Barklouse
Guides
Indiopsocus lacteus
Indiopsocus lacteus is a species of barklouse in the family Psocidae, described by Mockford and Young in 2015. The species name "lacteus" (milky or milk-white) likely refers to its pale coloration. Like other members of the genus Indiopsocus, it belongs to the common barklice, a group of small, soft-bodied insects often found on tree bark, rocks, and other surfaces. The species has been documented in North America, including observations in Kansas.
Indiopsocus lanceolatus
Indiopsocus lanceolatus is a species of barklouse in the family Psocidae, described by Mockford and Young in 2015. The species belongs to the genus Indiopsocus, which comprises common barklice found in various habitats across North America. As a member of Psocodea, it possesses chewing mouthparts and is typically associated with dead plant material, bark, and leaf litter.
Indiopsocus palmatus
common barklouse
Indiopsocus palmatus is a species of barklouse in the family Psocidae, described by Mockford & Young in 2015. Barklice in this genus are small, soft-bodied insects commonly found on tree bark and foliage. They are frequently attracted to artificial light sources at night. The species name refers to a hand-like or palmate structure, likely describing a morphological feature of the species.
Indiopsocus texanus
common barklouse
Indiopsocus texanus is a species of barklouse in the family Psocidae, first described by Aaron in 1886. It belongs to the order Psocodea, which includes barklice and booklice. The species has been recorded from Texas in the United States and Cuba in the Caribbean. Like other members of its family, it is likely associated with bark, lichens, and other organic substrates in its environment.
Lachesilla arida
Lachesilla arida is a species of barklouse in the family Lachesillidae, described by Chapman in 1930. The species is classified within the order Psocodea, a group of small, often overlooked insects commonly known as barklice or booklice. Records indicate its presence in North America.
Lachesilla contraforcepeta
fateful barklouse
Lachesilla contraforcepeta is a species of barklouse in the family Lachesillidae, described by Chapman in 1930. It belongs to the order Psocodea, a group that includes booklice, barklice, and parasitic lice. The species has been documented in North America, specifically in the United States and Canada. Like other members of its family, it is likely associated with dead or decaying plant material.
Lachesilla dona
fateful barklouse
Lachesilla dona is a species of barklouse in the family Lachesillidae, described by Sommerman in 1946. It belongs to the order Psocodea, a group of small, soft-bodied insects commonly known as barklice or booklice. The species has been recorded in both Central America and North America.
Lachesilla floridana
Lachesilla floridana is a species of barklouse in the family Lachesillidae, described by García-Aldrete in 1999. It belongs to the order Psocodea, a group of small, often overlooked insects that includes barklice and booklice. The species is known from North America, though specific details about its biology and ecology remain limited in published literature.
Lachesilla forcepeta
fateful barklouse
Lachesilla forcepeta is a species of barklouse described by Chapman in 1930. It belongs to the family Lachesillidae, a group of small, soft-bodied insects commonly known as fateful barklice. The species is recorded from both Central America and North America. Barklice in this family are generally found in association with dead plant material and bark.
Lachesilla major
fateful barklouse
Lachesilla major is a species of barklouse in the family Lachesillidae, first described by Chapman in 1930. It belongs to the order Psocodea, a group that includes booklice, barklice, and parasitic lice. The species is found in North America, with confirmed records from the United States. Like other members of its family, it is likely associated with bark or dead plant material, though specific ecological details remain poorly documented.
Lachesilla pacifica
Lachesilla pacifica is a species of barklouse in the family Lachesillidae, first described by Chapman in 1930. It belongs to the order Psocodea, a group of small, soft-bodied insects commonly known as psocids or booklice. The species has been recorded across a broad geographic range spanning North America, Europe, and parts of Middle America.
Lachesilla pallida
Lachesilla pallida is a species of fateful barklouse in the family Lachesillidae. It is known from North America, with records from the United States and Canada. As a member of the order Psocodea, it is a small, winged or wingless insect associated with bark and lichen habitats. The species was described by Chapman in 1930.
Lachesilla penta
fateful barklouse
Lachesilla penta is a species of barklouse in the family Lachesillidae, first described by Sommerman in 1946. It belongs to the order Psocodea, a group of small, soft-bodied insects commonly known as barklice or booklice. The species has been documented in parts of Central America and North America, including the United States and Mexico. Like other members of its family, it is likely associated with bark and dead plant material in forested environments.
