true bugs in the order Hemiptera. The tribe has been documented across multiple continents with substantial observational records.
Scoliopterygini
Scoliopterygini is a tribe of moths within the family Erebidae. The tribe comprises two genera: Ossonoba and Scoliopteryx. Members of this tribe are part of the diverse Erebidae family, which includes many nocturnal moth species.
Scolobatini
Scolobatini is a tribe of ichneumon wasps within the family Ichneumonidae. These wasps are parasitoids, though specific host associations remain poorly documented for the tribe as a whole. The tribe is characterized by morphological features that distinguish it from related groups within the subfamily Ctenopelmatinae, to which it belongs. Knowledge of Scolobatini is limited, with relatively few observations and studies published.
Simplocariini
pill beetles
Simplocariini is a tribe of pill beetles (family Byrrhidae) comprising approximately 9 genera and more than 40 described species. The tribe was established by Mulsant & Rey in 1869 and is classified within the subfamily Byrrhinae. Members of this tribe share the family characteristic of conglobation—the ability to roll into a ball when disturbed. The tribe includes genera distributed across the Holarctic region, with some genera showing more restricted geographic ranges.