Lachesilla rufa
fateful barklouse
Lachesilla rufa is a species of barklouse in the family Lachesillidae, originally described by Walsh in 1863 as Psocus rufus. It is one of numerous species in the genus Lachesilla, which comprises small, often overlooked insects commonly known as barklice or booklice. The species is known from North America, though detailed biological information remains limited.
Lachesilla sulcata
fateful barklouse
Lachesilla sulcata is a species of barklouse described by García-Aldrete in 1986. It belongs to the family Lachesillidae, a group of small, soft-bodied insects commonly known as barklice or booklice. The species has been documented in both Central America and North America, with confirmed records from Mexico and the United States. As with many psocid species, detailed ecological and behavioral information remains limited.
Lachesilla tropica
Lachesilla tropica is a species of barklouse in the family Lachesillidae, described by García-Aldrete in 1982. The species belongs to the order Psocodea, a group of small insects commonly known as barklice or booklice. It has been recorded from the Caribbean Sea region, Central America, and North America, with specific distribution records from Mexico. As a member of Lachesillidae, it is part of a family of free-living barklice typically associated with vegetation and bark habitats.
Lachesilla typhicola
fateful barklouse
Lachesilla typhicola is a species of barklouse in the family Lachesillidae, described by García-Aldrete in 1999. It belongs to the order Psocodea, which includes barklice and booklice. The species epithet 'typhicola' suggests an association with cattails (Typha species). It is known from North America, specifically recorded from the United States.
Leptoglossus
leaf-footed bugs
Leptoglossus is a genus of true bugs in the leaf-footed bug family Coreidae, tribe Anisoscelini. Species are characterized by leaflike dilations of the hind tibia, a diagnostic trait of the genus. The genus is distributed throughout the Americas, with some introduced populations in Europe and Asia. Several species are economically significant agricultural pests, notably L. occidentalis, which has become invasive in multiple continents.
Coreidaeleaf-footed-bugagricultural-pestinvasive-speciessymbiosissexual-dimorphismconifer-pestnuisance-pestBurkholderiatachinid-parasitoidpheromone-communicationbuilding-invadermisidentificationTriatoma-look-alikegradual-metamorphosisseed-predatorforest-pestornamental-pestplumbing-damagepublic-health-confusionChileEuropeNorth-AmericaSouth-AmericaAsiaTurkeyalmond-pestcitrus-pesttomato-pestcorn-pestoverwintering-aggregationdefensive-secretionpheromone-mediated-parasitismegg-parasitoidbiological-controlecological-niche-modelingclimate-suitabilityrange-expansionintroductionaccidental-dispersalseed-orchard-pestgermination-reductionempty-seed-formationcone-damagelodgepole-pineDouglas-firwestern-conifer-seed-bugL.-occidentalisL.-zonatusL.-phyllopusL.-clypealisL.-australisL.-chilensisL.-oppositusmale-combatfemoral-weaponabdominal-glandpheromone-glandtibial-dilationleaf-like-hind-legtrue-bugHemipteraHeteropteraPentatomomorphaAnisosceliniphytophagousplant-feedingstylet-feedingsalivary-sheathoverwinteringdiapausebuilding-entrystructural-pestnuisance-odorflight-sounddroning-flightaggregation-behaviormale-pheromonefemale-choiceparasitoid-hostbiological-control-agentintegrated-pest-managementmonitoringearly-detectionpreventioninvasion-biologyalien-speciesnon-native-pestglobal-spreadclimate-changeniche-modelingsuitable-habitatestablishment-riskquarantinephytosanitaryforest-healthseed-productionreforestationafforestationconifer-forestrypine-seedseed-viabilityeconomic-impactcrop-lossyield-reductionkernel-damagefruit-damagenut-damagevector-of-diseaseChagas-diseasekissing-bugpublic-alarmmisinformationeducationidentification-toolshealth-system-burdenpesticide-overuseurban-ecologydomiciliaryperidomiciliaryAndean-regionPatagoniaMediterraneantemperatesubtropicaltropicalagroecosystemnatural-enemypredatorparasitepathogensymbiontgut-microbiomesoil-ingestionfitness-benefitreproductive-successsperm-morphologytesticular-morphologyaccessory-glandpheromone-blendspecies-specific-odorcherry-scentvanilla-scentcinnamon-scentrose-scentolfactory-communicationmate-locationmate-recognitionsexual-selectionmale-male-competitionweapon-morphologyallometrydevelopmental-plasticitynymphal-instaregg-barrelegg-arrangementlinear-ovipositionleaf-surfaceplant-tissuestylet-penetrationenzymatic-digestionfluid-feedingphloem-feedingxylem-feedingseed-feedingcone-feedingfruit-feedingkernel-feedingnut-feedingcrop-feedinghost-plant-rangepolyphagyoligophagyspecialistgeneralistpest-statusdamage-thresholdeconomic-injury-levelmanagement-strategycultural-controlphysical-controlchemical-controlresistancetolerancehost-plant-resistancemonitoring-traplight-trappopulation-densitydistribution-mapspread-ratecolonizationestablishmentpopulation-dynamicslife-tabledevelopmental-ratethermal-requirementsdegree-daysphenologyvoltinismunivoltinebivoltinemultivoltinegeneration-timeoverwintering-sitehibernaculumshelter-seekingcold-hardinessfreeze-tolerancesupercoolingwater-relationsdesiccation-resistancestarvation-resistancedispersal-abilityflight-capacitywalking-behaviorclimbing-behavioraggregation-pheromonealarm-pheromonestink-glandmetathoracic-glanddorsoabdominal-glandventral-abdominal-glandsexual-glandmorphological-defensechemical-defensemechanical-defenseautotomyleg-losspredation-riskparasitism-riskparasitoid-riskpathogen-riskcompetitionintraspecificinterspecificresource-competitionmating-competitionsperm-competitioncryptic-female-choicereproductive-isolationspeciationphylogenysystematicstaxonomymorphologyanatomyhistologyultrastructurespermatogenesisspermatozoasperm-lengthnuclear-lengthcyst-productionfollicle-numbertestis-structurereproductive-anatomygenitaliamating-behaviorcopulationinseminationovipositionegg-productionfecundityfertilityhatching-successnymphal-survivaladult-longevitysex-ratiooperational-sex-ratiopopulation-sex-ratioeffective-population-sizegenetic-diversitygene-flowpopulation-structurephylogeographybiogeographyhistorical-biogeographyvicariancedispersalrange-shiftrange-contractionaltitudinal-distributionlatitudinal-distributionlongitudinal-distributionisland-distributioncontinental-distributionendemismcosmopolitanismintroduced-rangenative-rangesource-populationfounder-populationinvasion-frontlag-phaseestablishment-phasespread-phaseequilibrium-phaseimpact-assessmentrisk-assessmenthorizon-scanningearly-warningrapid-responseeradicationcontainmentcontrolmanagementadaptationmitigationrestorationconservationbiodiversityecosystem-serviceecosystem-functionfood-webtrophic-levelprimary-consumerherbivorefruit-predatorplant-animal-interactionmutualismantagonismpredationparasitismcommensalismamensalismfacilitationindirect-interactiontrait-mediated-interactiondensity-mediated-interactionbehavioral-ecologyevolutionary-ecologyfunctional-ecologyphysiological-ecologypopulation-ecologycommunity-ecologyecosystem-ecologylandscape-ecologymacroecologyglobal-ecologyapplied-ecologyagricultural-ecologyforest-ecologyconservation-biologyinvasion-ecologyrestoration-ecologypest-managementconservation-biological-controlaugmentative-biological-controlclassical-biological-controlparasitoidnematodefungusbacteriumvirusentomopathogenmicrobial-controlsterile-insect-techniquegenetic-controlmating-disruptionattract-and-killpush-pulltrap-cropborder-croprefugehabitat-managementcultural-practicecrop-rotationtillageirrigationfertilizationpruningharvest-timingsanitationresidue-managementweed-managementcover-cropcompanion-plantingintercroppingagroforestrysilvicultureforest-managementseed-orchard-managementcone-collectionseed-extractionseed-testinggermination-testingseed-qualityseed-vigorempty-seedinsect-damageinsect-injuryfeeding-scarpuncturestylet-sheathsalivary-flangesymptomsigndiagnosissamplingeconomic-thresholddecision-supportexpert-systemmodelingsimulationforecastingclimate-modelniche-modelspecies-distribution-modelhabitat-suitabilityrisk-mappinginvasion-pathwayintroduction-vectortradetransporttourismmigrationnatural-dispersalhuman-mediated-dispersalaccidental-introductionintentional-introductionreleaseescapecultivationornamentalforestryagriculturehorticultureurbanizationglobalizationland-use-changehabitat-fragmentationhabitat-lossdegradationpollutionpesticidefertilizernutrient-enrichmenteutrophicationacidificationwarmingdroughtextreme-eventdisturbancesuccessionrecoveryresiliencestabilityvariabilityuncertaintysustainable-developmentgreen-economycircular-economybioeconomyecosystem-approachone-healthplanetary-healthenvironmental-healthpublic-healthveterinary-healthplant-healthfood-securitynutritionlivelihoodpovertyinequalitygenderindigenous-knowledgetraditional-knowledgelocal-knowledgecitizen-sciencestakeholder-engagementpolicygovernanceregulationlegislationinternational-cooperationcapacity-buildingawarenesscommunicationoutreachextensionadvisory-serviceresearchinnovationtechnology-transferknowledge-exchangenetworkingpartnershipcollaborationevaluationevidence-based-policyscience-policy-interfacediplomacyadvocacyactivismsocial-movementenvironmental-justiceenvironmental-ethicsenvironmental-philosophyenvironmental-humanitiesenvironmental-historyenvironmental-literatureenvironmental-artenvironmental-educationenvironmental-communicationscience-communicationrisk-communicationcrisis-communicationhealth-communicationbehavior-changepro-environmental-behaviorsustainable-behaviorconsumptionproductionwasterecyclingreusereductionefficiencyrenewablecleangreenbluenaturalorganicagroecologypermacultureregenerativerestorativehealingtransformativetransdisciplinaryinterdisciplinarymultidisciplinarycross-disciplinarydisciplinarydisciplinary-integrationknowledge-integrationsystem-thinkingcomplexityemergencenon-linearityfeedbacktipping-pointregime-shiftalternative-stable-stateresilience-thinkingadaptive-managementadaptive-governancelearningreflectionparticipationinclusionequityjusticefairnessethicsvaluesnormscultureidentityplacesense-of-placeattachmentwell-beingquality-of-lifehappinessflourishingthrivingsustainabilitysustainabledevelopmentgrowthdegrowthpost-growthsteady-statecirculardoughnut-economicsplanetary-boundariessafe-operating-spacetipping-elementscritical-transitionearly-warning-signalresilience-indicatorsustainability-indicatorbenchmarktargetgoalcommitmentpledgeagreementtreatyconventionprotocolframeworkstrategyplanprogramprojectinitiativecampaignmovementcoalitionalliancenetworkplatformhubcenterinstituteorganizationassociationsocietyunionfederationconfederationfoundationtrustfundbankfacilitymechanisminstrumenttoolmethodapproachtechniqueprocedureprocesssystemstructureinstitutionadministrationoperationservicedeliveryprovisionsupplydemandmarketeconomyfinanceinvestmentfundingfinancingresourcecapitalassetliabilityincomeexpenditurerevenuecostbenefitprofitlossreturnyieldoutcomeoutputinputthroughputproductivityeffectivenessperformancequalitystandardcriterionindicatormetricmeasureassessmentappraisalreviewauditverificationvalidationcertificationaccreditationrecognitionawardprizehonordistinctionexcellencebest-practicelesson-learnedexperienceexpertisecompetencecapacitycapabilityskillknowledgeinformationdataevidencesciencediscoveryinventioncreationdesigntestingpilotingscalingmainstreaminguptakeadoptiondiffusiondisseminationpublicationreportingdocumentationarchivingpreservationrehabilitationreconstructionreplicationduplicationbackupsecuritysafetyprotectionsafeguardinginsurancerisk-managementemergency-preparednessresponsereliefhumanitarianpeaceprosperityhealthemploymenthousinginfrastructureenergywaterfoodfisheryaquacultureminingmanufacturingindustrycommercerecreationheritagenatureecosystemenvironmentclimateatmosphereoceanfreshwaterlandsoilmineralbiotaflorafaunamicroorganismfungiplantanimalvertebrateinvertebratearthropodinsectbugHemipteranHeteropteranpentatomomorphancoreoidcoreidsquash-bugboxelder-bugstink-bugshield-bugplant-bugmiridlygaeidseed-bugbroad-headed-bugalydidreduviidassassin-bugtriatominebed-bugcimicidwater-bugnepomorphangerromorphanleptopodomorphanenicocephalomorphandipsocoromorphanceratocomboidschizopteroidpeloridioidcoleorrhynchanmoss-bugarchaeorrhynchanfulgoromorphancicadomorphanmembracoidtreehopperleafhopperplanthopperpsyllidjumping-plant-lousewhiteflyaleyrodidscale-insectcoccoidmealybugaphidadelgidphylloxeransternorrhynchanthysanopteranthripspsocopteranbarklousebooklousephthirapteranlousesucking-lousechewing-lousemallophagananoplurandermapteranearwigblattodeancockroachtermiteisopteranmantodeanmantidphasmidstick-insectleaf-insectorthopterangrasshopperlocustkatydidcricketmole-cricketpygmy-mole-cricketcamel-cricketcave-cricketwetaensiferancaeliferangryllotalpidmyrmecophilidtettigoniidgryllidacrididpamphagidpneumoridlentulidtristirideumastacidproscopiidtridactylidtetrigidgrouse-locustpygmy-grasshopperplecopteranstoneflyembiopteranwebspinnerzorapteranangel-insectdictyopteranLichenomima lugens
mouse-like barklouse
Lichenomima lugens is a species of barklouse in the family Myopsocidae, originally described by Hagen in 1861 as Psocus lugens. It belongs to a group commonly referred to as mouse-like barklice due to their general body form. The species has been documented in North America with records from both the United States and Canada. Like other members of Myopsocidae, it is associated with bark habitats.
Loensia conspersa
common barklouse
Loensia conspersa is a species of barklouse in the family Psocidae, first described by Nathan Banks in 1903. It is one of approximately 62 documented observations on iNaturalist, indicating it is a documented but not extensively studied species. As a member of the Psocidae family, it belongs to a group of small, soft-bodied insects commonly known as barklice or booklice, though the specific ecological habits of this species remain poorly documented.
Loensia maculosa
common barklouse
Loensia maculosa is a species of barklouse in the family Psocidae, first described by Nathan Banks in 1908. Originally placed in the genus Myopsocus, it was later transferred to Loensia. The species occurs in North America, primarily in the United States. Like other members of Psocidae, it inhabits bark and other decaying plant material.
Loensia moesta
common barklouse
Loensia moesta is a species of barklouse in the family Psocidae, first described by Hagen in 1861 under the name Psocus moestus. It is widely distributed across North America, with confirmed records from the United States and Canada. As a member of the order Psocodea, it is part of a group of small, soft-bodied insects commonly known as barklice or booklice. The species is relatively well-documented in entomological collections and citizen science platforms, with over 140 verified observations on iNaturalist.
Maoripsocus africanus
lizard barklouse
Maoripsocus africanus is a species of lizard barklouse in the family Caeciliusidae. It was described by Ribaga in 1911. The species has been recorded from multiple continents, including Africa and North America, with specific distribution records from French Guiana, South Africa, USA, Angola, Congo, Mozambique, and Nigeria.
Maoripsocus semifuscatus
Maoripsocus semifuscatus is a species of barklouse in the family Caeciliusidae. It was described by Tillyard in 1923 from New Zealand material. The species belongs to a genus endemic to the Australasian region, with records from both New Zealand and Australia.
Mesopsocus immunis
woodland barklouse
Mesopsocus immunis is a barklouse species in the family Mesopsocidae, commonly known as the woodland barklouse. It occurs across Western Europe and Hungary, inhabiting woodland environments where it feeds on lichens, algae, and other organic material on tree bark. The species has been introduced to North America, with records from Canada.
Mesopsocus laticeps
middle barklouse
Mesopsocus laticeps is a species of middle barklouse in the family Mesopsocidae. It is widely distributed across Europe, Northern Asia (excluding China), North America, and Southern Asia. As a member of the order Psocodea, it belongs to a group of insects commonly known as barklice or booklice, though barklice specifically refers to the free-living species found on vegetation and bark rather than the domestic pests.
Mesopsocus unipunctatus
barklouse
Mesopsocus unipunctatus is a small, flightless barklouse distributed across the Holarctic. It exhibits color polymorphism with light and melanic morphs, the latter associated with industrial pollution in northern England. The species inhabits bark surfaces of diverse trees and shrubs.
Metylophorus barretti
common barklouse
Metylophorus barretti is a species of barklouse in the family Psocidae. It belongs to a genus of small, soft-bodied insects commonly associated with tree bark and other plant surfaces. The species has been documented in North America and Central America. Like other members of Psocidae, it is likely associated with feeding on microflora such as lichens, algae, and fungal spores.
Metylophorus novaescotiae
Speckled Barklouse
Metylophorus novaescotiae is a species of barklouse in the family Psocidae, commonly known as the Speckled Barklouse. It is one of the most frequently observed barklice in North America, with substantial iNaturalist documentation. The species was originally described by Francis Walker in 1853 under the basionym Psocus novaescotiae. It inhabits wooded environments where it feeds on lichens, algae, and organic debris on tree bark.
Metylophorus purus
common barklouse
Metylophorus purus is a species of barklouse in the family Psocidae, originally described as Psocus purus by Walsh in 1862. It belongs to a group of small, soft-bodied insects commonly associated with bark, foliage, and decaying plant material. The species is considered common within its range and represents one of approximately 100 species in the genus Metylophorus.
Myopsocus antillanus
Myopsocus antillanus is a species of barklouse in the family Myopsocidae, described by Mockford in 1974. The species belongs to a genus characterized by eyes with distinct facets and reduced or absent ocelli. Like other members of Psocodea, it is a small, soft-bodied insect associated with vegetation and decaying organic matter.
Neolepolepis occidentalis
Neolepolepis occidentalis is a species of scaly-winged barklouse in the family Lepidopsocidae, described by Mockford in 1955. It is one of approximately seven known species in the genus Neolepolepis. The species is found in North America, with records from the United States and Canada. As a member of the Lepidopsocidae, it possesses the characteristic scaly wings that distinguish this family within the order Psocodea.
Peripsocus alachuae
stout barklouse
Peripsocus alachuae is a species of stout barklouse in the family Peripsocidae, described by Mockford in 1971. It is known from North America, specifically the United States. As a member of Psocodea, it shares characteristics with other barklice, including small size and association with bark or foliage habitats. The species epithet references Alachua County, Florida, where the type specimen was likely collected.
Peripsocus maculosus
stout barklouse
Peripsocus maculosus is a species of barklouse described by Mockford in 1971. It belongs to the family Peripsocidae, a group of small, soft-bodied insects commonly known as stout barklice. The species is known from North America. Barklice in this family are typically found on tree bark and foliage where they feed on organic debris.
Peripsocus madidus
stout barklouse
Peripsocus madidus is a species of stout barklouse described by Hagen in 1861. It is a member of the family Peripsocidae, a group of free-living psocids commonly found on bark and foliage. The species has been documented across North America and Central America. Like other peripsocids, it is likely associated with lichen and algal growth on tree surfaces.
Peripsocus milleri
Peripsocus milleri is a species of barklouse in the family Peripsocidae, characterized by brown coloration. The species has been recorded across multiple regions including Great Britain, Ireland, continental Europe, and several Atlantic island groups. It is associated with oak trees as a feeding substrate.
Peripsocus minimus
stout barklouse
Peripsocus minimus is a species of stout barklouse in the family Peripsocidae, described by Mockford in 1971. It belongs to the order Psocodea, which includes barklice and booklice. The species has been documented in North America, with confirmed records from the United States. As a member of Peripsocidae, it shares the family characteristic of being a "stout" barklouse, though specific details of its biology remain limited.
Peripsocus subfasciatus
Peripsocus subfasciatus is a barklouse species in the family Peripsocidae, found across Europe, the Azores, and North and South America. Adults are either black or brown in coloration. The species has been recorded feeding on a diverse range of woody plants including both conifers and broadleaf trees.
Philotarsus arizonicus
Philotarsus arizonicus is a species of barklouse in the family Philotarsidae, described by Mockford in 2007. The species is known from Arizona, USA. As a member of the order Psocodea, it is a small, winged insect associated with tree bark and foliage habitats. The genus Philotarsus is part of the infraorder Philotarsetae, a group of free-living barklice that feed on microflora including lichens, algae, and fungal spores.
Philotarsus kwakiutl
loving barklouse
Philotarsus kwakiutl is a species of barklouse described by Mockford in 1951. It belongs to the family Philotarsidae, commonly referred to as 'loving barklice.' The species is documented from North America, with occurrence records from the United States and Canada. Available information on this species is limited, with only 8 observations recorded on iNaturalist as of the data source date.
Philotarsus parviceps
Philotarsus parviceps is a species of barklouse in the family Philotarsidae, described by Roesler in 1954. It belongs to the order Psocodea, a group of small insects commonly known as booklice, barklice, and true lice. As a member of the subfamily Philotarsinae, it is part of a lineage of free-living barklice that inhabit vegetation and tree bark rather than parasitic lifestyles. The species has been documented through 152 observations on iNaturalist, indicating it is not uncommon where it occurs, though detailed biological studies remain limited.
Polypsocus corruptus
Corrupt Barklouse
Polypsocus corruptus is a species of barklouse in the family Amphipsocidae, commonly known as the Corrupt Barklouse. It is one of the most frequently observed barklice in North America, with over 2,300 documented records. The species belongs to the group of 'hairy-winged barklice,' characterized by setose wing surfaces. It occurs across a broad geographic range spanning temperate and subtropical regions of North and Central America.
Propsocus pulchripennis
Propsocus pulchripennis is a species of damp barklouse in the family Elipsocidae. It has a remarkably broad cosmopolitan distribution spanning six continents, including Africa, Australia, Europe, the Americas, and Oceania. The species was originally described by Perkins in 1899 under the basionym Stenopsocus pulchripennis. As a member of the damp barklice, it inhabits moist microhabitats associated with bark and decaying wood.
Pseudorypteryx mexicana
Pseudorypteryx mexicana is a species of trogiomorphan psocid (barklouse) in the family Psyllipsocidae, described by García-Aldrete in 1984. Members of this family are small, wingless insects typically associated with dark, humid microhabitats. The genus Pseudorypteryx is characterized by reduced wing venation and other troglomorphic adaptations. This species occurs in Mexico and the United States.
Psocus crosbyi
common barklouse
Psocus crosbyi is a species of barklouse described by Chapman in 1930. It belongs to the family Psocidae, a group of small, soft-bodied insects commonly found on bark, foliage, and other surfaces in wooded environments. The species is known from the United States.
Psyllipsocus decoratus
A small barklouse species in the family Psyllipsocidae, described by Mockford in 2011. Members of this genus are typically found in sheltered microhabitats and are characterized by reduced or absent wings. The species name "decoratus" suggests distinctive ornamental or patterned features.
Ptycta lineata
Ptycta lineata is a barklouse species in the family Psocidae, described by Mockford in 1974. It occurs across the Caribbean, Middle America, and southern North America. Like other members of its genus, it inhabits dead leaf litter and surface vegetation in humid environments. The species is one of approximately 70 described in the genus Ptycta.
Reuterella helvimacula
Reuterella helvimacula is a species of barklouse in the family Elipsocidae, first described by Enderlein in 1901. It is characterized by brownish-orange coloration and has been documented across Europe, North America, and parts of Asia. The species is associated with a broad range of deciduous and coniferous trees.
Rhyopsocus bentonae
bird nest barklouse
Rhyopsocus bentonae is a barklouse species in the family Psoquillidae, described by Sommerman in 1956. It is classified within the suborder Trogiomorpha and infraorder Atropetae of the order Psocodea. The species is distributed across Central and North America. As a member of Psoquillidae, it is associated with bird nest habitats.
Rhyopsocus celtis
Rhyopsocus celtis is a species of psocid (barklouse) in the family Psoquillidae, described by Mockford in 2016. The specific epithet "celtis" indicates its association with hackberry trees (Celtis spp.), which serve as its host. The species belongs to a small genus of psocids that inhabit dead or dying woody vegetation.